F401944
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 312 | 217 | 289 | 342 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2795385472|2795791626 |
| Length | 336 |
| Sequence | GRYDDRMTYRRCGRSGLLLPAISLGLWHNFGDDKPLETQTAILRRAFDLGVTHFDLANNYGPPYGSAEINFGGHLARDFTPFRDELIISSKAGYDMWPGPYGQGGGSRKYVLASLDQSLARLGLDYVDIFYSHRFDPDTPLEETMGALDTAVRSGKALYAGISSYSAERTREAAAILRDLGTPLLIHQPSYSMLNRWIEEDLLDATGELGVGVIAFSPLAQGMLTDRYLDGVPADSRAAQGKSLSRDMLDEDTLRHVRALNEIAKQRGQSLAQLALAWVLRDDRVTSTVIGASSVKQLEDNLAAVGNLSFSADELAAIDADAVEAGINIWQRSSEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 2 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 3 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 4 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 5 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 6 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 7 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 8 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 9 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 10 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 11 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 12 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 13 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 14 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 15 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 16 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 17 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 18 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 19 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 20 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 21 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 22 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 23 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 81 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 113 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 115 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 116 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 117 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 119 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 120 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 121 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 122 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 123 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 124 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 125 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 126 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 127 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 128 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 129 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 130 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 131 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 132 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 133 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 134 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 136 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 137 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 139 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 140 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 143 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 144 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 145 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 146 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 147 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 148 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 149 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 150 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 151 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 152 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 153 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 154 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 184 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 185 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 188 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 189 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 190 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 191 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 192 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 215 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 216 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 217 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.35 |
| Metatranscriptomes | 1.28 |
| Isolates | 7.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.28 |
| Nodule | 0 |
| Rhizoplane | 3.53 |
| Rhizosphere | 84.94 |
| Stem | 0 |
| Stem Tuber | 0.32 |
| Unclassified | 9.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10028762 | 3300003203 | Bacteria | 2113 |
| 2 | JGI25404J52841_10002354 | 3300003659 | Bacteria | 3562 |
| 3 | Ga0070658_10018217 | 3300005327 | Bacteria | 5619 |
| 4 | Ga0070683_100255867 | 3300005329 | Bacteria | 1666 |
| 5 | Ga0070680_100013078 | 3300005336 | Bacteria | 6460 |
| 6 | Ga0070682_100127488 | 3300005337 | Bacteria | 1718 |
| 7 | Ga0070667_100025222 | 3300005367 | Bacteria | 4942 |
| 8 | Ga0070667_100050859 | 3300005367 | Bacteria | 3492 |
| 9 | Ga0070714_100000010 | 3300005435 | Bacteria | 262871 |
| 10 | Ga0070714_100126680 | 3300005435 | Bacteria | 2278 |
| 11 | Ga0070714_100272959 | 3300005435 | Bacteria | 1568 |
| 12 | Ga0070713_100053823 | 3300005436 | Bacteria | 3336 |
| 13 | Ga0070713_100089845 | 3300005436 | Bacteria | 2640 |
| 14 | Ga0070713_100097166 | 3300005436 | Bacteria | 2545 |
| 15 | Ga0070713_100237430 | 3300005436 | Bacteria | 1659 |
| 16 | Ga0070711_100300503 | 3300005439 | Bacteria | 1276 |
| 17 | Ga0070705_100210005 | 3300005440 | Bacteria | 1341 |
| 18 | Ga0070700_100000060 | 3300005441 | Bacteria | 82198 |
| 19 | Ga0070708_100026556 | 3300005445 | Bacteria | 4958 |
| 20 | Ga0070663_100000420 | 3300005455 | Bacteria | 22378 |
| 21 | Ga0070663_100081609 | 3300005455 | Bacteria | 2377 |
| 22 | Ga0070678_100116457 | 3300005456 | Bacteria | 2100 |
| 23 | Ga0070707_100058941 | 3300005468 | Bacteria | 3682 |
| 24 | Ga0070698_100353475 | 3300005471 | Bacteria | 1401 |
| 25 | Ga0070699_100053403 | 3300005518 | Bacteria | 3497 |
| 26 | Ga0070679_100380103 | 3300005530 | Bacteria | 1359 |
| 27 | Ga0070697_100276170 | 3300005536 | Bacteria | 1441 |
| 28 | Ga0070693_100068378 | 3300005547 | Bacteria | 2084 |
| 29 | Ga0070665_100104285 | 3300005548 | Bacteria | 2838 |
| 30 | Ga0070665_100360013 | 3300005548 | Bacteria | 1461 |
| 31 | Ga0068855_100001227 | 3300005563 | Bacteria | 31817 |
| 32 | Ga0068855_100044357 | 3300005563 | Bacteria | 5262 |
| 33 | Ga0070664_100275703 | 3300005564 | Bacteria | 1516 |
| 34 | Ga0068857_100028260 | 3300005577 | Bacteria | 4948 |
| 35 | Ga0068856_100076004 | 3300005614 | Bacteria | 3327 |
| 36 | Ga0070702_100000675 | 3300005615 | Bacteria | 12793 |
| 37 | Ga0068852_100013367 | 3300005616 | Bacteria | 6283 |
| 38 | Ga0068863_100047809 | 3300005841 | Bacteria | 4057 |
| 39 | Ga0068860_100000297 | 3300005843 | Bacteria | 69029 |
| 40 | Ga0068860_100075166 | 3300005843 | Bacteria | 3213 |
| 41 | Ga0081538_10001191 | 3300005981 | Bacteria | 27404 |
| 42 | Ga0081540_1000422 | 3300005983 | Bacteria | 41886 |
| 43 | Ga0081540_1016362 | 3300005983 | Bacteria | 4645 |
| 44 | Ga0081539_10000662 | 3300005985 | Bacteria | 69140 |
| 45 | Ga0081539_10003079 | 3300005985 | Bacteria | 21456 |
| 46 | Ga0081539_10005763 | 3300005985 | Bacteria | 12356 |
| 47 | Ga0081539_10009318 | 3300005985 | Bacteria | 8238 |
| 48 | Ga0075365_10008254 | 3300006038 | Bacteria | 5895 |
| 49 | Ga0075365_10084926 | 3300006038 | Bacteria | 2149 |
| 50 | Ga0075432_10001822 | 3300006058 | Bacteria | 7019 |
| 51 | Ga0070715_10001980 | 3300006163 | Bacteria | 6172 |
| 52 | Ga0070716_100062142 | 3300006173 | Bacteria | 2164 |
| 53 | Ga0070712_100034763 | 3300006175 | Bacteria | 3417 |
| 54 | Ga0075428_100010799 | 3300006844 | Bacteria | 10150 |
| 55 | Ga0075436_100154936 | 3300006914 | Bacteria | 1613 |
| 56 | Ga0105240_10025143 | 3300009093 | Bacteria | 7831 |
| 57 | Ga0105240_10425443 | 3300009093 | Bacteria | 1491 |
| 58 | Ga0105245_10005722 | 3300009098 | Bacteria | 10916 |
| 59 | Ga0105247_10080234 | 3300009101 | Bacteria | 2055 |
| 60 | Ga0114129_10309739 | 3300009147 | Bacteria | 2102 |
| 61 | Ga0105243_10007981 | 3300009148 | Bacteria | 8131 |
| 62 | Ga0105242_10002484 | 3300009176 | Bacteria | 14462 |
| 63 | Ga0105242_10147112 | 3300009176 | Bacteria | 2050 |
| 64 | Ga0105248_10476245 | 3300009177 | Bacteria | 1407 |
| 65 | Ga0105238_10187821 | 3300009551 | Bacteria | 2043 |
| 66 | Ga0157370_10022425 | 3300013104 | Bacteria | 6282 |
| 67 | Ga0157370_10163444 | 3300013104 | Bacteria | 2071 |
| 68 | Ga0157370_10208882 | 3300013104 | Bacteria | 1810 |
| 69 | Ga0157369_10007005 | 3300013105 | Bacteria | 13009 |
| 70 | Ga0157369_10133431 | 3300013105 | Bacteria | 2630 |
| 71 | Ga0157369_10383317 | 3300013105 | Bacteria | 1459 |
| 72 | Ga0157378_10169509 | 3300013297 | Bacteria | 2046 |
| 73 | Ga0163162_10045599 | 3300013306 | Bacteria | 4392 |
| 74 | Ga0157372_10262191 | 3300013307 | Bacteria | 2007 |
| 75 | Ga0157375_10112868 | 3300013308 | Bacteria | 2818 |
| 76 | Ga0163163_10123777 | 3300014325 | Bacteria | 2622 |
| 77 | Ga0157380_10069219 | 3300014326 | Bacteria | 2847 |
| 78 | Ga0206354_11454385 | 3300020081 | Bacteria | 1753 |
| 79 | Ga0206353_10484881 | 3300020082 | Bacteria | 2376 |
| 80 | Ga0206353_11067826 | 3300020082 | Bacteria | 2819 |
| 81 | Ga0206353_11650896 | 3300020082 | Bacteria | 2857 |
| 82 | Ga0213875_10001297 | 3300021388 | Bacteria | 16615 |
| 83 | Ga0213875_10003226 | 3300021388 | Bacteria | 9364 |
| 84 | Ga0213875_10010525 | 3300021388 | Bacteria | 4626 |
| 85 | Ga0207692_10002212 | 3300025898 | Bacteria | 7442 |
| 86 | Ga0207680_10003281 | 3300025903 | Bacteria | 7622 |
| 87 | Ga0207699_10001402 | 3300025906 | Bacteria | 11442 |
| 88 | Ga0207699_10093657 | 3300025906 | Bacteria | 1891 |
| 89 | Ga0207643_10138135 | 3300025908 | Bacteria | 1454 |
| 90 | Ga0207705_10010366 | 3300025909 | Bacteria | 6777 |
| 91 | Ga0207705_10013615 | 3300025909 | Bacteria | 5868 |
| 92 | Ga0207705_10051655 | 3300025909 | Bacteria | 2959 |
| 93 | Ga0207705_10140775 | 3300025909 | Bacteria | 1801 |
| 94 | Ga0207695_10034884 | 3300025913 | Bacteria | 5463 |
| 95 | Ga0207695_10354181 | 3300025913 | Bacteria | 1355 |
| 96 | Ga0207671_10049039 | 3300025914 | Bacteria | 3125 |
| 97 | Ga0207693_10071188 | 3300025915 | Bacteria | 2721 |
| 98 | Ga0207663_10044548 | 3300025916 | Bacteria | 2724 |
| 99 | Ga0207652_10022220 | 3300025921 | Bacteria | 5244 |
| 100 | Ga0207652_10402602 | 3300025921 | Bacteria | 1235 |
| 101 | Ga0207646_10044356 | 3300025922 | Bacteria | 3991 |
| 102 | Ga0207659_10309693 | 3300025926 | Bacteria | 1300 |
| 103 | Ga0207687_10003294 | 3300025927 | Bacteria | 10926 |
| 104 | Ga0207700_10034240 | 3300025928 | Bacteria | 3645 |
| 105 | Ga0207700_10035769 | 3300025928 | Bacteria | 3580 |
| 106 | Ga0207700_10070506 | 3300025928 | Bacteria | 2687 |
| 107 | Ga0207700_10104087 | 3300025928 | Bacteria | 2270 |
| 108 | Ga0207700_10121896 | 3300025928 | Bacteria | 2115 |
| 109 | Ga0207700_10143548 | 3300025928 | Bacteria | 1964 |
| 110 | Ga0207664_10000009 | 3300025929 | Bacteria | 299246 |
| 111 | Ga0207664_10002231 | 3300025929 | Bacteria | 12764 |
| 112 | Ga0207664_10005040 | 3300025929 | Bacteria | 8988 |
| 113 | Ga0207664_10101040 | 3300025929 | Bacteria | 2382 |
| 114 | Ga0207664_10191034 | 3300025929 | Bacteria | 1763 |
| 115 | Ga0207686_10012998 | 3300025934 | Bacteria | 4595 |
| 116 | Ga0207665_10129676 | 3300025939 | Bacteria | 1788 |
| 117 | Ga0207689_10128260 | 3300025942 | Bacteria | 2086 |
| 118 | Ga0207667_10002782 | 3300025949 | Bacteria | 21659 |
| 119 | Ga0207667_10016905 | 3300025949 | Bacteria | 8230 |
| 120 | Ga0207667_10034156 | 3300025949 | Bacteria | 5464 |
| 121 | Ga0207667_10074970 | 3300025949 | Bacteria | 3513 |
| 122 | Ga0207668_10020363 | 3300025972 | Bacteria | 4213 |
| 123 | Ga0207668_10022720 | 3300025972 | Bacteria | 4021 |
| 124 | Ga0207658_10037077 | 3300025986 | Bacteria | 3500 |
| 125 | Ga0207658_10122491 | 3300025986 | Bacteria | 2076 |
| 126 | Ga0207678_10000514 | 3300026067 | Bacteria | 35082 |
| 127 | Ga0207678_10012393 | 3300026067 | Bacteria | 7484 |
| 128 | Ga0207678_10054188 | 3300026067 | Bacteria | 3454 |
| 129 | Ga0207708_10000011 | 3300026075 | Bacteria | 214227 |
| 130 | Ga0207702_10197380 | 3300026078 | Bacteria | 1863 |
| 131 | Ga0207702_10199369 | 3300026078 | Bacteria | 1854 |
| 132 | Ga0207641_10026802 | 3300026088 | Bacteria | 4758 |
| 133 | Ga0207674_10008344 | 3300026116 | Bacteria | 11986 |
| 134 | Ga0207674_10026995 | 3300026116 | Bacteria | 6087 |
| 135 | Ga0207674_10162970 | 3300026116 | Bacteria | 2184 |
| 136 | Ga0207683_10006893 | 3300026121 | Bacteria | 9728 |
| 137 | Ga0207683_10086685 | 3300026121 | Bacteria | 2784 |
| 138 | Ga0207698_10014967 | 3300026142 | Bacteria | 5178 |
| 139 | Ga0207428_10142407 | 3300027907 | Bacteria | 1829 |
| 140 | Ga0268266_10003631 | 3300028379 | Bacteria | 15261 |
| 141 | Ga0268264_10000353 | 3300028381 | Bacteria | 69101 |
| 142 | Ga0268264_10001453 | 3300028381 | Bacteria | 22147 |
| 143 | Ga0268264_10018837 | 3300028381 | Bacteria | 5645 |
| 144 | Ga0307515_10237996 | 3300028794 | Bacteria | 1598 |
| 145 | Ga0265338_10017578 | 3300028800 | Bacteria | 7701 |
| 146 | Ga0265340_10000300 | 3300031247 | Bacteria | 25972 |
| 147 | Ga0307513_10028036 | 3300031456 | Bacteria | 6450 |
| 148 | Ga0307509_10016244 | 3300031507 | Bacteria | 8623 |
| 149 | Ga0265313_10110957 | 3300031595 | Bacteria | 1206 |
| 150 | Ga0307413_10094684 | 3300031824 | Bacteria | 1956 |
| 151 | Ga0307410_10005453 | 3300031852 | Bacteria | 6737 |
| 152 | Ga0307406_10150534 | 3300031901 | Bacteria | 1659 |
| 153 | Ga0307407_10207339 | 3300031903 | Bacteria | 1317 |
| 154 | Ga0307412_10031407 | 3300031911 | Bacteria | 3354 |
| 155 | Ga0307409_100021734 | 3300031995 | Bacteria | 4406 |
| 156 | Ga0307409_100046562 | 3300031995 | Bacteria | 3284 |
| 157 | Ga0307409_100067295 | 3300031995 | Bacteria | 2828 |
| 158 | Ga0307409_100276277 | 3300031995 | Bacteria | 1550 |
| 159 | Ga0307416_100004821 | 3300032002 | Bacteria | 8203 |
| 160 | Ga0307416_100145201 | 3300032002 | Bacteria | 2165 |
| 161 | Ga0307416_100465115 | 3300032002 | Bacteria | 1321 |
| 162 | Ga0307415_100082083 | 3300032126 | Bacteria | 2305 |
| 163 | Ga0307415_100334265 | 3300032126 | Bacteria | 1269 |
| 164 | Ga0307507_10040551 | 3300033179 | Bacteria | 4675 |
| 165 | Ga0373926_0032011 | 3300035083 | Bacteria | 1855 |
| 166 | Ga0373923_0020665 | 3300035111 | Bacteria | 2560 |
| 167 | Ga0373936_0026881 | 3300035113 | Bacteria | 2255 |
| 168 | Ga0373945_0012897 | 3300035116 | Bacteria | 2783 |
| 169 | Ga0373953_0033364 | 3300035117 | Bacteria | 2013 |
| 170 | Ga0373957_0084617 | 3300035120 | Bacteria | 1254 |
| 171 | Ga0373943_0131504 | 3300035170 | Bacteria | 1339 |
| 172 | Ga0373935_0005194 | 3300035692 | Bacteria | 7666 |
| 173 | Ga0373927_0059376 | 3300035695 | Bacteria | 2473 |
| 174 | Ga0373933_0123959 | 3300035724 | Bacteria | 1620 |
| 175 | Ga0373925_0000129 | 3300037068 | Bacteria | 80897 |
| 176 | Ga0395900_0087104 | 3300037418 | Bacteria | 3210 |
| 177 | Ga0395898_0256108 | 3300037466 | Bacteria | 1669 |
| 178 | Ga0436364_0145178 | 3300037853 | Bacteria | 26239 |
| 179 | Ga0436364_0447536 | 3300037853 | Bacteria | 1524 |
| 180 | Ga0436364_1416932 | 3300037853 | Bacteria | 21451 |
| 181 | Ga0436364_1489025 | 3300037853 | Bacteria | 2626 |
| 182 | Ga0395901_0010884 | 3300038443 | Bacteria | 9218 |
| 183 | Ga0395901_0025371 | 3300038443 | Bacteria | 6085 |
| 184 | Ga0395901_0043230 | 3300038443 | Bacteria | 4674 |
| 185 | Ga0395901_0103795 | 3300038443 | Bacteria | 2983 |
| 186 | Ga0395901_0416005 | 3300038443 | Bacteria | 1379 |
| 187 | Ga0451853_0637535 | 3300041512 | Bacteria | 10626 |
| 188 | Ga0466969_0008684 | 3300044656 | Bacteria | 5389 |
| 189 | Ga0466969_0071135 | 3300044656 | Bacteria | 1673 |
| 190 | Ga0466965_0207888 | 3300044683 | Bacteria | 1040 |
| 191 | Ga0466966_0013789 | 3300044684 | Bacteria | 5347 |
| 192 | Ga0466966_0016491 | 3300044684 | Bacteria | 4878 |
| 193 | Ga0466966_0071784 | 3300044684 | Bacteria | 2169 |
| 194 | Ga0466961_0034255 | 3300044693 | Bacteria | 3260 |
| 195 | Ga0466961_0070886 | 3300044693 | Bacteria | 2212 |
| 196 | Ga0466961_0118675 | 3300044693 | Bacteria | 1661 |
| 197 | Ga0466961_0121492 | 3300044693 | Bacteria | 1640 |
| 198 | Ga0466961_0171520 | 3300044693 | Bacteria | 1349 |
| 199 | Ga0466971_0032105 | 3300044719 | Bacteria | 2353 |
| 200 | Ga0466971_0073097 | 3300044719 | Bacteria | 1558 |
| 201 | Ga0466971_0079005 | 3300044719 | Bacteria | 1499 |
| 202 | Ga0466968_0039814 | 3300044735 | Bacteria | 1979 |
| 203 | Ga0466970_0017773 | 3300044765 | Bacteria | 3677 |
| 204 | Ga0466970_0024427 | 3300044765 | Bacteria | 3160 |
| 205 | Ga0466970_0051154 | 3300044765 | Bacteria | 2205 |
| 206 | Ga0466957_0164139 | 3300044842 | Bacteria | 1444 |
| 207 | Ga0466957_0181889 | 3300044842 | Bacteria | 1373 |
| 208 | Ga0466959_0013100 | 3300045049 | Bacteria | 6005 |
| 209 | Ga0466959_0124496 | 3300045049 | Bacteria | 1830 |
| 210 | Ga0466959_0139647 | 3300045049 | Bacteria | 1713 |
| 211 | Ga0466958_0021765 | 3300045836 | Bacteria | 3750 |
| 212 | Ga0466967_0010969 | 3300045976 | Bacteria | 6831 |
| 213 | Ga0466967_0139356 | 3300045976 | Bacteria | 2258 |
| 214 | Ga0495592_0255777 | 3300046454 | Bacteria | 1155 |
| 215 | Ga0495641_0072314 | 3300046461 | Bacteria | 1547 |
| 216 | Ga0495653_0098223 | 3300046463 | Bacteria | 2126 |
| 217 | Ga0495580_0070023 | 3300046472 | Bacteria | 2450 |
| 218 | Ga0495580_0116229 | 3300046472 | Bacteria | 1858 |
| 219 | Ga0495662_0011936 | 3300046476 | Bacteria | 4245 |
| 220 | Ga0495664_0036647 | 3300046477 | Bacteria | 2891 |
| 221 | Ga0495594_0030457 | 3300046499 | Bacteria | 2920 |
| 222 | Ga0495606_0017138 | 3300046507 | Bacteria | 5490 |
| 223 | Ga0495608_0003670 | 3300046511 | Bacteria | 11039 |
| 224 | Ga0495628_0333470 | 3300046516 | Bacteria | 1117 |
| 225 | Ga0495630_0102750 | 3300046517 | Bacteria | 2162 |
| 226 | Ga0495652_0251724 | 3300046529 | Bacteria | 1308 |
| 227 | Ga0495665_0012235 | 3300046531 | Bacteria | 4643 |
| 228 | Ga0495586_0080769 | 3300046535 | Bacteria | 1786 |
| 229 | Ga0495586_0102397 | 3300046535 | Bacteria | 1589 |
| 230 | Ga0495622_0084075 | 3300046557 | Bacteria | 1464 |
| 231 | Ga0495667_0003592 | 3300046559 | Bacteria | 10432 |
| 232 | Ga0495635_0144626 | 3300046663 | Bacteria | 1619 |
| 233 | Ga0495657_0115854 | 3300046675 | Bacteria | 1692 |
| 234 | Ga0495623_0086251 | 3300046679 | Bacteria | 1935 |
| 235 | Ga0495613_0165267 | 3300046689 | Bacteria | 1572 |
| 236 | Ga0495624_0063148 | 3300046690 | Bacteria | 2315 |
| 237 | Ga0495600_0023959 | 3300046809 | Bacteria | 3928 |
| 238 | Ga0495604_0080993 | 3300047317 | Bacteria | 2431 |
| 239 | Ga0495672_0024216 | 3300047320 | Bacteria | 3915 |
| 240 | Ga0495680_0061177 | 3300047322 | Bacteria | 2897 |
| 241 | Ga0495675_0106792 | 3300047444 | Bacteria | 1749 |
| 242 | Ga0495593_0124198 | 3300047673 | Bacteria | 1312 |
| 243 | Ga0495614_0065935 | 3300048089 | Bacteria | 1557 |
| 244 | Ga0496101_0200768 | 3300048904 | Bacteria | 1542 |
| 245 | Ga0496105_0015123 | 3300048908 | Bacteria | 6142 |
| 246 | Ga0496107_0229629 | 3300048910 | Bacteria | 1381 |
| 247 | Ga0496108_0001092 | 3300048911 | Bacteria | 21182 |
| 248 | Ga0496108_0054704 | 3300048911 | Bacteria | 3349 |
| 249 | Ga0496109_0067016 | 3300048912 | Bacteria | 3288 |
| 250 | Ga0496112_0033425 | 3300048915 | Bacteria | 5000 |
| 251 | Ga0496113_0021220 | 3300048916 | Bacteria | 4579 |
| 252 | Ga0496114_0034721 | 3300048917 | Bacteria | 4162 |
| 253 | Ga0496115_0041977 | 3300048918 | Bacteria | 3643 |
| 254 | Ga0496115_0347179 | 3300048918 | Bacteria | 1211 |
| 255 | Ga0496126_0017841 | 3300048929 | Bacteria | 7062 |
| 256 | Ga0496126_0049956 | 3300048929 | Bacteria | 3815 |
| 257 | Ga0501034_0004257 | 3300049571 | Bacteria | 15964 |
| 258 | Ga0501036_0001531 | 3300049572 | Bacteria | 17856 |
| 259 | Ga0501036_0015455 | 3300049572 | Bacteria | 6376 |
| 260 | Ga0501037_0010228 | 3300049573 | Bacteria | 6884 |
| 261 | Ga0501037_0088274 | 3300049573 | Bacteria | 2244 |
| 262 | Ga0501039_0128880 | 3300049575 | Bacteria | 1985 |
| 263 | Ga0501039_0360359 | 3300049575 | Bacteria | 1142 |
| 264 | Ga0501042_0004561 | 3300049578 | Bacteria | 8839 |
| 265 | Ga0501043_0007852 | 3300049579 | Bacteria | 8438 |
| 266 | Ga0501046_0021187 | 3300049580 | Bacteria | 5367 |
| 267 | Ga0501047_0012110 | 3300049581 | Bacteria | 8164 |
| 268 | Ga0501048_0010509 | 3300049582 | Bacteria | 6909 |
| 269 | Ga0501048_0044193 | 3300049582 | Bacteria | 3186 |
| 270 | Ga0501071_0180308 | 3300049587 | Bacteria | 1582 |
| 271 | Ga0501071_0266888 | 3300049587 | Bacteria | 1293 |
| 272 | Ga0501072_0034541 | 3300049588 | Bacteria | 3963 |
| 273 | Ga0501073_0175996 | 3300049589 | Bacteria | 1481 |
| 274 | Ga0501074_0003425 | 3300049590 | Bacteria | 11242 |
| 275 | Ga0501074_0142942 | 3300049590 | Bacteria | 1711 |
| 276 | Ga0501076_0033355 | 3300049592 | Bacteria | 4019 |
| 277 | Ga0501077_0019668 | 3300049593 | Bacteria | 4271 |
| 278 | Ga0501079_0016094 | 3300049741 | Bacteria | 5715 |
| 279 | Ga0501081_0028356 | 3300049743 | Bacteria | 3778 |
| 280 | Ga0501081_0126017 | 3300049743 | Bacteria | 1827 |
| 281 | Ga0501044_0043610 | 3300049823 | Bacteria | 4659 |
| 282 | Ga0501044_0132267 | 3300049823 | Bacteria | 2488 |
| 283 | Ga0501044_0288242 | 3300049823 | Bacteria | 1574 |
| 284 | nmdc:mga05p37_304112_c1 | 3300050507 | Bacteria | 1893 |
| 285 | Ga0495612_0050288 | 3300053078 | Bacteria | 1711 |
| 286 | Ga0495595_0014870 | 3300053084 | Bacteria | 3309 |
| 287 | Ga0495619_0013573 | 3300053085 | Bacteria | 5133 |
| 288 | Ga0500646_0043531 | 3300053090 | Bacteria | 1271 |
| 289 | Ga0500616_0000377 | 3300053153 | Bacteria | 62514 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044765 | Ga0466970_0024427 | Ga0466970_0024427_2185_3132 | 315 |
| 2 | 3300025906 | Ga0207699_10093657 | Ga0207699_100936572 | 318 |
| 3 | 3300020082 | Ga0206353_11067826 | Ga0206353_110678262 | 319 |
| 4 | 3300037466 | Ga0395898_0256108 | Ga0395898_0256108_560_1585 | 320 |
| 5 | 3300038443 | Ga0395901_0103795 | Ga0395901_0103795_725_1750 | 320 |
| 6 | 3300025908 | Ga0207643_10138135 | Ga0207643_101381352 | 325 |
| 7 | iso_pu_bacteria | 2751185782 | 2753268057 | 325 |
| 8 | 3300005455 | Ga0070663_100000420 | Ga0070663_10000042011 | 326 |
| 9 | 3300026067 | Ga0207678_10000514 | Ga0207678_100005148 | 326 |
| 10 | 3300037853 | Ga0436364_0145178 | Ga0436364_0145178_10086_11066 | 326 |
| 11 | 3300005983 | Ga0081540_1016362 | Ga0081540_10163625 | 328 |
| 12 | iso_pu_bacteria | 2675903060 | 2676490683 | 328 |
| 13 | iso_pu_bacteria | 2884693830 | 2884703623 | 328 |
| 14 | iso_pu_bacteria | 2895427314 | 2895435268 | 328 |
| 15 | iso_pu_bacteria | 2895442618 | 2895447388 | 328 |
| 16 | 3300028379 | Ga0268266_10003631 | Ga0268266_1000363117 | 329 |
| 17 | 3300031901 | Ga0307406_10150534 | Ga0307406_101505342 | 329 |
| 18 | 3300044656 | Ga0466969_0008684 | Ga0466969_0008684_2587_3579 | 329 |
| 19 | 3300044656 | Ga0466969_0071135 | Ga0466969_0071135_16_1005 | 329 |
| 20 | 3300044683 | Ga0466965_0207888 | Ga0466965_0207888_30_1019 | 329 |
| 21 | 3300044684 | Ga0466966_0016491 | Ga0466966_0016491_252_1244 | 329 |
| 22 | 3300044693 | Ga0466961_0118675 | Ga0466961_0118675_498_1490 | 329 |
| 23 | 3300044693 | Ga0466961_0171520 | Ga0466961_0171520_161_1153 | 329 |
| 24 | 3300044719 | Ga0466971_0079005 | Ga0466971_0079005_485_1477 | 329 |
| 25 | 3300044765 | Ga0466970_0017773 | Ga0466970_0017773_2586_3578 | 329 |
| 26 | 3300044842 | Ga0466957_0164139 | Ga0466957_0164139_315_1304 | 329 |
| 27 | 3300045049 | Ga0466959_0013100 | Ga0466959_0013100_248_1240 | 329 |
| 28 | 3300046472 | Ga0495580_0116229 | Ga0495580_0116229_536_1525 | 329 |
| 29 | 3300048917 | Ga0496114_0034721 | Ga0496114_0034721_1066_2058 | 329 |
| 30 | 3300053090 | Ga0500646_0043531 | Ga0500646_0043531_33_1037 | 329 |
| 31 | iso_pu_bacteria | 2873314349 | 2873316338 | 331 |
| 32 | iso_pu_bacteria | 8055066027 | 8055073872 | 331 |
| 33 | 3300033179 | Ga0307507_10040551 | Ga0307507_100405512 | 332 |
| 34 | 3300049575 | Ga0501039_0360359 | Ga0501039_0360359_32_1075 | 333 |
| 35 | 3300049587 | Ga0501071_0180308 | Ga0501071_0180308_93_1136 | 333 |
| 36 | 3300049587 | Ga0501071_0266888 | Ga0501071_0266888_123_1166 | 333 |
| 37 | 3300049743 | Ga0501081_0126017 | Ga0501081_0126017_703_1746 | 333 |
| 38 | iso_pu_bacteria | 2795385472 | 2795791626 | 334 |
| 39 | 3300044693 | Ga0466961_0034255 | Ga0466961_0034255_2118_3125 | 335 |
| 40 | 3300048911 | Ga0496108_0001092 | Ga0496108_0001092_18844_19851 | 335 |
| 41 | iso_pu_bacteria | 2856741275 | 2856744193 | 337 |
| 42 | iso_pu_bacteria | 2891395885 | 2891399993 | 337 |
| 43 | iso_pu_bacteria | 2891554331 | 2891558828 | 337 |
| 44 | iso_pu_bacteria | 2891562705 | 2891566611 | 337 |
| 45 | iso_pu_bacteria | 2899370129 | 2899370377 | 337 |
| 46 | iso_pu_bacteria | 2917736166 | 2917744675 | 337 |
| 47 | iso_pu_bacteria | 3002998708 | 3003005385 | 337 |
| 48 | iso_pu_bacteria | 8055172936 | 8055174307 | 337 |
| 49 | 3300021388 | Ga0213875_10001297 | Ga0213875_100012979 | 338 |
| 50 | 3300046535 | Ga0495586_0102397 | Ga0495586_0102397_28_1065 | 338 |
| 51 | iso_pu_bacteria | 2585427649 | 2586059656 | 338 |
| 52 | iso_pu_bacteria | 2915768154 | 2915772868 | 338 |
| 53 | 3300005327 | Ga0070658_10018217 | Ga0070658_100182172 | 339 |
| 54 | 3300005563 | Ga0068855_100001227 | Ga0068855_10000122718 | 339 |
| 55 | 3300009093 | Ga0105240_10425443 | Ga0105240_104254432 | 339 |
| 56 | 3300025909 | Ga0207705_10013615 | Ga0207705_100136152 | 339 |
| 57 | 3300025913 | Ga0207695_10354181 | Ga0207695_103541812 | 339 |
| 58 | 3300025949 | Ga0207667_10002782 | Ga0207667_1000278211 | 339 |
| 59 | 3300005548 | Ga0070665_100360013 | Ga0070665_1003600132 | 340 |
| 60 | 3300005563 | Ga0068855_100044357 | Ga0068855_1000443573 | 340 |
| 61 | 3300005841 | Ga0068863_100047809 | Ga0068863_1000478092 | 340 |
| 62 | 3300005843 | Ga0068860_100075166 | Ga0068860_1000751663 | 340 |
| 63 | 3300009093 | Ga0105240_10025143 | Ga0105240_100251434 | 340 |
| 64 | 3300013104 | Ga0157370_10022425 | Ga0157370_100224256 | 340 |
| 65 | 3300013105 | Ga0157369_10007005 | Ga0157369_100070059 | 340 |
| 66 | 3300025913 | Ga0207695_10034884 | Ga0207695_100348844 | 340 |
| 67 | 3300025928 | Ga0207700_10034240 | Ga0207700_100342404 | 340 |
| 68 | 3300025928 | Ga0207700_10143548 | Ga0207700_101435482 | 340 |
| 69 | 3300025942 | Ga0207689_10128260 | Ga0207689_101282602 | 340 |
| 70 | 3300025949 | Ga0207667_10034156 | Ga0207667_100341564 | 340 |
| 71 | 3300025972 | Ga0207668_10020363 | Ga0207668_100203634 | 340 |
| 72 | 3300026088 | Ga0207641_10026802 | Ga0207641_100268023 | 340 |
| 73 | 3300028381 | Ga0268264_10018837 | Ga0268264_100188374 | 340 |
| 74 | 3300031507 | Ga0307509_10016244 | Ga0307509_100162449 | 340 |
| 75 | 3300035692 | Ga0373935_0005194 | Ga0373935_0005194_1249_2274 | 340 |
| 76 | 3300038443 | Ga0395901_0416005 | Ga0395901_0416005_259_1281 | 340 |
| 77 | 3300003659 | JGI25404J52841_10002354 | JGI25404J52841_100023544 | 341 |
| 78 | 3300005329 | Ga0070683_100255867 | Ga0070683_1002558671 | 341 |
| 79 | 3300005336 | Ga0070680_100013078 | Ga0070680_1000130784 | 341 |
| 80 | 3300005337 | Ga0070682_100127488 | Ga0070682_1001274882 | 341 |
| 81 | 3300005367 | Ga0070667_100025222 | Ga0070667_1000252222 | 341 |
| 82 | 3300005367 | Ga0070667_100050859 | Ga0070667_1000508592 | 341 |
| 83 | 3300005435 | Ga0070714_100000010 | Ga0070714_100000010173 | 341 |
| 84 | 3300005435 | Ga0070714_100126680 | Ga0070714_1001266801 | 341 |
| 85 | 3300005435 | Ga0070714_100272959 | Ga0070714_1002729591 | 341 |
| 86 | 3300005436 | Ga0070713_100053823 | Ga0070713_1000538233 | 341 |
| 87 | 3300005436 | Ga0070713_100089845 | Ga0070713_1000898452 | 341 |
| 88 | 3300005436 | Ga0070713_100097166 | Ga0070713_1000971662 | 341 |
| 89 | 3300005436 | Ga0070713_100237430 | Ga0070713_1002374302 | 341 |
| 90 | 3300005439 | Ga0070711_100300503 | Ga0070711_1003005032 | 341 |
| 91 | 3300005440 | Ga0070705_100210005 | Ga0070705_1002100052 | 341 |
| 92 | 3300005441 | Ga0070700_100000060 | Ga0070700_10000006031 | 341 |
| 93 | 3300005445 | Ga0070708_100026556 | Ga0070708_1000265562 | 341 |
| 94 | 3300005455 | Ga0070663_100081609 | Ga0070663_1000816093 | 341 |
| 95 | 3300005456 | Ga0070678_100116457 | Ga0070678_1001164572 | 341 |
| 96 | 3300005468 | Ga0070707_100058941 | Ga0070707_1000589412 | 341 |
| 97 | 3300005471 | Ga0070698_100353475 | Ga0070698_1003534751 | 341 |
| 98 | 3300005518 | Ga0070699_100053403 | Ga0070699_1000534036 | 341 |
| 99 | 3300005530 | Ga0070679_100380103 | Ga0070679_1003801032 | 341 |
| 100 | 3300005536 | Ga0070697_100276170 | Ga0070697_1002761702 | 341 |
| 101 | 3300005547 | Ga0070693_100068378 | Ga0070693_1000683781 | 341 |
| 102 | 3300005564 | Ga0070664_100275703 | Ga0070664_1002757031 | 341 |
| 103 | 3300005614 | Ga0068856_100076004 | Ga0068856_1000760043 | 341 |
| 104 | 3300005615 | Ga0070702_100000675 | Ga0070702_1000006755 | 341 |
| 105 | 3300005616 | Ga0068852_100013367 | Ga0068852_1000133677 | 341 |
| 106 | 3300005843 | Ga0068860_100000297 | Ga0068860_10000029717 | 341 |
| 107 | 3300005981 | Ga0081538_10001191 | Ga0081538_100011913 | 341 |
| 108 | 3300005983 | Ga0081540_1000422 | Ga0081540_10004222 | 341 |
| 109 | 3300006058 | Ga0075432_10001822 | Ga0075432_100018226 | 341 |
| 110 | 3300006163 | Ga0070715_10001980 | Ga0070715_100019804 | 341 |
| 111 | 3300006173 | Ga0070716_100062142 | Ga0070716_1000621422 | 341 |
| 112 | 3300006175 | Ga0070712_100034763 | Ga0070712_1000347631 | 341 |
| 113 | 3300006844 | Ga0075428_100010799 | Ga0075428_1000107997 | 341 |
| 114 | 3300006914 | Ga0075436_100154936 | Ga0075436_1001549362 | 341 |
| 115 | 3300009098 | Ga0105245_10005722 | Ga0105245_100057222 | 341 |
| 116 | 3300009101 | Ga0105247_10080234 | Ga0105247_100802342 | 341 |
| 117 | 3300009147 | Ga0114129_10309739 | Ga0114129_103097392 | 341 |
| 118 | 3300009148 | Ga0105243_10007981 | Ga0105243_100079815 | 341 |
| 119 | 3300009176 | Ga0105242_10002484 | Ga0105242_100024846 | 341 |
| 120 | 3300009177 | Ga0105248_10476245 | Ga0105248_104762451 | 341 |
| 121 | 3300009551 | Ga0105238_10187821 | Ga0105238_101878212 | 341 |
| 122 | 3300013104 | Ga0157370_10163444 | Ga0157370_101634442 | 341 |
| 123 | 3300013104 | Ga0157370_10208882 | Ga0157370_102088821 | 341 |
| 124 | 3300013105 | Ga0157369_10133431 | Ga0157369_101334312 | 341 |
| 125 | 3300013105 | Ga0157369_10383317 | Ga0157369_103833171 | 341 |
| 126 | 3300013297 | Ga0157378_10169509 | Ga0157378_101695092 | 341 |
| 127 | 3300013306 | Ga0163162_10045599 | Ga0163162_100455994 | 341 |
| 128 | 3300013308 | Ga0157375_10112868 | Ga0157375_101128682 | 341 |
| 129 | 3300014326 | Ga0157380_10069219 | Ga0157380_100692191 | 341 |
| 130 | 3300020081 | Ga0206354_11454385 | Ga0206354_114543853 | 341 |
| 131 | 3300021388 | Ga0213875_10003226 | Ga0213875_1000322610 | 341 |
| 132 | 3300021388 | Ga0213875_10010525 | Ga0213875_100105252 | 341 |
| 133 | 3300025898 | Ga0207692_10002212 | Ga0207692_100022123 | 341 |
| 134 | 3300025903 | Ga0207680_10003281 | Ga0207680_100032814 | 341 |
| 135 | 3300025906 | Ga0207699_10001402 | Ga0207699_100014024 | 341 |
| 136 | 3300025909 | Ga0207705_10010366 | Ga0207705_100103664 | 341 |
| 137 | 3300025909 | Ga0207705_10051655 | Ga0207705_100516554 | 341 |
| 138 | 3300025909 | Ga0207705_10140775 | Ga0207705_101407753 | 341 |
| 139 | 3300025914 | Ga0207671_10049039 | Ga0207671_100490391 | 341 |
| 140 | 3300025915 | Ga0207693_10071188 | Ga0207693_100711883 | 341 |
| 141 | 3300025916 | Ga0207663_10044548 | Ga0207663_100445482 | 341 |
| 142 | 3300025921 | Ga0207652_10022220 | Ga0207652_100222201 | 341 |
| 143 | 3300025921 | Ga0207652_10402602 | Ga0207652_104026022 | 341 |
| 144 | 3300025922 | Ga0207646_10044356 | Ga0207646_100443564 | 341 |
| 145 | 3300025926 | Ga0207659_10309693 | Ga0207659_103096931 | 341 |
| 146 | 3300025927 | Ga0207687_10003294 | Ga0207687_100032942 | 341 |
| 147 | 3300025928 | Ga0207700_10035769 | Ga0207700_100357694 | 341 |
| 148 | 3300025928 | Ga0207700_10070506 | Ga0207700_100705063 | 341 |
| 149 | 3300025928 | Ga0207700_10104087 | Ga0207700_101040873 | 341 |
| 150 | 3300025928 | Ga0207700_10121896 | Ga0207700_101218961 | 341 |
| 151 | 3300025929 | Ga0207664_10000009 | Ga0207664_10000009104 | 341 |
| 152 | 3300025929 | Ga0207664_10002231 | Ga0207664_1000223110 | 341 |
| 153 | 3300025929 | Ga0207664_10005040 | Ga0207664_1000504010 | 341 |
| 154 | 3300025929 | Ga0207664_10101040 | Ga0207664_101010402 | 341 |
| 155 | 3300025929 | Ga0207664_10191034 | Ga0207664_101910342 | 341 |
| 156 | 3300025934 | Ga0207686_10012998 | Ga0207686_100129984 | 341 |
| 157 | 3300025939 | Ga0207665_10129676 | Ga0207665_101296761 | 341 |
| 158 | 3300025949 | Ga0207667_10016905 | Ga0207667_100169055 | 341 |
| 159 | 3300025949 | Ga0207667_10074970 | Ga0207667_100749702 | 341 |
| 160 | 3300025972 | Ga0207668_10022720 | Ga0207668_100227204 | 341 |
| 161 | 3300025986 | Ga0207658_10037077 | Ga0207658_100370772 | 341 |
| 162 | 3300025986 | Ga0207658_10122491 | Ga0207658_101224912 | 341 |
| 163 | 3300026067 | Ga0207678_10012393 | Ga0207678_100123933 | 341 |
| 164 | 3300026067 | Ga0207678_10054188 | Ga0207678_100541881 | 341 |
| 165 | 3300026075 | Ga0207708_10000011 | Ga0207708_10000011117 | 341 |
| 166 | 3300026078 | Ga0207702_10197380 | Ga0207702_101973803 | 341 |
| 167 | 3300026078 | Ga0207702_10199369 | Ga0207702_101993691 | 341 |
| 168 | 3300026116 | Ga0207674_10008344 | Ga0207674_100083441 | 341 |
| 169 | 3300026116 | Ga0207674_10162970 | Ga0207674_101629703 | 341 |
| 170 | 3300026121 | Ga0207683_10006893 | Ga0207683_1000689310 | 341 |
| 171 | 3300026142 | Ga0207698_10014967 | Ga0207698_100149672 | 341 |
| 172 | 3300027907 | Ga0207428_10142407 | Ga0207428_101424073 | 341 |
| 173 | 3300028381 | Ga0268264_10000353 | Ga0268264_1000035350 | 341 |
| 174 | 3300028800 | Ga0265338_10017578 | Ga0265338_100175782 | 341 |
| 175 | 3300031595 | Ga0265313_10110957 | Ga0265313_101109572 | 341 |
| 176 | 3300031824 | Ga0307413_10094684 | Ga0307413_100946842 | 341 |
| 177 | 3300032126 | Ga0307415_100334265 | Ga0307415_1003342651 | 341 |
| 178 | 3300035083 | Ga0373926_0032011 | Ga0373926_0032011_795_1820 | 341 |
| 179 | 3300035111 | Ga0373923_0020665 | Ga0373923_0020665_549_1574 | 341 |
| 180 | 3300035113 | Ga0373936_0026881 | Ga0373936_0026881_1067_2092 | 341 |
| 181 | 3300035116 | Ga0373945_0012897 | Ga0373945_0012897_49_1074 | 341 |
| 182 | 3300035117 | Ga0373953_0033364 | Ga0373953_0033364_72_1097 | 341 |
| 183 | 3300035120 | Ga0373957_0084617 | Ga0373957_0084617_103_1128 | 341 |
| 184 | 3300035170 | Ga0373943_0131504 | Ga0373943_0131504_220_1245 | 341 |
| 185 | 3300035695 | Ga0373927_0059376 | Ga0373927_0059376_216_1241 | 341 |
| 186 | 3300035724 | Ga0373933_0123959 | Ga0373933_0123959_53_1081 | 341 |
| 187 | 3300037068 | Ga0373925_0000129 | Ga0373925_0000129_76936_77964 | 341 |
| 188 | 3300037418 | Ga0395900_0087104 | Ga0395900_0087104_166_1191 | 341 |
| 189 | 3300037853 | Ga0436364_0447536 | Ga0436364_0447536_434_1459 | 341 |
| 190 | 3300037853 | Ga0436364_1416932 | Ga0436364_1416932_4630_5661 | 341 |
| 191 | 3300037853 | Ga0436364_1489025 | Ga0436364_1489025_39_1064 | 341 |
| 192 | 3300038443 | Ga0395901_0025371 | Ga0395901_0025371_3570_4595 | 341 |
| 193 | 3300044693 | Ga0466961_0121492 | Ga0466961_0121492_139_1164 | 341 |
| 194 | 3300044719 | Ga0466971_0073097 | Ga0466971_0073097_53_1078 | 341 |
| 195 | 3300044735 | Ga0466968_0039814 | Ga0466968_0039814_635_1663 | 341 |
| 196 | 3300044842 | Ga0466957_0181889 | Ga0466957_0181889_168_1193 | 341 |
| 197 | 3300045836 | Ga0466958_0021765 | Ga0466958_0021765_2470_3495 | 341 |
| 198 | 3300045976 | Ga0466967_0010969 | Ga0466967_0010969_5455_6480 | 341 |
| 199 | 3300046454 | Ga0495592_0255777 | Ga0495592_0255777_36_1061 | 341 |
| 200 | 3300046461 | Ga0495641_0072314 | Ga0495641_0072314_326_1351 | 341 |
| 201 | 3300046463 | Ga0495653_0098223 | Ga0495653_0098223_1066_2091 | 341 |
| 202 | 3300046472 | Ga0495580_0070023 | Ga0495580_0070023_804_1829 | 341 |
| 203 | 3300046476 | Ga0495662_0011936 | Ga0495662_0011936_1788_2813 | 341 |
| 204 | 3300046477 | Ga0495664_0036647 | Ga0495664_0036647_1031_2056 | 341 |
| 205 | 3300046499 | Ga0495594_0030457 | Ga0495594_0030457_1629_2654 | 341 |
| 206 | 3300046507 | Ga0495606_0017138 | Ga0495606_0017138_395_1429 | 341 |
| 207 | 3300046511 | Ga0495608_0003670 | Ga0495608_0003670_531_1556 | 341 |
| 208 | 3300046516 | Ga0495628_0333470 | Ga0495628_0333470_36_1061 | 341 |
| 209 | 3300046517 | Ga0495630_0102750 | Ga0495630_0102750_1043_2068 | 341 |
| 210 | 3300046529 | Ga0495652_0251724 | Ga0495652_0251724_248_1273 | 341 |
| 211 | 3300046531 | Ga0495665_0012235 | Ga0495665_0012235_148_1173 | 341 |
| 212 | 3300046535 | Ga0495586_0080769 | Ga0495586_0080769_380_1405 | 341 |
| 213 | 3300046557 | Ga0495622_0084075 | Ga0495622_0084075_374_1399 | 341 |
| 214 | 3300046559 | Ga0495667_0003592 | Ga0495667_0003592_1182_2207 | 341 |
| 215 | 3300046675 | Ga0495657_0115854 | Ga0495657_0115854_285_1310 | 341 |
| 216 | 3300046679 | Ga0495623_0086251 | Ga0495623_0086251_176_1201 | 341 |
| 217 | 3300046689 | Ga0495613_0165267 | Ga0495613_0165267_269_1294 | 341 |
| 218 | 3300046690 | Ga0495624_0063148 | Ga0495624_0063148_954_1979 | 341 |
| 219 | 3300046809 | Ga0495600_0023959 | Ga0495600_0023959_2628_3653 | 341 |
| 220 | 3300047317 | Ga0495604_0080993 | Ga0495604_0080993_1066_2091 | 341 |
| 221 | 3300047322 | Ga0495680_0061177 | Ga0495680_0061177_1837_2862 | 341 |
| 222 | 3300047444 | Ga0495675_0106792 | Ga0495675_0106792_426_1451 | 341 |
| 223 | 3300047673 | Ga0495593_0124198 | Ga0495593_0124198_175_1200 | 341 |
| 224 | 3300048089 | Ga0495614_0065935 | Ga0495614_0065935_418_1443 | 341 |
| 225 | 3300048904 | Ga0496101_0200768 | Ga0496101_0200768_261_1328 | 341 |
| 226 | 3300048908 | Ga0496105_0015123 | Ga0496105_0015123_1978_3045 | 341 |
| 227 | 3300048911 | Ga0496108_0054704 | Ga0496108_0054704_1017_2084 | 341 |
| 228 | 3300048912 | Ga0496109_0067016 | Ga0496109_0067016_2023_3090 | 341 |
| 229 | 3300048915 | Ga0496112_0033425 | Ga0496112_0033425_1828_2895 | 341 |
| 230 | 3300048916 | Ga0496113_0021220 | Ga0496113_0021220_697_1764 | 341 |
| 231 | 3300048918 | Ga0496115_0041977 | Ga0496115_0041977_2436_3503 | 341 |
| 232 | 3300048929 | Ga0496126_0017841 | Ga0496126_0017841_1497_2531 | 341 |
| 233 | 3300048929 | Ga0496126_0049956 | Ga0496126_0049956_1426_2454 | 341 |
| 234 | 3300049571 | Ga0501034_0004257 | Ga0501034_0004257_5471_6496 | 341 |
| 235 | 3300049572 | Ga0501036_0001531 | Ga0501036_0001531_14231_15256 | 341 |
| 236 | 3300049573 | Ga0501037_0010228 | Ga0501037_0010228_3275_4300 | 341 |
| 237 | 3300049578 | Ga0501042_0004561 | Ga0501042_0004561_6374_7399 | 341 |
| 238 | 3300049579 | Ga0501043_0007852 | Ga0501043_0007852_3799_4824 | 341 |
| 239 | 3300049581 | Ga0501047_0012110 | Ga0501047_0012110_4795_5820 | 341 |
| 240 | 3300049582 | Ga0501048_0010509 | Ga0501048_0010509_1521_2546 | 341 |
| 241 | 3300049590 | Ga0501074_0003425 | Ga0501074_0003425_4469_5494 | 341 |
| 242 | 3300049823 | Ga0501044_0043610 | Ga0501044_0043610_3185_4210 | 341 |
| 243 | 3300049823 | Ga0501044_0132267 | Ga0501044_0132267_1194_2219 | 341 |
| 244 | 3300049823 | Ga0501044_0288242 | Ga0501044_0288242_340_1365 | 341 |
| 245 | 3300050507 | nmdc:mga05p37_304112_c1 | nmdc:mga05p37_304112_c1_73_1098 | 341 |
| 246 | 3300053078 | Ga0495612_0050288 | Ga0495612_0050288_141_1166 | 341 |
| 247 | 3300053084 | Ga0495595_0014870 | Ga0495595_0014870_647_1672 | 341 |
| 248 | 3300053085 | Ga0495619_0013573 | Ga0495619_0013573_112_1137 | 341 |
| 249 | iso_pu_bacteria | 2643221567 | 2643851799 | 341 |
| 250 | iso_pu_bacteria | 2643221624 | 2644137612 | 341 |
| 251 | iso_pu_bacteria | 2808606365 | 2808872401 | 341 |
| 252 | iso_pu_bacteria | 2842888712 | 2842890927 | 341 |
| 253 | iso_pu_bacteria | 2919446982 | 2919448745 | 341 |
| 254 | 3300028381 | Ga0268264_10001453 | Ga0268264_1000145312 | 342 |
| 255 | 3300041512 | Ga0451853_0637535 | Ga0451853_0637535_1241_2269 | 342 |
| 256 | 3300003203 | JGI25406J46586_10028762 | JGI25406J46586_100287621 | 343 |
| 257 | 3300005548 | Ga0070665_100104285 | Ga0070665_1001042853 | 343 |
| 258 | 3300005577 | Ga0068857_100028260 | Ga0068857_1000282604 | 343 |
| 259 | 3300005985 | Ga0081539_10000662 | Ga0081539_1000066259 | 343 |
| 260 | 3300005985 | Ga0081539_10003079 | Ga0081539_1000307913 | 343 |
| 261 | 3300005985 | Ga0081539_10005763 | Ga0081539_100057635 | 343 |
| 262 | 3300005985 | Ga0081539_10009318 | Ga0081539_100093182 | 343 |
| 263 | 3300006038 | Ga0075365_10008254 | Ga0075365_100082544 | 343 |
| 264 | 3300006038 | Ga0075365_10084926 | Ga0075365_100849262 | 343 |
| 265 | 3300009176 | Ga0105242_10147112 | Ga0105242_101471122 | 343 |
| 266 | 3300013307 | Ga0157372_10262191 | Ga0157372_102621911 | 343 |
| 267 | 3300014325 | Ga0163163_10123777 | Ga0163163_101237773 | 343 |
| 268 | 3300020082 | Ga0206353_10484881 | Ga0206353_104848812 | 343 |
| 269 | 3300020082 | Ga0206353_11650896 | Ga0206353_116508962 | 343 |
| 270 | 3300026116 | Ga0207674_10026995 | Ga0207674_100269953 | 343 |
| 271 | 3300026121 | Ga0207683_10086685 | Ga0207683_100866852 | 343 |
| 272 | 3300028794 | Ga0307515_10237996 | Ga0307515_102379962 | 343 |
| 273 | 3300031247 | Ga0265340_10000300 | Ga0265340_100003004 | 343 |
| 274 | 3300031456 | Ga0307513_10028036 | Ga0307513_100280366 | 343 |
| 275 | 3300031852 | Ga0307410_10005453 | Ga0307410_100054534 | 343 |
| 276 | 3300031903 | Ga0307407_10207339 | Ga0307407_102073392 | 343 |
| 277 | 3300031911 | Ga0307412_10031407 | Ga0307412_100314072 | 343 |
| 278 | 3300031995 | Ga0307409_100021734 | Ga0307409_1000217342 | 343 |
| 279 | 3300031995 | Ga0307409_100046562 | Ga0307409_1000465623 | 343 |
| 280 | 3300031995 | Ga0307409_100067295 | Ga0307409_1000672952 | 343 |
| 281 | 3300031995 | Ga0307409_100276277 | Ga0307409_1002762772 | 343 |
| 282 | 3300032002 | Ga0307416_100004821 | Ga0307416_1000048214 | 343 |
| 283 | 3300032002 | Ga0307416_100145201 | Ga0307416_1001452012 | 343 |
| 284 | 3300032002 | Ga0307416_100465115 | Ga0307416_1004651152 | 343 |
| 285 | 3300032126 | Ga0307415_100082083 | Ga0307415_1000820832 | 343 |
| 286 | 3300038443 | Ga0395901_0010884 | Ga0395901_0010884_1279_2325 | 343 |
| 287 | 3300038443 | Ga0395901_0043230 | Ga0395901_0043230_2922_3968 | 343 |
| 288 | 3300044684 | Ga0466966_0013789 | Ga0466966_0013789_3018_4190 | 343 |
| 289 | 3300044684 | Ga0466966_0071784 | Ga0466966_0071784_63_1100 | 343 |
| 290 | 3300044693 | Ga0466961_0070886 | Ga0466961_0070886_181_1353 | 343 |
| 291 | 3300044719 | Ga0466971_0032105 | Ga0466971_0032105_189_1226 | 343 |
| 292 | 3300044765 | Ga0466970_0051154 | Ga0466970_0051154_916_1959 | 343 |
| 293 | 3300045049 | Ga0466959_0124496 | Ga0466959_0124496_237_1409 | 343 |
| 294 | 3300045049 | Ga0466959_0139647 | Ga0466959_0139647_659_1696 | 343 |
| 295 | 3300045976 | Ga0466967_0139356 | Ga0466967_0139356_965_2002 | 343 |
| 296 | 3300046663 | Ga0495635_0144626 | Ga0495635_0144626_219_1265 | 343 |
| 297 | 3300047320 | Ga0495672_0024216 | Ga0495672_0024216_833_1870 | 343 |
| 298 | 3300048910 | Ga0496107_0229629 | Ga0496107_0229629_19_1065 | 343 |
| 299 | 3300048918 | Ga0496115_0347179 | Ga0496115_0347179_82_1128 | 343 |
| 300 | 3300049572 | Ga0501036_0015455 | Ga0501036_0015455_498_1544 | 343 |
| 301 | 3300049573 | Ga0501037_0088274 | Ga0501037_0088274_541_1587 | 343 |
| 302 | 3300049575 | Ga0501039_0128880 | Ga0501039_0128880_137_1174 | 343 |
| 303 | 3300049580 | Ga0501046_0021187 | Ga0501046_0021187_2103_3158 | 343 |
| 304 | 3300049582 | Ga0501048_0044193 | Ga0501048_0044193_446_1492 | 343 |
| 305 | 3300049588 | Ga0501072_0034541 | Ga0501072_0034541_1134_2189 | 343 |
| 306 | 3300049589 | Ga0501073_0175996 | Ga0501073_0175996_370_1422 | 343 |
| 307 | 3300049590 | Ga0501074_0142942 | Ga0501074_0142942_497_1552 | 343 |
| 308 | 3300049592 | Ga0501076_0033355 | Ga0501076_0033355_1767_2813 | 343 |
| 309 | 3300049593 | Ga0501077_0019668 | Ga0501077_0019668_1677_2732 | 343 |
| 310 | 3300049741 | Ga0501079_0016094 | Ga0501079_0016094_1875_2930 | 343 |
| 311 | 3300049743 | Ga0501081_0028356 | Ga0501081_0028356_1978_3024 | 343 |
| 312 | 3300053153 | Ga0500616_0000377 | Ga0500616_0000377_30150_31187 | 343 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ast-assembly1.cif.gz_F | the apo structure of a bacterial aldo-keto reductase akr14a1 | 0.9833 | 4 | 328 |
| 3n6q-assembly1.cif.gz_D | crystal structure of yghz from e. coli | 0.9803 | 4 | 328 |
| 3erp-assembly1.cif.gz_B-5 | structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium | 0.9781 | 5 | 328 |
| 3n6q-assembly3.cif.gz_E-2 | crystal structure of yghz from e. coli | 0.9773 | 4 | 329 |
| 4ast-assembly1.cif.gz_H | the apo structure of a bacterial aldo-keto reductase akr14a1 | 0.977 | 4 | 329 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3n6qB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9751 | 17 | 328 | 3.20.20.100 |
| 3n6qB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9497 | 17 | 328 | 3.20.20.100 |
| af_O59826_13_339_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9314 | 16 | 329 | 3.20.20.100 |
| af_C4J2K0_1_323_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9181 | 15 | 335 | 3.20.20.100 |
| af_C4J2K0_1_323_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.91 | 15 | 335 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A614Z7P8-F1-model_v4 | L-glyceraldehyde 3-phosphate reductase | 0.9863 | 4 | 222 |
GO:0016491
GO:0051596 |
| AF-A0A7Z0X0R6-F1-model_v4 | Putative ion-channel protein | 0.986 | 4 | 215 |
GO:0016491
GO:0051596 |
| AF-A0A6V8KKT3-F1-model_v4 | NADP-dependent oxidoreductase domain-containing protein | 0.9859 | 4 | 220 |
GO:0016491
GO:0051596 |
| AF-A0A7W1R132-F1-model_v4 | Aldo/keto reductase | 0.985 | 15 | 204 |
GO:0016491
GO:0051596 |
| AF-A0A2G2A5G1-F1-model_v4 | L-glyceraldehyde 3-phosphate reductase | 0.9845 | 4 | 180 |
GO:0016491
GO:0051596 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar