F401944

General Info

Members Datasets Scaffolds Average Seq Length
312 217 289 342

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2795385472|2795791626
Length 336
Sequence GRYDDRMTYRRCGRSGLLLPAISLGLWHNFGDDKPLETQTAILRRAFDLGVTHFDLANNYGPPYGSAEINFGGHLARDFTPFRDELIISSKAGYDMWPGPYGQGGGSRKYVLASLDQSLARLGLDYVDIFYSHRFDPDTPLEETMGALDTAVRSGKALYAGISSYSAERTREAAAILRDLGTPLLIHQPSYSMLNRWIEEDLLDATGELGVGVIAFSPLAQGMLTDRYLDGVPADSRAAQGKSLSRDMLDEDTLRHVRALNEIAKQRGQSLAQLALAWVLRDDRVTSTVIGASSVKQLEDNLAAVGNLSFSADELAAIDADAVEAGINIWQRSSEG

Samples

Sample ID Description Type Environment
1 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
2 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
3 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
4 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
5 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
6 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
7 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
8 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
9 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
10 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
11 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
12 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
13 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
14 2891562705 Microbispora tritici MT50 Isolate Unclassified
15 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
16 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
17 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
18 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
19 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
20 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
21 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
22 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
127 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
217 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.35
Metatranscriptomes 1.28
Isolates 7.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 3.53
Rhizosphere 84.94
Stem 0
Stem Tuber 0.32
Unclassified 9.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10028762 3300003203 Bacteria 2113
2 JGI25404J52841_10002354 3300003659 Bacteria 3562
3 Ga0070658_10018217 3300005327 Bacteria 5619
4 Ga0070683_100255867 3300005329 Bacteria 1666
5 Ga0070680_100013078 3300005336 Bacteria 6460
6 Ga0070682_100127488 3300005337 Bacteria 1718
7 Ga0070667_100025222 3300005367 Bacteria 4942
8 Ga0070667_100050859 3300005367 Bacteria 3492
9 Ga0070714_100000010 3300005435 Bacteria 262871
10 Ga0070714_100126680 3300005435 Bacteria 2278
11 Ga0070714_100272959 3300005435 Bacteria 1568
12 Ga0070713_100053823 3300005436 Bacteria 3336
13 Ga0070713_100089845 3300005436 Bacteria 2640
14 Ga0070713_100097166 3300005436 Bacteria 2545
15 Ga0070713_100237430 3300005436 Bacteria 1659
16 Ga0070711_100300503 3300005439 Bacteria 1276
17 Ga0070705_100210005 3300005440 Bacteria 1341
18 Ga0070700_100000060 3300005441 Bacteria 82198
19 Ga0070708_100026556 3300005445 Bacteria 4958
20 Ga0070663_100000420 3300005455 Bacteria 22378
21 Ga0070663_100081609 3300005455 Bacteria 2377
22 Ga0070678_100116457 3300005456 Bacteria 2100
23 Ga0070707_100058941 3300005468 Bacteria 3682
24 Ga0070698_100353475 3300005471 Bacteria 1401
25 Ga0070699_100053403 3300005518 Bacteria 3497
26 Ga0070679_100380103 3300005530 Bacteria 1359
27 Ga0070697_100276170 3300005536 Bacteria 1441
28 Ga0070693_100068378 3300005547 Bacteria 2084
29 Ga0070665_100104285 3300005548 Bacteria 2838
30 Ga0070665_100360013 3300005548 Bacteria 1461
31 Ga0068855_100001227 3300005563 Bacteria 31817
32 Ga0068855_100044357 3300005563 Bacteria 5262
33 Ga0070664_100275703 3300005564 Bacteria 1516
34 Ga0068857_100028260 3300005577 Bacteria 4948
35 Ga0068856_100076004 3300005614 Bacteria 3327
36 Ga0070702_100000675 3300005615 Bacteria 12793
37 Ga0068852_100013367 3300005616 Bacteria 6283
38 Ga0068863_100047809 3300005841 Bacteria 4057
39 Ga0068860_100000297 3300005843 Bacteria 69029
40 Ga0068860_100075166 3300005843 Bacteria 3213
41 Ga0081538_10001191 3300005981 Bacteria 27404
42 Ga0081540_1000422 3300005983 Bacteria 41886
43 Ga0081540_1016362 3300005983 Bacteria 4645
44 Ga0081539_10000662 3300005985 Bacteria 69140
45 Ga0081539_10003079 3300005985 Bacteria 21456
46 Ga0081539_10005763 3300005985 Bacteria 12356
47 Ga0081539_10009318 3300005985 Bacteria 8238
48 Ga0075365_10008254 3300006038 Bacteria 5895
49 Ga0075365_10084926 3300006038 Bacteria 2149
50 Ga0075432_10001822 3300006058 Bacteria 7019
51 Ga0070715_10001980 3300006163 Bacteria 6172
52 Ga0070716_100062142 3300006173 Bacteria 2164
53 Ga0070712_100034763 3300006175 Bacteria 3417
54 Ga0075428_100010799 3300006844 Bacteria 10150
55 Ga0075436_100154936 3300006914 Bacteria 1613
56 Ga0105240_10025143 3300009093 Bacteria 7831
57 Ga0105240_10425443 3300009093 Bacteria 1491
58 Ga0105245_10005722 3300009098 Bacteria 10916
59 Ga0105247_10080234 3300009101 Bacteria 2055
60 Ga0114129_10309739 3300009147 Bacteria 2102
61 Ga0105243_10007981 3300009148 Bacteria 8131
62 Ga0105242_10002484 3300009176 Bacteria 14462
63 Ga0105242_10147112 3300009176 Bacteria 2050
64 Ga0105248_10476245 3300009177 Bacteria 1407
65 Ga0105238_10187821 3300009551 Bacteria 2043
66 Ga0157370_10022425 3300013104 Bacteria 6282
67 Ga0157370_10163444 3300013104 Bacteria 2071
68 Ga0157370_10208882 3300013104 Bacteria 1810
69 Ga0157369_10007005 3300013105 Bacteria 13009
70 Ga0157369_10133431 3300013105 Bacteria 2630
71 Ga0157369_10383317 3300013105 Bacteria 1459
72 Ga0157378_10169509 3300013297 Bacteria 2046
73 Ga0163162_10045599 3300013306 Bacteria 4392
74 Ga0157372_10262191 3300013307 Bacteria 2007
75 Ga0157375_10112868 3300013308 Bacteria 2818
76 Ga0163163_10123777 3300014325 Bacteria 2622
77 Ga0157380_10069219 3300014326 Bacteria 2847
78 Ga0206354_11454385 3300020081 Bacteria 1753
79 Ga0206353_10484881 3300020082 Bacteria 2376
80 Ga0206353_11067826 3300020082 Bacteria 2819
81 Ga0206353_11650896 3300020082 Bacteria 2857
82 Ga0213875_10001297 3300021388 Bacteria 16615
83 Ga0213875_10003226 3300021388 Bacteria 9364
84 Ga0213875_10010525 3300021388 Bacteria 4626
85 Ga0207692_10002212 3300025898 Bacteria 7442
86 Ga0207680_10003281 3300025903 Bacteria 7622
87 Ga0207699_10001402 3300025906 Bacteria 11442
88 Ga0207699_10093657 3300025906 Bacteria 1891
89 Ga0207643_10138135 3300025908 Bacteria 1454
90 Ga0207705_10010366 3300025909 Bacteria 6777
91 Ga0207705_10013615 3300025909 Bacteria 5868
92 Ga0207705_10051655 3300025909 Bacteria 2959
93 Ga0207705_10140775 3300025909 Bacteria 1801
94 Ga0207695_10034884 3300025913 Bacteria 5463
95 Ga0207695_10354181 3300025913 Bacteria 1355
96 Ga0207671_10049039 3300025914 Bacteria 3125
97 Ga0207693_10071188 3300025915 Bacteria 2721
98 Ga0207663_10044548 3300025916 Bacteria 2724
99 Ga0207652_10022220 3300025921 Bacteria 5244
100 Ga0207652_10402602 3300025921 Bacteria 1235
101 Ga0207646_10044356 3300025922 Bacteria 3991
102 Ga0207659_10309693 3300025926 Bacteria 1300
103 Ga0207687_10003294 3300025927 Bacteria 10926
104 Ga0207700_10034240 3300025928 Bacteria 3645
105 Ga0207700_10035769 3300025928 Bacteria 3580
106 Ga0207700_10070506 3300025928 Bacteria 2687
107 Ga0207700_10104087 3300025928 Bacteria 2270
108 Ga0207700_10121896 3300025928 Bacteria 2115
109 Ga0207700_10143548 3300025928 Bacteria 1964
110 Ga0207664_10000009 3300025929 Bacteria 299246
111 Ga0207664_10002231 3300025929 Bacteria 12764
112 Ga0207664_10005040 3300025929 Bacteria 8988
113 Ga0207664_10101040 3300025929 Bacteria 2382
114 Ga0207664_10191034 3300025929 Bacteria 1763
115 Ga0207686_10012998 3300025934 Bacteria 4595
116 Ga0207665_10129676 3300025939 Bacteria 1788
117 Ga0207689_10128260 3300025942 Bacteria 2086
118 Ga0207667_10002782 3300025949 Bacteria 21659
119 Ga0207667_10016905 3300025949 Bacteria 8230
120 Ga0207667_10034156 3300025949 Bacteria 5464
121 Ga0207667_10074970 3300025949 Bacteria 3513
122 Ga0207668_10020363 3300025972 Bacteria 4213
123 Ga0207668_10022720 3300025972 Bacteria 4021
124 Ga0207658_10037077 3300025986 Bacteria 3500
125 Ga0207658_10122491 3300025986 Bacteria 2076
126 Ga0207678_10000514 3300026067 Bacteria 35082
127 Ga0207678_10012393 3300026067 Bacteria 7484
128 Ga0207678_10054188 3300026067 Bacteria 3454
129 Ga0207708_10000011 3300026075 Bacteria 214227
130 Ga0207702_10197380 3300026078 Bacteria 1863
131 Ga0207702_10199369 3300026078 Bacteria 1854
132 Ga0207641_10026802 3300026088 Bacteria 4758
133 Ga0207674_10008344 3300026116 Bacteria 11986
134 Ga0207674_10026995 3300026116 Bacteria 6087
135 Ga0207674_10162970 3300026116 Bacteria 2184
136 Ga0207683_10006893 3300026121 Bacteria 9728
137 Ga0207683_10086685 3300026121 Bacteria 2784
138 Ga0207698_10014967 3300026142 Bacteria 5178
139 Ga0207428_10142407 3300027907 Bacteria 1829
140 Ga0268266_10003631 3300028379 Bacteria 15261
141 Ga0268264_10000353 3300028381 Bacteria 69101
142 Ga0268264_10001453 3300028381 Bacteria 22147
143 Ga0268264_10018837 3300028381 Bacteria 5645
144 Ga0307515_10237996 3300028794 Bacteria 1598
145 Ga0265338_10017578 3300028800 Bacteria 7701
146 Ga0265340_10000300 3300031247 Bacteria 25972
147 Ga0307513_10028036 3300031456 Bacteria 6450
148 Ga0307509_10016244 3300031507 Bacteria 8623
149 Ga0265313_10110957 3300031595 Bacteria 1206
150 Ga0307413_10094684 3300031824 Bacteria 1956
151 Ga0307410_10005453 3300031852 Bacteria 6737
152 Ga0307406_10150534 3300031901 Bacteria 1659
153 Ga0307407_10207339 3300031903 Bacteria 1317
154 Ga0307412_10031407 3300031911 Bacteria 3354
155 Ga0307409_100021734 3300031995 Bacteria 4406
156 Ga0307409_100046562 3300031995 Bacteria 3284
157 Ga0307409_100067295 3300031995 Bacteria 2828
158 Ga0307409_100276277 3300031995 Bacteria 1550
159 Ga0307416_100004821 3300032002 Bacteria 8203
160 Ga0307416_100145201 3300032002 Bacteria 2165
161 Ga0307416_100465115 3300032002 Bacteria 1321
162 Ga0307415_100082083 3300032126 Bacteria 2305
163 Ga0307415_100334265 3300032126 Bacteria 1269
164 Ga0307507_10040551 3300033179 Bacteria 4675
165 Ga0373926_0032011 3300035083 Bacteria 1855
166 Ga0373923_0020665 3300035111 Bacteria 2560
167 Ga0373936_0026881 3300035113 Bacteria 2255
168 Ga0373945_0012897 3300035116 Bacteria 2783
169 Ga0373953_0033364 3300035117 Bacteria 2013
170 Ga0373957_0084617 3300035120 Bacteria 1254
171 Ga0373943_0131504 3300035170 Bacteria 1339
172 Ga0373935_0005194 3300035692 Bacteria 7666
173 Ga0373927_0059376 3300035695 Bacteria 2473
174 Ga0373933_0123959 3300035724 Bacteria 1620
175 Ga0373925_0000129 3300037068 Bacteria 80897
176 Ga0395900_0087104 3300037418 Bacteria 3210
177 Ga0395898_0256108 3300037466 Bacteria 1669
178 Ga0436364_0145178 3300037853 Bacteria 26239
179 Ga0436364_0447536 3300037853 Bacteria 1524
180 Ga0436364_1416932 3300037853 Bacteria 21451
181 Ga0436364_1489025 3300037853 Bacteria 2626
182 Ga0395901_0010884 3300038443 Bacteria 9218
183 Ga0395901_0025371 3300038443 Bacteria 6085
184 Ga0395901_0043230 3300038443 Bacteria 4674
185 Ga0395901_0103795 3300038443 Bacteria 2983
186 Ga0395901_0416005 3300038443 Bacteria 1379
187 Ga0451853_0637535 3300041512 Bacteria 10626
188 Ga0466969_0008684 3300044656 Bacteria 5389
189 Ga0466969_0071135 3300044656 Bacteria 1673
190 Ga0466965_0207888 3300044683 Bacteria 1040
191 Ga0466966_0013789 3300044684 Bacteria 5347
192 Ga0466966_0016491 3300044684 Bacteria 4878
193 Ga0466966_0071784 3300044684 Bacteria 2169
194 Ga0466961_0034255 3300044693 Bacteria 3260
195 Ga0466961_0070886 3300044693 Bacteria 2212
196 Ga0466961_0118675 3300044693 Bacteria 1661
197 Ga0466961_0121492 3300044693 Bacteria 1640
198 Ga0466961_0171520 3300044693 Bacteria 1349
199 Ga0466971_0032105 3300044719 Bacteria 2353
200 Ga0466971_0073097 3300044719 Bacteria 1558
201 Ga0466971_0079005 3300044719 Bacteria 1499
202 Ga0466968_0039814 3300044735 Bacteria 1979
203 Ga0466970_0017773 3300044765 Bacteria 3677
204 Ga0466970_0024427 3300044765 Bacteria 3160
205 Ga0466970_0051154 3300044765 Bacteria 2205
206 Ga0466957_0164139 3300044842 Bacteria 1444
207 Ga0466957_0181889 3300044842 Bacteria 1373
208 Ga0466959_0013100 3300045049 Bacteria 6005
209 Ga0466959_0124496 3300045049 Bacteria 1830
210 Ga0466959_0139647 3300045049 Bacteria 1713
211 Ga0466958_0021765 3300045836 Bacteria 3750
212 Ga0466967_0010969 3300045976 Bacteria 6831
213 Ga0466967_0139356 3300045976 Bacteria 2258
214 Ga0495592_0255777 3300046454 Bacteria 1155
215 Ga0495641_0072314 3300046461 Bacteria 1547
216 Ga0495653_0098223 3300046463 Bacteria 2126
217 Ga0495580_0070023 3300046472 Bacteria 2450
218 Ga0495580_0116229 3300046472 Bacteria 1858
219 Ga0495662_0011936 3300046476 Bacteria 4245
220 Ga0495664_0036647 3300046477 Bacteria 2891
221 Ga0495594_0030457 3300046499 Bacteria 2920
222 Ga0495606_0017138 3300046507 Bacteria 5490
223 Ga0495608_0003670 3300046511 Bacteria 11039
224 Ga0495628_0333470 3300046516 Bacteria 1117
225 Ga0495630_0102750 3300046517 Bacteria 2162
226 Ga0495652_0251724 3300046529 Bacteria 1308
227 Ga0495665_0012235 3300046531 Bacteria 4643
228 Ga0495586_0080769 3300046535 Bacteria 1786
229 Ga0495586_0102397 3300046535 Bacteria 1589
230 Ga0495622_0084075 3300046557 Bacteria 1464
231 Ga0495667_0003592 3300046559 Bacteria 10432
232 Ga0495635_0144626 3300046663 Bacteria 1619
233 Ga0495657_0115854 3300046675 Bacteria 1692
234 Ga0495623_0086251 3300046679 Bacteria 1935
235 Ga0495613_0165267 3300046689 Bacteria 1572
236 Ga0495624_0063148 3300046690 Bacteria 2315
237 Ga0495600_0023959 3300046809 Bacteria 3928
238 Ga0495604_0080993 3300047317 Bacteria 2431
239 Ga0495672_0024216 3300047320 Bacteria 3915
240 Ga0495680_0061177 3300047322 Bacteria 2897
241 Ga0495675_0106792 3300047444 Bacteria 1749
242 Ga0495593_0124198 3300047673 Bacteria 1312
243 Ga0495614_0065935 3300048089 Bacteria 1557
244 Ga0496101_0200768 3300048904 Bacteria 1542
245 Ga0496105_0015123 3300048908 Bacteria 6142
246 Ga0496107_0229629 3300048910 Bacteria 1381
247 Ga0496108_0001092 3300048911 Bacteria 21182
248 Ga0496108_0054704 3300048911 Bacteria 3349
249 Ga0496109_0067016 3300048912 Bacteria 3288
250 Ga0496112_0033425 3300048915 Bacteria 5000
251 Ga0496113_0021220 3300048916 Bacteria 4579
252 Ga0496114_0034721 3300048917 Bacteria 4162
253 Ga0496115_0041977 3300048918 Bacteria 3643
254 Ga0496115_0347179 3300048918 Bacteria 1211
255 Ga0496126_0017841 3300048929 Bacteria 7062
256 Ga0496126_0049956 3300048929 Bacteria 3815
257 Ga0501034_0004257 3300049571 Bacteria 15964
258 Ga0501036_0001531 3300049572 Bacteria 17856
259 Ga0501036_0015455 3300049572 Bacteria 6376
260 Ga0501037_0010228 3300049573 Bacteria 6884
261 Ga0501037_0088274 3300049573 Bacteria 2244
262 Ga0501039_0128880 3300049575 Bacteria 1985
263 Ga0501039_0360359 3300049575 Bacteria 1142
264 Ga0501042_0004561 3300049578 Bacteria 8839
265 Ga0501043_0007852 3300049579 Bacteria 8438
266 Ga0501046_0021187 3300049580 Bacteria 5367
267 Ga0501047_0012110 3300049581 Bacteria 8164
268 Ga0501048_0010509 3300049582 Bacteria 6909
269 Ga0501048_0044193 3300049582 Bacteria 3186
270 Ga0501071_0180308 3300049587 Bacteria 1582
271 Ga0501071_0266888 3300049587 Bacteria 1293
272 Ga0501072_0034541 3300049588 Bacteria 3963
273 Ga0501073_0175996 3300049589 Bacteria 1481
274 Ga0501074_0003425 3300049590 Bacteria 11242
275 Ga0501074_0142942 3300049590 Bacteria 1711
276 Ga0501076_0033355 3300049592 Bacteria 4019
277 Ga0501077_0019668 3300049593 Bacteria 4271
278 Ga0501079_0016094 3300049741 Bacteria 5715
279 Ga0501081_0028356 3300049743 Bacteria 3778
280 Ga0501081_0126017 3300049743 Bacteria 1827
281 Ga0501044_0043610 3300049823 Bacteria 4659
282 Ga0501044_0132267 3300049823 Bacteria 2488
283 Ga0501044_0288242 3300049823 Bacteria 1574
284 nmdc:mga05p37_304112_c1 3300050507 Bacteria 1893
285 Ga0495612_0050288 3300053078 Bacteria 1711
286 Ga0495595_0014870 3300053084 Bacteria 3309
287 Ga0495619_0013573 3300053085 Bacteria 5133
288 Ga0500646_0043531 3300053090 Bacteria 1271
289 Ga0500616_0000377 3300053153 Bacteria 62514

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0024427 Ga0466970_0024427_2185_3132 315
2 3300025906 Ga0207699_10093657 Ga0207699_100936572 318
3 3300020082 Ga0206353_11067826 Ga0206353_110678262 319
4 3300037466 Ga0395898_0256108 Ga0395898_0256108_560_1585 320
5 3300038443 Ga0395901_0103795 Ga0395901_0103795_725_1750 320
6 3300025908 Ga0207643_10138135 Ga0207643_101381352 325
7 iso_pu_bacteria 2751185782 2753268057 325
8 3300005455 Ga0070663_100000420 Ga0070663_10000042011 326
9 3300026067 Ga0207678_10000514 Ga0207678_100005148 326
10 3300037853 Ga0436364_0145178 Ga0436364_0145178_10086_11066 326
11 3300005983 Ga0081540_1016362 Ga0081540_10163625 328
12 iso_pu_bacteria 2675903060 2676490683 328
13 iso_pu_bacteria 2884693830 2884703623 328
14 iso_pu_bacteria 2895427314 2895435268 328
15 iso_pu_bacteria 2895442618 2895447388 328
16 3300028379 Ga0268266_10003631 Ga0268266_1000363117 329
17 3300031901 Ga0307406_10150534 Ga0307406_101505342 329
18 3300044656 Ga0466969_0008684 Ga0466969_0008684_2587_3579 329
19 3300044656 Ga0466969_0071135 Ga0466969_0071135_16_1005 329
20 3300044683 Ga0466965_0207888 Ga0466965_0207888_30_1019 329
21 3300044684 Ga0466966_0016491 Ga0466966_0016491_252_1244 329
22 3300044693 Ga0466961_0118675 Ga0466961_0118675_498_1490 329
23 3300044693 Ga0466961_0171520 Ga0466961_0171520_161_1153 329
24 3300044719 Ga0466971_0079005 Ga0466971_0079005_485_1477 329
25 3300044765 Ga0466970_0017773 Ga0466970_0017773_2586_3578 329
26 3300044842 Ga0466957_0164139 Ga0466957_0164139_315_1304 329
27 3300045049 Ga0466959_0013100 Ga0466959_0013100_248_1240 329
28 3300046472 Ga0495580_0116229 Ga0495580_0116229_536_1525 329
29 3300048917 Ga0496114_0034721 Ga0496114_0034721_1066_2058 329
30 3300053090 Ga0500646_0043531 Ga0500646_0043531_33_1037 329
31 iso_pu_bacteria 2873314349 2873316338 331
32 iso_pu_bacteria 8055066027 8055073872 331
33 3300033179 Ga0307507_10040551 Ga0307507_100405512 332
34 3300049575 Ga0501039_0360359 Ga0501039_0360359_32_1075 333
35 3300049587 Ga0501071_0180308 Ga0501071_0180308_93_1136 333
36 3300049587 Ga0501071_0266888 Ga0501071_0266888_123_1166 333
37 3300049743 Ga0501081_0126017 Ga0501081_0126017_703_1746 333
38 iso_pu_bacteria 2795385472 2795791626 334
39 3300044693 Ga0466961_0034255 Ga0466961_0034255_2118_3125 335
40 3300048911 Ga0496108_0001092 Ga0496108_0001092_18844_19851 335
41 iso_pu_bacteria 2856741275 2856744193 337
42 iso_pu_bacteria 2891395885 2891399993 337
43 iso_pu_bacteria 2891554331 2891558828 337
44 iso_pu_bacteria 2891562705 2891566611 337
45 iso_pu_bacteria 2899370129 2899370377 337
46 iso_pu_bacteria 2917736166 2917744675 337
47 iso_pu_bacteria 3002998708 3003005385 337
48 iso_pu_bacteria 8055172936 8055174307 337
49 3300021388 Ga0213875_10001297 Ga0213875_100012979 338
50 3300046535 Ga0495586_0102397 Ga0495586_0102397_28_1065 338
51 iso_pu_bacteria 2585427649 2586059656 338
52 iso_pu_bacteria 2915768154 2915772868 338
53 3300005327 Ga0070658_10018217 Ga0070658_100182172 339
54 3300005563 Ga0068855_100001227 Ga0068855_10000122718 339
55 3300009093 Ga0105240_10425443 Ga0105240_104254432 339
56 3300025909 Ga0207705_10013615 Ga0207705_100136152 339
57 3300025913 Ga0207695_10354181 Ga0207695_103541812 339
58 3300025949 Ga0207667_10002782 Ga0207667_1000278211 339
59 3300005548 Ga0070665_100360013 Ga0070665_1003600132 340
60 3300005563 Ga0068855_100044357 Ga0068855_1000443573 340
61 3300005841 Ga0068863_100047809 Ga0068863_1000478092 340
62 3300005843 Ga0068860_100075166 Ga0068860_1000751663 340
63 3300009093 Ga0105240_10025143 Ga0105240_100251434 340
64 3300013104 Ga0157370_10022425 Ga0157370_100224256 340
65 3300013105 Ga0157369_10007005 Ga0157369_100070059 340
66 3300025913 Ga0207695_10034884 Ga0207695_100348844 340
67 3300025928 Ga0207700_10034240 Ga0207700_100342404 340
68 3300025928 Ga0207700_10143548 Ga0207700_101435482 340
69 3300025942 Ga0207689_10128260 Ga0207689_101282602 340
70 3300025949 Ga0207667_10034156 Ga0207667_100341564 340
71 3300025972 Ga0207668_10020363 Ga0207668_100203634 340
72 3300026088 Ga0207641_10026802 Ga0207641_100268023 340
73 3300028381 Ga0268264_10018837 Ga0268264_100188374 340
74 3300031507 Ga0307509_10016244 Ga0307509_100162449 340
75 3300035692 Ga0373935_0005194 Ga0373935_0005194_1249_2274 340
76 3300038443 Ga0395901_0416005 Ga0395901_0416005_259_1281 340
77 3300003659 JGI25404J52841_10002354 JGI25404J52841_100023544 341
78 3300005329 Ga0070683_100255867 Ga0070683_1002558671 341
79 3300005336 Ga0070680_100013078 Ga0070680_1000130784 341
80 3300005337 Ga0070682_100127488 Ga0070682_1001274882 341
81 3300005367 Ga0070667_100025222 Ga0070667_1000252222 341
82 3300005367 Ga0070667_100050859 Ga0070667_1000508592 341
83 3300005435 Ga0070714_100000010 Ga0070714_100000010173 341
84 3300005435 Ga0070714_100126680 Ga0070714_1001266801 341
85 3300005435 Ga0070714_100272959 Ga0070714_1002729591 341
86 3300005436 Ga0070713_100053823 Ga0070713_1000538233 341
87 3300005436 Ga0070713_100089845 Ga0070713_1000898452 341
88 3300005436 Ga0070713_100097166 Ga0070713_1000971662 341
89 3300005436 Ga0070713_100237430 Ga0070713_1002374302 341
90 3300005439 Ga0070711_100300503 Ga0070711_1003005032 341
91 3300005440 Ga0070705_100210005 Ga0070705_1002100052 341
92 3300005441 Ga0070700_100000060 Ga0070700_10000006031 341
93 3300005445 Ga0070708_100026556 Ga0070708_1000265562 341
94 3300005455 Ga0070663_100081609 Ga0070663_1000816093 341
95 3300005456 Ga0070678_100116457 Ga0070678_1001164572 341
96 3300005468 Ga0070707_100058941 Ga0070707_1000589412 341
97 3300005471 Ga0070698_100353475 Ga0070698_1003534751 341
98 3300005518 Ga0070699_100053403 Ga0070699_1000534036 341
99 3300005530 Ga0070679_100380103 Ga0070679_1003801032 341
100 3300005536 Ga0070697_100276170 Ga0070697_1002761702 341
101 3300005547 Ga0070693_100068378 Ga0070693_1000683781 341
102 3300005564 Ga0070664_100275703 Ga0070664_1002757031 341
103 3300005614 Ga0068856_100076004 Ga0068856_1000760043 341
104 3300005615 Ga0070702_100000675 Ga0070702_1000006755 341
105 3300005616 Ga0068852_100013367 Ga0068852_1000133677 341
106 3300005843 Ga0068860_100000297 Ga0068860_10000029717 341
107 3300005981 Ga0081538_10001191 Ga0081538_100011913 341
108 3300005983 Ga0081540_1000422 Ga0081540_10004222 341
109 3300006058 Ga0075432_10001822 Ga0075432_100018226 341
110 3300006163 Ga0070715_10001980 Ga0070715_100019804 341
111 3300006173 Ga0070716_100062142 Ga0070716_1000621422 341
112 3300006175 Ga0070712_100034763 Ga0070712_1000347631 341
113 3300006844 Ga0075428_100010799 Ga0075428_1000107997 341
114 3300006914 Ga0075436_100154936 Ga0075436_1001549362 341
115 3300009098 Ga0105245_10005722 Ga0105245_100057222 341
116 3300009101 Ga0105247_10080234 Ga0105247_100802342 341
117 3300009147 Ga0114129_10309739 Ga0114129_103097392 341
118 3300009148 Ga0105243_10007981 Ga0105243_100079815 341
119 3300009176 Ga0105242_10002484 Ga0105242_100024846 341
120 3300009177 Ga0105248_10476245 Ga0105248_104762451 341
121 3300009551 Ga0105238_10187821 Ga0105238_101878212 341
122 3300013104 Ga0157370_10163444 Ga0157370_101634442 341
123 3300013104 Ga0157370_10208882 Ga0157370_102088821 341
124 3300013105 Ga0157369_10133431 Ga0157369_101334312 341
125 3300013105 Ga0157369_10383317 Ga0157369_103833171 341
126 3300013297 Ga0157378_10169509 Ga0157378_101695092 341
127 3300013306 Ga0163162_10045599 Ga0163162_100455994 341
128 3300013308 Ga0157375_10112868 Ga0157375_101128682 341
129 3300014326 Ga0157380_10069219 Ga0157380_100692191 341
130 3300020081 Ga0206354_11454385 Ga0206354_114543853 341
131 3300021388 Ga0213875_10003226 Ga0213875_1000322610 341
132 3300021388 Ga0213875_10010525 Ga0213875_100105252 341
133 3300025898 Ga0207692_10002212 Ga0207692_100022123 341
134 3300025903 Ga0207680_10003281 Ga0207680_100032814 341
135 3300025906 Ga0207699_10001402 Ga0207699_100014024 341
136 3300025909 Ga0207705_10010366 Ga0207705_100103664 341
137 3300025909 Ga0207705_10051655 Ga0207705_100516554 341
138 3300025909 Ga0207705_10140775 Ga0207705_101407753 341
139 3300025914 Ga0207671_10049039 Ga0207671_100490391 341
140 3300025915 Ga0207693_10071188 Ga0207693_100711883 341
141 3300025916 Ga0207663_10044548 Ga0207663_100445482 341
142 3300025921 Ga0207652_10022220 Ga0207652_100222201 341
143 3300025921 Ga0207652_10402602 Ga0207652_104026022 341
144 3300025922 Ga0207646_10044356 Ga0207646_100443564 341
145 3300025926 Ga0207659_10309693 Ga0207659_103096931 341
146 3300025927 Ga0207687_10003294 Ga0207687_100032942 341
147 3300025928 Ga0207700_10035769 Ga0207700_100357694 341
148 3300025928 Ga0207700_10070506 Ga0207700_100705063 341
149 3300025928 Ga0207700_10104087 Ga0207700_101040873 341
150 3300025928 Ga0207700_10121896 Ga0207700_101218961 341
151 3300025929 Ga0207664_10000009 Ga0207664_10000009104 341
152 3300025929 Ga0207664_10002231 Ga0207664_1000223110 341
153 3300025929 Ga0207664_10005040 Ga0207664_1000504010 341
154 3300025929 Ga0207664_10101040 Ga0207664_101010402 341
155 3300025929 Ga0207664_10191034 Ga0207664_101910342 341
156 3300025934 Ga0207686_10012998 Ga0207686_100129984 341
157 3300025939 Ga0207665_10129676 Ga0207665_101296761 341
158 3300025949 Ga0207667_10016905 Ga0207667_100169055 341
159 3300025949 Ga0207667_10074970 Ga0207667_100749702 341
160 3300025972 Ga0207668_10022720 Ga0207668_100227204 341
161 3300025986 Ga0207658_10037077 Ga0207658_100370772 341
162 3300025986 Ga0207658_10122491 Ga0207658_101224912 341
163 3300026067 Ga0207678_10012393 Ga0207678_100123933 341
164 3300026067 Ga0207678_10054188 Ga0207678_100541881 341
165 3300026075 Ga0207708_10000011 Ga0207708_10000011117 341
166 3300026078 Ga0207702_10197380 Ga0207702_101973803 341
167 3300026078 Ga0207702_10199369 Ga0207702_101993691 341
168 3300026116 Ga0207674_10008344 Ga0207674_100083441 341
169 3300026116 Ga0207674_10162970 Ga0207674_101629703 341
170 3300026121 Ga0207683_10006893 Ga0207683_1000689310 341
171 3300026142 Ga0207698_10014967 Ga0207698_100149672 341
172 3300027907 Ga0207428_10142407 Ga0207428_101424073 341
173 3300028381 Ga0268264_10000353 Ga0268264_1000035350 341
174 3300028800 Ga0265338_10017578 Ga0265338_100175782 341
175 3300031595 Ga0265313_10110957 Ga0265313_101109572 341
176 3300031824 Ga0307413_10094684 Ga0307413_100946842 341
177 3300032126 Ga0307415_100334265 Ga0307415_1003342651 341
178 3300035083 Ga0373926_0032011 Ga0373926_0032011_795_1820 341
179 3300035111 Ga0373923_0020665 Ga0373923_0020665_549_1574 341
180 3300035113 Ga0373936_0026881 Ga0373936_0026881_1067_2092 341
181 3300035116 Ga0373945_0012897 Ga0373945_0012897_49_1074 341
182 3300035117 Ga0373953_0033364 Ga0373953_0033364_72_1097 341
183 3300035120 Ga0373957_0084617 Ga0373957_0084617_103_1128 341
184 3300035170 Ga0373943_0131504 Ga0373943_0131504_220_1245 341
185 3300035695 Ga0373927_0059376 Ga0373927_0059376_216_1241 341
186 3300035724 Ga0373933_0123959 Ga0373933_0123959_53_1081 341
187 3300037068 Ga0373925_0000129 Ga0373925_0000129_76936_77964 341
188 3300037418 Ga0395900_0087104 Ga0395900_0087104_166_1191 341
189 3300037853 Ga0436364_0447536 Ga0436364_0447536_434_1459 341
190 3300037853 Ga0436364_1416932 Ga0436364_1416932_4630_5661 341
191 3300037853 Ga0436364_1489025 Ga0436364_1489025_39_1064 341
192 3300038443 Ga0395901_0025371 Ga0395901_0025371_3570_4595 341
193 3300044693 Ga0466961_0121492 Ga0466961_0121492_139_1164 341
194 3300044719 Ga0466971_0073097 Ga0466971_0073097_53_1078 341
195 3300044735 Ga0466968_0039814 Ga0466968_0039814_635_1663 341
196 3300044842 Ga0466957_0181889 Ga0466957_0181889_168_1193 341
197 3300045836 Ga0466958_0021765 Ga0466958_0021765_2470_3495 341
198 3300045976 Ga0466967_0010969 Ga0466967_0010969_5455_6480 341
199 3300046454 Ga0495592_0255777 Ga0495592_0255777_36_1061 341
200 3300046461 Ga0495641_0072314 Ga0495641_0072314_326_1351 341
201 3300046463 Ga0495653_0098223 Ga0495653_0098223_1066_2091 341
202 3300046472 Ga0495580_0070023 Ga0495580_0070023_804_1829 341
203 3300046476 Ga0495662_0011936 Ga0495662_0011936_1788_2813 341
204 3300046477 Ga0495664_0036647 Ga0495664_0036647_1031_2056 341
205 3300046499 Ga0495594_0030457 Ga0495594_0030457_1629_2654 341
206 3300046507 Ga0495606_0017138 Ga0495606_0017138_395_1429 341
207 3300046511 Ga0495608_0003670 Ga0495608_0003670_531_1556 341
208 3300046516 Ga0495628_0333470 Ga0495628_0333470_36_1061 341
209 3300046517 Ga0495630_0102750 Ga0495630_0102750_1043_2068 341
210 3300046529 Ga0495652_0251724 Ga0495652_0251724_248_1273 341
211 3300046531 Ga0495665_0012235 Ga0495665_0012235_148_1173 341
212 3300046535 Ga0495586_0080769 Ga0495586_0080769_380_1405 341
213 3300046557 Ga0495622_0084075 Ga0495622_0084075_374_1399 341
214 3300046559 Ga0495667_0003592 Ga0495667_0003592_1182_2207 341
215 3300046675 Ga0495657_0115854 Ga0495657_0115854_285_1310 341
216 3300046679 Ga0495623_0086251 Ga0495623_0086251_176_1201 341
217 3300046689 Ga0495613_0165267 Ga0495613_0165267_269_1294 341
218 3300046690 Ga0495624_0063148 Ga0495624_0063148_954_1979 341
219 3300046809 Ga0495600_0023959 Ga0495600_0023959_2628_3653 341
220 3300047317 Ga0495604_0080993 Ga0495604_0080993_1066_2091 341
221 3300047322 Ga0495680_0061177 Ga0495680_0061177_1837_2862 341
222 3300047444 Ga0495675_0106792 Ga0495675_0106792_426_1451 341
223 3300047673 Ga0495593_0124198 Ga0495593_0124198_175_1200 341
224 3300048089 Ga0495614_0065935 Ga0495614_0065935_418_1443 341
225 3300048904 Ga0496101_0200768 Ga0496101_0200768_261_1328 341
226 3300048908 Ga0496105_0015123 Ga0496105_0015123_1978_3045 341
227 3300048911 Ga0496108_0054704 Ga0496108_0054704_1017_2084 341
228 3300048912 Ga0496109_0067016 Ga0496109_0067016_2023_3090 341
229 3300048915 Ga0496112_0033425 Ga0496112_0033425_1828_2895 341
230 3300048916 Ga0496113_0021220 Ga0496113_0021220_697_1764 341
231 3300048918 Ga0496115_0041977 Ga0496115_0041977_2436_3503 341
232 3300048929 Ga0496126_0017841 Ga0496126_0017841_1497_2531 341
233 3300048929 Ga0496126_0049956 Ga0496126_0049956_1426_2454 341
234 3300049571 Ga0501034_0004257 Ga0501034_0004257_5471_6496 341
235 3300049572 Ga0501036_0001531 Ga0501036_0001531_14231_15256 341
236 3300049573 Ga0501037_0010228 Ga0501037_0010228_3275_4300 341
237 3300049578 Ga0501042_0004561 Ga0501042_0004561_6374_7399 341
238 3300049579 Ga0501043_0007852 Ga0501043_0007852_3799_4824 341
239 3300049581 Ga0501047_0012110 Ga0501047_0012110_4795_5820 341
240 3300049582 Ga0501048_0010509 Ga0501048_0010509_1521_2546 341
241 3300049590 Ga0501074_0003425 Ga0501074_0003425_4469_5494 341
242 3300049823 Ga0501044_0043610 Ga0501044_0043610_3185_4210 341
243 3300049823 Ga0501044_0132267 Ga0501044_0132267_1194_2219 341
244 3300049823 Ga0501044_0288242 Ga0501044_0288242_340_1365 341
245 3300050507 nmdc:mga05p37_304112_c1 nmdc:mga05p37_304112_c1_73_1098 341
246 3300053078 Ga0495612_0050288 Ga0495612_0050288_141_1166 341
247 3300053084 Ga0495595_0014870 Ga0495595_0014870_647_1672 341
248 3300053085 Ga0495619_0013573 Ga0495619_0013573_112_1137 341
249 iso_pu_bacteria 2643221567 2643851799 341
250 iso_pu_bacteria 2643221624 2644137612 341
251 iso_pu_bacteria 2808606365 2808872401 341
252 iso_pu_bacteria 2842888712 2842890927 341
253 iso_pu_bacteria 2919446982 2919448745 341
254 3300028381 Ga0268264_10001453 Ga0268264_1000145312 342
255 3300041512 Ga0451853_0637535 Ga0451853_0637535_1241_2269 342
256 3300003203 JGI25406J46586_10028762 JGI25406J46586_100287621 343
257 3300005548 Ga0070665_100104285 Ga0070665_1001042853 343
258 3300005577 Ga0068857_100028260 Ga0068857_1000282604 343
259 3300005985 Ga0081539_10000662 Ga0081539_1000066259 343
260 3300005985 Ga0081539_10003079 Ga0081539_1000307913 343
261 3300005985 Ga0081539_10005763 Ga0081539_100057635 343
262 3300005985 Ga0081539_10009318 Ga0081539_100093182 343
263 3300006038 Ga0075365_10008254 Ga0075365_100082544 343
264 3300006038 Ga0075365_10084926 Ga0075365_100849262 343
265 3300009176 Ga0105242_10147112 Ga0105242_101471122 343
266 3300013307 Ga0157372_10262191 Ga0157372_102621911 343
267 3300014325 Ga0163163_10123777 Ga0163163_101237773 343
268 3300020082 Ga0206353_10484881 Ga0206353_104848812 343
269 3300020082 Ga0206353_11650896 Ga0206353_116508962 343
270 3300026116 Ga0207674_10026995 Ga0207674_100269953 343
271 3300026121 Ga0207683_10086685 Ga0207683_100866852 343
272 3300028794 Ga0307515_10237996 Ga0307515_102379962 343
273 3300031247 Ga0265340_10000300 Ga0265340_100003004 343
274 3300031456 Ga0307513_10028036 Ga0307513_100280366 343
275 3300031852 Ga0307410_10005453 Ga0307410_100054534 343
276 3300031903 Ga0307407_10207339 Ga0307407_102073392 343
277 3300031911 Ga0307412_10031407 Ga0307412_100314072 343
278 3300031995 Ga0307409_100021734 Ga0307409_1000217342 343
279 3300031995 Ga0307409_100046562 Ga0307409_1000465623 343
280 3300031995 Ga0307409_100067295 Ga0307409_1000672952 343
281 3300031995 Ga0307409_100276277 Ga0307409_1002762772 343
282 3300032002 Ga0307416_100004821 Ga0307416_1000048214 343
283 3300032002 Ga0307416_100145201 Ga0307416_1001452012 343
284 3300032002 Ga0307416_100465115 Ga0307416_1004651152 343
285 3300032126 Ga0307415_100082083 Ga0307415_1000820832 343
286 3300038443 Ga0395901_0010884 Ga0395901_0010884_1279_2325 343
287 3300038443 Ga0395901_0043230 Ga0395901_0043230_2922_3968 343
288 3300044684 Ga0466966_0013789 Ga0466966_0013789_3018_4190 343
289 3300044684 Ga0466966_0071784 Ga0466966_0071784_63_1100 343
290 3300044693 Ga0466961_0070886 Ga0466961_0070886_181_1353 343
291 3300044719 Ga0466971_0032105 Ga0466971_0032105_189_1226 343
292 3300044765 Ga0466970_0051154 Ga0466970_0051154_916_1959 343
293 3300045049 Ga0466959_0124496 Ga0466959_0124496_237_1409 343
294 3300045049 Ga0466959_0139647 Ga0466959_0139647_659_1696 343
295 3300045976 Ga0466967_0139356 Ga0466967_0139356_965_2002 343
296 3300046663 Ga0495635_0144626 Ga0495635_0144626_219_1265 343
297 3300047320 Ga0495672_0024216 Ga0495672_0024216_833_1870 343
298 3300048910 Ga0496107_0229629 Ga0496107_0229629_19_1065 343
299 3300048918 Ga0496115_0347179 Ga0496115_0347179_82_1128 343
300 3300049572 Ga0501036_0015455 Ga0501036_0015455_498_1544 343
301 3300049573 Ga0501037_0088274 Ga0501037_0088274_541_1587 343
302 3300049575 Ga0501039_0128880 Ga0501039_0128880_137_1174 343
303 3300049580 Ga0501046_0021187 Ga0501046_0021187_2103_3158 343
304 3300049582 Ga0501048_0044193 Ga0501048_0044193_446_1492 343
305 3300049588 Ga0501072_0034541 Ga0501072_0034541_1134_2189 343
306 3300049589 Ga0501073_0175996 Ga0501073_0175996_370_1422 343
307 3300049590 Ga0501074_0142942 Ga0501074_0142942_497_1552 343
308 3300049592 Ga0501076_0033355 Ga0501076_0033355_1767_2813 343
309 3300049593 Ga0501077_0019668 Ga0501077_0019668_1677_2732 343
310 3300049741 Ga0501079_0016094 Ga0501079_0016094_1875_2930 343
311 3300049743 Ga0501081_0028356 Ga0501081_0028356_1978_3024 343
312 3300053153 Ga0500616_0000377 Ga0500616_0000377_30150_31187 343

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

21

322

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ast-assembly1.cif.gz_F the apo structure of a bacterial aldo-keto reductase akr14a1 0.9833 4 328
3n6q-assembly1.cif.gz_D crystal structure of yghz from e. coli 0.9803 4 328
3erp-assembly1.cif.gz_B-5 structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium 0.9781 5 328
3n6q-assembly3.cif.gz_E-2 crystal structure of yghz from e. coli 0.9773 4 329
4ast-assembly1.cif.gz_H the apo structure of a bacterial aldo-keto reductase akr14a1 0.977 4 329
ID Description Score Start End Superfamily
3n6qB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9751 17 328 3.20.20.100
3n6qB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9497 17 328 3.20.20.100
af_O59826_13_339_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9314 16 329 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9181 15 335 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.91 15 335 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A614Z7P8-F1-model_v4 L-glyceraldehyde 3-phosphate reductase 0.9863 4 222 GO:0016491
GO:0051596
AF-A0A7Z0X0R6-F1-model_v4 Putative ion-channel protein 0.986 4 215 GO:0016491
GO:0051596
AF-A0A6V8KKT3-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9859 4 220 GO:0016491
GO:0051596
AF-A0A7W1R132-F1-model_v4 Aldo/keto reductase 0.985 15 204 GO:0016491
GO:0051596
AF-A0A2G2A5G1-F1-model_v4 L-glyceraldehyde 3-phosphate reductase 0.9845 4 180 GO:0016491
GO:0051596

Feature Viewer

pLDDT pTM Quality
89.83 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map