F401850

General Info

Members Datasets Scaffolds Average Seq Length
312 172 624 233

Family's Representative Sequence

Representative Sequence 3300046537|Ga0495598_0067968|Ga0495598_0067968_94_882
Length 262
Sequence MIFDLRSLIFERNTKVEDQKSKIVFAKNLMKIALIGYGAMGKLIGALAEKKDHEIAVIIDEADADLSATSLADKLKGAEVAIDFSAAGAVKRNVEACVLAGVPLVEGTTGWNAQREEIENFVKESGGAFVFGANFSVGVNLFYRIAAYASELFAKFKDYEAFIEEQHHSRKKDAPSGTALKLKDIVAEHIKKDLSVSSTRAGNIPGTHRVGFDGGADQILLEHTARSREGFASGAILAAEWIAGRKGFYEFTDVMDEIIRQK

Samples

Sample ID Description Type Environment
1 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
147 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
148 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
149 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
150 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
154 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
155 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
156 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
157 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
158 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
159 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
160 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
161 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
162 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
163 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
164 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
165 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.56
Rhizosphere 95.19
Stem 0
Stem Tuber 0
Unclassified 25.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495598_0067968 3300046537 Bacteria 1115
2 LJQas_1000020 3300000549 Bacteria 24760
3 JGI25406J46586_10005074 3300003203 Bacteria 6108
4 JGI25406J46586_10024419 3300003203 Unclassified 2369
5 rootL2_10162874 3300003322 Bacteria 2980
6 Ga0070658_10000858 3300005327 Bacteria 25965
7 Ga0070683_100510306 3300005329 Unclassified 1149
8 Ga0070690_100058538 3300005330 Unclassified 2475
9 Ga0070670_100031843 3300005331 Bacteria 4541
10 Ga0070670_100052178 3300005331 Bacteria 3512
11 Ga0068869_100070594 3300005334 Bacteria 2585
12 Ga0070680_100046919 3300005336 Unclassified 3515
13 Ga0070680_100308191 3300005336 Bacteria 1343
14 Ga0070682_100238632 3300005337 Bacteria 1304
15 Ga0068868_100618483 3300005338 Bacteria 961
16 Ga0070660_100041109 3300005339 Bacteria 3523
17 Ga0070660_100124130 3300005339 Bacteria 2062
18 Ga0070689_100268317 3300005340 Bacteria 1412
19 Ga0070689_100367061 3300005340 Bacteria 1211
20 Ga0070661_100022516 3300005344 Bacteria 4512
21 Ga0070661_100138255 3300005344 Bacteria 1834
22 Ga0070661_100199911 3300005344 Bacteria 1527
23 Ga0070669_100320656 3300005353 Bacteria 1251
24 Ga0070671_100041418 3300005355 Bacteria 3828
25 Ga0070688_100034415 3300005365 Bacteria 3069
26 Ga0070659_100233077 3300005366 Bacteria 1522
27 Ga0070659_100384592 3300005366 Bacteria 1182
28 Ga0070667_100027865 3300005367 Bacteria 4701
29 Ga0070703_10006838 3300005406 Bacteria 3201
30 Ga0070701_10497051 3300005438 Bacteria 791
31 Ga0070705_100281679 3300005440 Unclassified 1182
32 Ga0070694_100040577 3300005444 Bacteria 3102
33 Ga0070694_100091505 3300005444 Bacteria 2135
34 Ga0070694_100260672 3300005444 Bacteria 1315
35 Ga0070694_100562197 3300005444 Bacteria 914
36 Ga0070708_100001006 3300005445 Bacteria 21546
37 Ga0070663_100576599 3300005455 Unclassified 943
38 Ga0070678_100291116 3300005456 Unclassified 1384
39 Ga0070662_100264512 3300005457 Bacteria 1387
40 Ga0070662_100550132 3300005457 Bacteria 967
41 Ga0070681_10025364 3300005458 Bacteria 5963
42 Ga0070681_10325633 3300005458 Bacteria 1446
43 Ga0070706_100009054 3300005467 Bacteria 9267
44 Ga0070706_100292183 3300005467 Bacteria 1521
45 Ga0070706_100521807 3300005467 Bacteria 1105
46 Ga0070707_100811331 3300005468 Bacteria 900
47 Ga0070698_100023895 3300005471 Bacteria 6381
48 Ga0070698_100046664 3300005471 Bacteria 4429
49 Ga0070698_100387789 3300005471 Bacteria 1330
50 Ga0070699_100002005 3300005518 Bacteria 18382
51 Ga0070699_100003132 3300005518 Bacteria 14641
52 Ga0070699_100013708 3300005518 Bacteria 6974
53 Ga0070699_100112968 3300005518 Bacteria 2386
54 Ga0070699_100155824 3300005518 Bacteria 2021
55 Ga0070679_100108295 3300005530 Unclassified 2765
56 Ga0070684_100267794 3300005535 Bacteria 1563
57 Ga0070684_100690749 3300005535 Bacteria 951
58 Ga0070684_100896377 3300005535 Bacteria 831
59 Ga0070697_100015470 3300005536 Bacteria 5990
60 Ga0070697_100067233 3300005536 Bacteria 2931
61 Ga0070697_100264466 3300005536 Unclassified 1473
62 Ga0068853_100016249 3300005539 Bacteria 6125
63 Ga0068853_100034552 3300005539 Unclassified 4292
64 Ga0070686_100051376 3300005544 Unclassified 2624
65 Ga0070686_100511034 3300005544 Unclassified 934
66 Ga0070696_100077275 3300005546 Bacteria 2352
67 Ga0070693_100225632 3300005547 Unclassified 1230
68 Ga0070665_100243358 3300005548 Bacteria 1799
69 Ga0070704_100006484 3300005549 Bacteria 6900
70 Ga0070704_100177885 3300005549 Viruses 1699
71 Ga0070704_100223670 3300005549 Unclassified 1532
72 Ga0068855_100012502 3300005563 Bacteria 10246
73 Ga0068855_100489461 3300005563 Bacteria 1338
74 Ga0068855_100526506 3300005563 Viruses 1282
75 Ga0070664_100018434 3300005564 Bacteria 5734
76 Ga0070664_100145330 3300005564 Bacteria 2091
77 Ga0070664_100170263 3300005564 Bacteria 1932
78 Ga0070664_100340797 3300005564 Bacteria 1362
79 Ga0068857_100043563 3300005577 Bacteria 3980
80 Ga0068857_100249236 3300005577 Unclassified 1628
81 Ga0068854_100546381 3300005578 Unclassified 982
82 Ga0068852_100246957 3300005616 Bacteria 1708
83 Ga0068852_100616883 3300005616 Unclassified 1090
84 Ga0068859_100222446 3300005617 Bacteria 1975
85 Ga0068859_100326927 3300005617 Unclassified 1627
86 Ga0068859_100332382 3300005617 Bacteria 1614
87 Ga0068864_100013618 3300005618 Bacteria 6742
88 Ga0068864_100044278 3300005618 Bacteria 3814
89 Ga0068864_100092228 3300005618 Bacteria 2673
90 Ga0068864_100100600 3300005618 Bacteria 2563
91 Ga0068864_100127544 3300005618 Bacteria 2281
92 Ga0068864_100340353 3300005618 Bacteria 1413
93 Ga0068861_100022458 3300005719 Bacteria 4546
94 Ga0068861_100228305 3300005719 Unclassified 1577
95 Ga0068851_10207034 3300005834 Unclassified 1097
96 Ga0068851_10277925 3300005834 Unclassified 957
97 Ga0068863_100057728 3300005841 Bacteria 3673
98 Ga0068863_100431358 3300005841 Bacteria 1292
99 Ga0068863_101167166 3300005841 Unclassified 775
100 Ga0068860_100152036 3300005843 Bacteria 2229
101 Ga0081539_10000063 3300005985 Bacteria 248201
102 Ga0081539_10000788 3300005985 Bacteria 61718
103 Ga0081539_10002056 3300005985 Bacteria 30178
104 Ga0081539_10167993 3300005985 Unclassified 1040
105 Ga0070716_100005183 3300006173 Bacteria 6302
106 Ga0070716_100130259 3300006173 Bacteria 1589
107 Ga0097621_100707072 3300006237 Bacteria 928
108 Ga0075430_100227498 3300006846 Bacteria 1547
109 Ga0068865_100056695 3300006881 Unclassified 2731
110 Ga0097620_100222458 3300006931 Bacteria 1975
111 Ga0097620_100326917 3300006931 Unclassified 1627
112 Ga0097620_100332397 3300006931 Bacteria 1614
113 Ga0105240_10994162 3300009093 Bacteria 898
114 Ga0105247_10011454 3300009101 Bacteria 5346
115 Ga0114129_10085254 3300009147 Bacteria 4383
116 Ga0114129_10225785 3300009147 Bacteria 2524
117 Ga0105242_10148644 3300009176 Unclassified 2041
118 Ga0105248_10395577 3300009177 Unclassified 1556
119 Ga0105237_10138410 3300009545 Bacteria 2429
120 Ga0105237_10238565 3300009545 Bacteria 1819
121 Ga0105249_10025699 3300009553 Bacteria 5303
122 Ga0105249_10047721 3300009553 Bacteria 3903
123 Ga0105249_10334718 3300009553 Unclassified 1529
124 Ga0105249_10521217 3300009553 Bacteria 1236
125 Ga0105239_10155043 3300010375 Bacteria 2557
126 Ga0157373_10015917 3300013100 Bacteria 5491
127 Ga0157373_10163340 3300013100 Bacteria 1567
128 Ga0157373_10382070 3300013100 Bacteria 1007
129 Ga0157369_10018295 3300013105 Bacteria 7858
130 Ga0157369_10917390 3300013105 Unclassified 898
131 Ga0157374_10630805 3300013296 Bacteria 1083
132 Ga0157378_10032681 3300013297 Bacteria 4597
133 Ga0157378_10071013 3300013297 Bacteria 3126
134 Ga0157378_10219347 3300013297 Bacteria 1807
135 Ga0163162_10025221 3300013306 Bacteria 5875
136 Ga0163162_10048656 3300013306 Bacteria 4249
137 Ga0163162_10250431 3300013306 Bacteria 1903
138 Ga0163162_10318866 3300013306 Bacteria 1687
139 Ga0163162_10332675 3300013306 Unclassified 1651
140 Ga0157372_10136033 3300013307 Bacteria 2830
141 Ga0157372_10456573 3300013307 Bacteria 1489
142 Ga0157372_11012464 3300013307 Bacteria 962
143 Ga0157372_11372328 3300013307 Bacteria 815
144 Ga0157375_10009654 3300013308 Bacteria 8483
145 Ga0157375_10059630 3300013308 Unclassified 3782
146 Ga0157375_10346150 3300013308 Bacteria 1652
147 Ga0163163_10029010 3300014325 Bacteria 5320
148 Ga0163163_10144223 3300014325 Bacteria 2424
149 Ga0163163_10590395 3300014325 Bacteria 1174
150 Ga0157380_10039171 3300014326 Unclassified 3684
151 Ga0157380_10412398 3300014326 Bacteria 1285
152 Ga0157380_10523183 3300014326 Bacteria 1157
153 Ga0157379_10212800 3300014968 Bacteria 1750
154 Ga0163161_10000948 3300017792 Bacteria 22261
155 Ga0163161_10010028 3300017792 Bacteria 6558
156 Ga0213876_10000137 3300021384 Bacteria 79910
157 Ga0213876_10000385 3300021384 Bacteria 37341
158 Ga0207653_10003477 3300025885 Bacteria 4958
159 Ga0207710_10076938 3300025900 Unclassified 1541
160 Ga0207643_10103671 3300025908 Unclassified 1670
161 Ga0207705_10003749 3300025909 Bacteria 11579
162 Ga0207684_10335204 3300025910 Bacteria 1303
163 Ga0207684_10468573 3300025910 Bacteria 1081
164 Ga0207654_10129373 3300025911 Bacteria 1596
165 Ga0207707_10009459 3300025912 Bacteria 8451
166 Ga0207707_10037885 3300025912 Bacteria 4213
167 Ga0207707_10158560 3300025912 Bacteria 1978
168 Ga0207707_10724786 3300025912 Unclassified 833
169 Ga0207660_10180227 3300025917 Bacteria 1640
170 Ga0207657_10094797 3300025919 Bacteria 2484
171 Ga0207657_10282349 3300025919 Unclassified 1318
172 Ga0207649_10039575 3300025920 Bacteria 2860
173 Ga0207649_10229599 3300025920 Bacteria 1326
174 Ga0207649_10508561 3300025920 Unclassified 917
175 Ga0207652_10293516 3300025921 Bacteria 1467
176 Ga0207646_10016972 3300025922 Bacteria 6823
177 Ga0207646_10034502 3300025922 Bacteria 4572
178 Ga0207681_10383292 3300025923 Bacteria 1132
179 Ga0207650_10070881 3300025925 Bacteria 2620
180 Ga0207650_10156712 3300025925 Bacteria 1801
181 Ga0207659_10197399 3300025926 Bacteria 1605
182 Ga0207644_10020730 3300025931 Unclassified 4472
183 Ga0207706_10543481 3300025933 Bacteria 1001
184 Ga0207670_10104352 3300025936 Bacteria 2030
185 Ga0207670_10246284 3300025936 Unclassified 1379
186 Ga0207670_10324210 3300025936 Bacteria 1213
187 Ga0207704_10056515 3300025938 Unclassified 2405
188 Ga0207665_10002680 3300025939 Bacteria 11952
189 Ga0207665_10159502 3300025939 Bacteria 1621
190 Ga0207711_10035034 3300025941 Bacteria 4253
191 Ga0207689_10145796 3300025942 Bacteria 1950
192 Ga0207661_10892625 3300025944 Bacteria 819
193 Ga0207679_10128453 3300025945 Unclassified 2029
194 Ga0207679_10152005 3300025945 Unclassified 1885
195 Ga0207667_10661554 3300025949 Bacteria 1049
196 Ga0207667_10837012 3300025949 Bacteria 915
197 Ga0207712_10264758 3300025961 Bacteria 1396
198 Ga0207712_10344259 3300025961 Bacteria 1237
199 Ga0207712_10398262 3300025961 Unclassified 1156
200 Ga0207668_10450449 3300025972 Bacteria 1098
201 Ga0207658_10131615 3300025986 Bacteria 2010
202 Ga0207703_10179408 3300026035 Unclassified 1868
203 Ga0207703_10219316 3300026035 Unclassified 1700
204 Ga0207639_10003584 3300026041 Bacteria 10426
205 Ga0207639_10071960 3300026041 Bacteria 2706
206 Ga0207639_10096613 3300026041 Unclassified 2377
207 Ga0207639_10183151 3300026041 Bacteria 1783
208 Ga0207678_10371696 3300026067 Unclassified 1235
209 Ga0207641_10055354 3300026088 Unclassified 3368
210 Ga0207641_10074371 3300026088 Bacteria 2931
211 Ga0207641_10202605 3300026088 Bacteria 1831
212 Ga0207641_10302797 3300026088 Unclassified 1510
213 Ga0207676_10190894 3300026095 Bacteria 1802
214 Ga0207676_10309455 3300026095 Bacteria 1446
215 Ga0207676_10367377 3300026095 Bacteria 1335
216 Ga0207674_10000841 3300026116 Bacteria 40016
217 Ga0207674_10017846 3300026116 Bacteria 7736
218 Ga0207675_100030763 3300026118 Bacteria 4999
219 Ga0207683_10286909 3300026121 Unclassified 1505
220 Ga0268266_10463335 3300028379 Bacteria 1206
221 Ga0268264_10314269 3300028381 Unclassified 1479
222 Ga0307408_100026082 3300031548 Unclassified 4009
223 Ga0307408_100178009 3300031548 Bacteria 1703
224 Ga0307408_100247244 3300031548 Bacteria 1469
225 Ga0307405_10006838 3300031731 Bacteria 5653
226 Ga0307405_10013125 3300031731 Unclassified 4411
227 Ga0307405_10013668 3300031731 Bacteria 4337
228 Ga0307405_10157890 3300031731 Bacteria 1603
229 Ga0307405_10442106 3300031731 Bacteria 1029
230 Ga0307405_10575680 3300031731 Unclassified 915
231 Ga0307413_10005481 3300031824 Bacteria 5671
232 Ga0307413_10170851 3300031824 Unclassified 1538
233 Ga0307410_10000711 3300031852 Bacteria 13908
234 Ga0307410_10004535 3300031852 Bacteria 7196
235 Ga0307410_10110200 3300031852 Unclassified 1991
236 Ga0307410_10272924 3300031852 Bacteria 1323
237 Ga0307406_10003348 3300031901 Bacteria 8736
238 Ga0307406_10013272 3300031901 Unclassified 4716
239 Ga0307406_10184229 3300031901 Unclassified 1523
240 Ga0307406_10239383 3300031901 Unclassified 1360
241 Ga0307407_10000438 3300031903 Bacteria 12733
242 Ga0307407_10011738 3300031903 Unclassified 4184
243 Ga0307407_10018584 3300031903 Bacteria 3519
244 Ga0307407_10061008 3300031903 Unclassified 2203
245 Ga0307407_10284504 3300031903 Unclassified 1147
246 Ga0307412_10057329 3300031911 Unclassified 2600
247 Ga0307409_100095974 3300031995 Bacteria 2444
248 Ga0307409_100105948 3300031995 Bacteria 2345
249 Ga0307409_100220203 3300031995 Bacteria 1713
250 Ga0307416_100045266 3300032002 Bacteria 3464
251 Ga0307416_100050010 3300032002 Bacteria 3328
252 Ga0307416_100221311 3300032002 Bacteria 1816
253 Ga0307416_100474559 3300032002 Unclassified 1309
254 Ga0307416_101080734 3300032002 Unclassified 906
255 Ga0307416_101656206 3300032002 Unclassified 745
256 Ga0307414_10313510 3300032004 Bacteria 1332
257 Ga0307411_10001977 3300032005 Bacteria 8794
258 Ga0307411_10003358 3300032005 Bacteria 7418
259 Ga0307411_10014173 3300032005 Bacteria 4427
260 Ga0307415_100049426 3300032126 Bacteria 2843
261 Ga0307415_100069047 3300032126 Bacteria 2476
262 Ga0307415_100225817 3300032126 Bacteria 1504
263 Ga0307415_100556204 3300032126 Bacteria 1013
264 Ga0373943_0048449 3300035170 Unclassified 2082
265 Ga0373937_0079096 3300036401 Bacteria 3039
266 Ga0395905_0006977 3300037471 Bacteria 11295
267 Ga0395901_0832019 3300038443 Unclassified 910
268 Ga0436365_0453322 3300039437 Bacteria 114543
269 Ga0436365_1885657 3300039437 Bacteria 103056
270 Ga0436363_0453616 3300039450 Bacteria 2505
271 Ga0451849_0658708 3300041505 Unclassified 2219
272 Ga0495664_0274009 3300046477 Bacteria 1020
273 Ga0495668_0000552 3300046616 Bacteria 46274
274 Ga0495613_0038043 3300046689 Bacteria 3566
275 Ga0496104_0158882 3300048907 Bacteria 2169
276 Ga0496106_0573421 3300048909 Bacteria 905
277 Ga0496108_0121038 3300048911 Bacteria 2245
278 Ga0496108_0256443 3300048911 Bacteria 1522
279 Ga0496108_0360850 3300048911 Bacteria 1268
280 Ga0496112_0409153 3300048915 Unclassified 1296
281 Ga0496114_0184715 3300048917 Bacteria 1822
282 Ga0496115_0011716 3300048918 Bacteria 6584
283 Ga0501291_000968 3300049514 Unclassified 3304
284 Ga0501292_016048 3300049515 Unclassified 1175
285 Ga0501295_014546 3300049518 Bacteria 1329
286 Ga0501296_004134 3300049519 Bacteria 1572
287 Ga0501298_001010 3300049521 Unclassified 4018
288 Ga0501298_002671 3300049521 Bacteria 2717
289 Ga0501038_0008160 3300049574 Bacteria 9635
290 Ga0501039_0594882 3300049575 Bacteria 867
291 Ga0501198_041313 3300049649 Bacteria 800
292 Ga0501202_013651 3300049652 Bacteria 1548
293 Ga0501206_010121 3300049653 Unclassified 1259
294 Ga0501208_004233 3300049655 Unclassified 1677
295 Ga0501227_020262 3300049665 Bacteria 1524
296 Ga0501233_055040 3300049668 Bacteria 973
297 Ga0501235_009210 3300049669 Bacteria 2158
298 Ga0501243_005716 3300049675 Bacteria 1872
299 Ga0501257_031593 3300049686 Unclassified 1278
300 Ga0501225_0064579 3300049705 Unclassified 1033
301 Ga0501268_029456 3300049765 Bacteria 986
302 Ga0501268_042815 3300049765 Bacteria 857
303 Ga0501270_003005 3300049767 Unclassified 1784
304 Ga0501273_001410 3300049770 Unclassified 2281
305 Ga0501045_0624718 3300049824 Bacteria 797
306 nmdc:mga05p37_292599_c1 3300050507 Bacteria 1938
307 nmdc:mga0n895_14704_c1 3300050512 Bacteria 7118
308 nmdc:mga0rr50_73044_c1 3300050513 Bacteria 2621
309 nmdc:mga08x19_20458_c1 3300050514 Bacteria 4074
310 nmdc:mga0a205_667182_c1 3300050515 Unclassified 890
311 nmdc:mga0a205_67734_c1 3300050515 Bacteria 3449
312 Ga0501082_0544507 3300060353 Unclassified 1015
313 Ga0495598_0067968
314 LJQas_1000020
315 JGI25406J46586_10005074
316 JGI25406J46586_10024419
317 rootL2_10162874
318 Ga0070658_10000858
319 Ga0070683_100510306
320 Ga0070690_100058538
321 Ga0070670_100031843
322 Ga0070670_100052178
323 Ga0068869_100070594
324 Ga0070680_100046919
325 Ga0070680_100308191
326 Ga0070682_100238632
327 Ga0068868_100618483
328 Ga0070660_100041109
329 Ga0070660_100124130
330 Ga0070689_100268317
331 Ga0070689_100367061
332 Ga0070661_100022516
333 Ga0070661_100138255
334 Ga0070661_100199911
335 Ga0070669_100320656
336 Ga0070671_100041418
337 Ga0070688_100034415
338 Ga0070659_100233077
339 Ga0070659_100384592
340 Ga0070667_100027865
341 Ga0070703_10006838
342 Ga0070701_10497051
343 Ga0070705_100281679
344 Ga0070694_100040577
345 Ga0070694_100091505
346 Ga0070694_100260672
347 Ga0070694_100562197
348 Ga0070708_100001006
349 Ga0070663_100576599
350 Ga0070678_100291116
351 Ga0070662_100264512
352 Ga0070662_100550132
353 Ga0070681_10025364
354 Ga0070681_10325633
355 Ga0070706_100009054
356 Ga0070706_100292183
357 Ga0070706_100521807
358 Ga0070707_100811331
359 Ga0070698_100023895
360 Ga0070698_100046664
361 Ga0070698_100387789
362 Ga0070699_100002005
363 Ga0070699_100003132
364 Ga0070699_100013708
365 Ga0070699_100112968
366 Ga0070699_100155824
367 Ga0070679_100108295
368 Ga0070684_100267794
369 Ga0070684_100690749
370 Ga0070684_100896377
371 Ga0070697_100015470
372 Ga0070697_100067233
373 Ga0070697_100264466
374 Ga0068853_100016249
375 Ga0068853_100034552
376 Ga0070686_100051376
377 Ga0070686_100511034
378 Ga0070696_100077275
379 Ga0070693_100225632
380 Ga0070665_100243358
381 Ga0070704_100006484
382 Ga0070704_100177885
383 Ga0070704_100223670
384 Ga0068855_100012502
385 Ga0068855_100489461
386 Ga0068855_100526506
387 Ga0070664_100018434
388 Ga0070664_100145330
389 Ga0070664_100170263
390 Ga0070664_100340797
391 Ga0068857_100043563
392 Ga0068857_100249236
393 Ga0068854_100546381
394 Ga0068852_100246957
395 Ga0068852_100616883
396 Ga0068859_100222446
397 Ga0068859_100326927
398 Ga0068859_100332382
399 Ga0068864_100013618
400 Ga0068864_100044278
401 Ga0068864_100092228
402 Ga0068864_100100600
403 Ga0068864_100127544
404 Ga0068864_100340353
405 Ga0068861_100022458
406 Ga0068861_100228305
407 Ga0068851_10207034
408 Ga0068851_10277925
409 Ga0068863_100057728
410 Ga0068863_100431358
411 Ga0068863_101167166
412 Ga0068860_100152036
413 Ga0081539_10000063
414 Ga0081539_10000788
415 Ga0081539_10002056
416 Ga0081539_10167993
417 Ga0070716_100005183
418 Ga0070716_100130259
419 Ga0097621_100707072
420 Ga0075430_100227498
421 Ga0068865_100056695
422 Ga0097620_100222458
423 Ga0097620_100326917
424 Ga0097620_100332397
425 Ga0105240_10994162
426 Ga0105247_10011454
427 Ga0114129_10085254
428 Ga0114129_10225785
429 Ga0105242_10148644
430 Ga0105248_10395577
431 Ga0105237_10138410
432 Ga0105237_10238565
433 Ga0105249_10025699
434 Ga0105249_10047721
435 Ga0105249_10334718
436 Ga0105249_10521217
437 Ga0105239_10155043
438 Ga0157373_10015917
439 Ga0157373_10163340
440 Ga0157373_10382070
441 Ga0157369_10018295
442 Ga0157369_10917390
443 Ga0157374_10630805
444 Ga0157378_10032681
445 Ga0157378_10071013
446 Ga0157378_10219347
447 Ga0163162_10025221
448 Ga0163162_10048656
449 Ga0163162_10250431
450 Ga0163162_10318866
451 Ga0163162_10332675
452 Ga0157372_10136033
453 Ga0157372_10456573
454 Ga0157372_11012464
455 Ga0157372_11372328
456 Ga0157375_10009654
457 Ga0157375_10059630
458 Ga0157375_10346150
459 Ga0163163_10029010
460 Ga0163163_10144223
461 Ga0163163_10590395
462 Ga0157380_10039171
463 Ga0157380_10412398
464 Ga0157380_10523183
465 Ga0157379_10212800
466 Ga0163161_10000948
467 Ga0163161_10010028
468 Ga0213876_10000137
469 Ga0213876_10000385
470 Ga0207653_10003477
471 Ga0207710_10076938
472 Ga0207643_10103671
473 Ga0207705_10003749
474 Ga0207684_10335204
475 Ga0207684_10468573
476 Ga0207654_10129373
477 Ga0207707_10009459
478 Ga0207707_10037885
479 Ga0207707_10158560
480 Ga0207707_10724786
481 Ga0207660_10180227
482 Ga0207657_10094797
483 Ga0207657_10282349
484 Ga0207649_10039575
485 Ga0207649_10229599
486 Ga0207649_10508561
487 Ga0207652_10293516
488 Ga0207646_10016972
489 Ga0207646_10034502
490 Ga0207681_10383292
491 Ga0207650_10070881
492 Ga0207650_10156712
493 Ga0207659_10197399
494 Ga0207644_10020730
495 Ga0207706_10543481
496 Ga0207670_10104352
497 Ga0207670_10246284
498 Ga0207670_10324210
499 Ga0207704_10056515
500 Ga0207665_10002680
501 Ga0207665_10159502
502 Ga0207711_10035034
503 Ga0207689_10145796
504 Ga0207661_10892625
505 Ga0207679_10128453
506 Ga0207679_10152005
507 Ga0207667_10661554
508 Ga0207667_10837012
509 Ga0207712_10264758
510 Ga0207712_10344259
511 Ga0207712_10398262
512 Ga0207668_10450449
513 Ga0207658_10131615
514 Ga0207703_10179408
515 Ga0207703_10219316
516 Ga0207639_10003584
517 Ga0207639_10071960
518 Ga0207639_10096613
519 Ga0207639_10183151
520 Ga0207678_10371696
521 Ga0207641_10055354
522 Ga0207641_10074371
523 Ga0207641_10202605
524 Ga0207641_10302797
525 Ga0207676_10190894
526 Ga0207676_10309455
527 Ga0207676_10367377
528 Ga0207674_10000841
529 Ga0207674_10017846
530 Ga0207675_100030763
531 Ga0207683_10286909
532 Ga0268266_10463335
533 Ga0268264_10314269
534 Ga0307408_100026082
535 Ga0307408_100178009
536 Ga0307408_100247244
537 Ga0307405_10006838
538 Ga0307405_10013125
539 Ga0307405_10013668
540 Ga0307405_10157890
541 Ga0307405_10442106
542 Ga0307405_10575680
543 Ga0307413_10005481
544 Ga0307413_10170851
545 Ga0307410_10000711
546 Ga0307410_10004535
547 Ga0307410_10110200
548 Ga0307410_10272924
549 Ga0307406_10003348
550 Ga0307406_10013272
551 Ga0307406_10184229
552 Ga0307406_10239383
553 Ga0307407_10000438
554 Ga0307407_10011738
555 Ga0307407_10018584
556 Ga0307407_10061008
557 Ga0307407_10284504
558 Ga0307412_10057329
559 Ga0307409_100095974
560 Ga0307409_100105948
561 Ga0307409_100220203
562 Ga0307416_100045266
563 Ga0307416_100050010
564 Ga0307416_100221311
565 Ga0307416_100474559
566 Ga0307416_101080734
567 Ga0307416_101656206
568 Ga0307414_10313510
569 Ga0307411_10001977
570 Ga0307411_10003358
571 Ga0307411_10014173
572 Ga0307415_100049426
573 Ga0307415_100069047
574 Ga0307415_100225817
575 Ga0307415_100556204
576 Ga0373943_0048449
577 Ga0373937_0079096
578 Ga0395905_0006977
579 Ga0395901_0832019
580 Ga0436365_0453322
581 Ga0436365_1885657
582 Ga0436363_0453616
583 Ga0451849_0658708
584 Ga0495664_0274009
585 Ga0495668_0000552
586 Ga0495613_0038043
587 Ga0496104_0158882
588 Ga0496106_0573421
589 Ga0496108_0121038
590 Ga0496108_0256443
591 Ga0496108_0360850
592 Ga0496112_0409153
593 Ga0496114_0184715
594 Ga0496115_0011716
595 Ga0501291_000968
596 Ga0501292_016048
597 Ga0501295_014546
598 Ga0501296_004134
599 Ga0501298_001010
600 Ga0501298_002671
601 Ga0501038_0008160
602 Ga0501039_0594882
603 Ga0501198_041313
604 Ga0501202_013651
605 Ga0501206_010121
606 Ga0501208_004233
607 Ga0501227_020262
608 Ga0501233_055040
609 Ga0501235_009210
610 Ga0501243_005716
611 Ga0501257_031593
612 Ga0501225_0064579
613 Ga0501268_029456
614 Ga0501268_042815
615 Ga0501270_003005
616 Ga0501273_001410
617 Ga0501045_0624718
618 nmdc:mga05p37_292599_c1
619 nmdc:mga0n895_14704_c1
620 nmdc:mga0rr50_73044_c1
621 nmdc:mga08x19_20458_c1
622 nmdc:mga0a205_667182_c1
623 nmdc:mga0a205_67734_c1
624 Ga0501082_0544507

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05173

DapB_C

Dihydrodipicolinate reductase, C-terminus

138

255

0.96

PF01113

DapB_N

Dihydrodipicolinate reductase, N-terminus

30

135

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5us6-assembly2.cif.gz_H structure of dihydrodipicolinate reductase from vibrio vulnificus bound to nadh and 2,6 pyridine dicarboxylic acid with intact polyhistidine tag 0.8931 8 235
5us6-assembly1.cif.gz_D structure of dihydrodipicolinate reductase from vibrio vulnificus bound to nadh and 2,6 pyridine dicarboxylic acid with intact polyhistidine tag 0.889 8 235
1arz-assembly1.cif.gz_C escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate 0.8491 8 235
5ugj-assembly1.cif.gz_A crystal structure of htpa reductase from neisseria meningitidis 0.8374 10 235
5us6-assembly2.cif.gz_H structure of dihydrodipicolinate reductase from vibrio vulnificus bound to nadh and 2,6 pyridine dicarboxylic acid with intact polyhistidine tag 0.8372 8 235
ID Description Score Start End Superfamily
6bdxA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9052 116 204 3.30.360.10
1vm6D02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8868 116 204 3.30.360.10
3ijpB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8813 116 205 3.30.360.10
3qy9A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8738 115 205 3.30.360.10
af_Q57865_2_266_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8734 10 232 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A838U619-F1-model_v4 Dihydrodipicolinate reductase 0.9648 119 239 GO:0005829
GO:0008839
GO:0009089
GO:0019877
AF-A0A833GN97-F1-model_v4 Protochlamydia outer membrane protein domain-containing protein 0.9638 113 211 GO:0008839
GO:0009089
GO:0019877
AF-A0A7V9U3R5-F1-model_v4 Dihydrodipicolinate reductase 0.9626 121 235 GO:0008839
GO:0009089
GO:0019877
AF-A0A2V8M6R3-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8) 0.9588 9 239 GO:0005829
GO:0008839
GO:0009089
GO:0019877
AF-A0A3B8H5K4-F1-model_v4 deleted 0.9574 100 235

Map