F401842

General Info

Members Datasets Scaffolds Average Seq Length
312 243 199 377

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0005218|Ga0495606_0005218_1720_2964
Length 414
Sequence MRRLQSHDFDSRRAVSPHDAPSLDGIRVVGFFVLEQLMNDALKIGILYSTTGPYGSMGRDARDGALFAIEELTATGKRIEPVFIDPHANIPAYLEAAKHMLRNAGCRHIVGTITSAARKEVIPLVEKHDGLLWYMCPYEGFEANENVIYVGGCPNQHLLPLFDHLLPGYGKRPYLVGANYVWGWEMNRLARELITNAGGEVLGERYLPLEETSVERIVADIEQRRPSFILNNLIGPSSYAFLEAIKALGERDQAFSAENCPVVSCDLMECELDDIKAGAATGQLCAASYFDSVDSAENLAFKARVEAQYGPDRRVSSIFASAYTAVKLCAEAILAAGSDEPQAVRRELYASSWPSLFGPLAIDAETNHAALPFHLGRINAENGFDVIASRPALAADPYLTGKRGRTAPKLRVVS

Samples

Sample ID Description Type Environment
1 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
2 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
5 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
8 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
9 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
10 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
11 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
12 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
13 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
14 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
15 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
16 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
17 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
18 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
19 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
20 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
21 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
22 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
23 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
24 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
25 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
26 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
27 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
28 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
29 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
30 2643221557 Ensifer sp. Root558 Isolate Unclassified
31 2643221607 Rhizobium sp. Root73 Isolate Unclassified
32 2643221610 Ensifer sp. Root74 Isolate Unclassified
33 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
34 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
35 2643221668 Ensifer sp. Root423 Isolate Unclassified
36 2643221675 Ensifer sp. Root1298 Isolate Unclassified
37 2643221680 Ensifer sp. Root1312 Isolate Unclassified
38 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
39 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
40 2643221726 Ensifer sp. Root954 Isolate Unclassified
41 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
42 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
43 2738541293 Rhizobium sp. GV031 Isolate Unclassified
44 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
45 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
46 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
47 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
48 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
49 2802429633 Rhizobium anhuiense J3 Isolate Nodule
50 2802429634 Rhizobium anhuiense S10 Isolate Nodule
51 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
52 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
53 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
54 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
55 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
56 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
57 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
58 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
59 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
60 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
61 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
62 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
63 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
64 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
65 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
66 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
67 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
68 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
69 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
70 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
71 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
72 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
73 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
74 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
75 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
76 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
77 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
78 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
79 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
80 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
81 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
82 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
83 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
84 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
85 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
86 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
87 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
88 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
89 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
90 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
91 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
92 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
93 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
94 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
95 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
96 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
97 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
98 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
99 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
100 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
101 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
102 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
103 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
104 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
105 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
106 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
107 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
108 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
109 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
110 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
111 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
112 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
113 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
114 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
115 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
116 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
117 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
118 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
119 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
120 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
121 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
126 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
211 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
214 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
215 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
216 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
217 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
218 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
219 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
220 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
221 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
222 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
223 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
226 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
229 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
230 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
231 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
232 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
233 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
234 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
235 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
236 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
237 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
238 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
239 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
240 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
241 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
242 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
243 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.78
Metatranscriptomes 0
Isolates 36.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.36
Nodule 21.15
Rhizoplane 2.88
Rhizosphere 26.6
Stem 0
Stem Tuber 0
Unclassified 25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1006481 3300002705 Bacteria 3190
2 JGI25158J39367_1000099 3300002739 Bacteria 20210
3 JGI25157J39369_1000893 3300002741 Bacteria 14361
4 JGI25152J39213_1000001 3300002773 Bacteria 224104
5 JGI25152J39213_1000015 3300002773 Bacteria 120605
6 JGI25152J39213_1007291 3300002773 Bacteria 2883
7 JGI25150J39212_1000007 3300002774 Bacteria 253635
8 JGI25159J45721_1003977 3300002987 Bacteria 5035
9 JGI25151J46595_10000013 3300003187 Bacteria 253635
10 JGI25165J46597_1000263 3300003214 Bacteria 68906
11 JGI25153J46596_10004089 3300003215 Bacteria 7934
12 JGI25153J46596_10026433 3300003215 Bacteria 2053
13 rootH1_10131954 3300003323 Bacteria 2543
14 JGI25160J50197_1000022 3300003354 Bacteria 201071
15 JGI25160J50197_1012864 3300003354 Bacteria 2881
16 JGI25161J50226_1000024 3300003374 Bacteria 152176
17 JGI25161J50226_1000050 3300003374 Bacteria 110628
18 Ga0055526_1002823 3300003771 Bacteria 11492
19 Ga0055524_1000939 3300003775 Bacteria 18642
20 Ga0055524_1010795 3300003775 Bacteria 3613
21 Ga0055528_1000109 3300003790 Bacteria 66661
22 Ga0055528_1011137 3300003790 Bacteria 3598
23 Ga0055528_1023997 3300003790 Bacteria 1842
24 Ga0055540_1011184 3300003792 Bacteria 2916
25 Ga0055543_1000025 3300004625 Bacteria 137886
26 Ga0055543_1000977 3300004625 Bacteria 12940
27 Ga0065165_1000439 3300005262 Bacteria 65347
28 Ga0065165_1004707 3300005262 Bacteria 8203
29 Ga0070670_100002591 3300005331 Bacteria 14942
30 Ga0068853_100106564 3300005539 Bacteria 2484
31 Ga0068852_100319310 3300005616 Bacteria 1508
32 Ga0068851_10071004 3300005834 Bacteria 1801
33 Ga0075365_10002739 3300006038 Bacteria 8787
34 Ga0075369_10003728 3300006186 Bacteria 5575
35 Ga0105240_10080397 3300009093 Bacteria 4009
36 Ga0105237_10018706 3300009545 Bacteria 7163
37 Ga0105238_10006813 3300009551 Bacteria 11410
38 Ga0123340_1006119 3300009763 Bacteria 11483
39 Ga0123341_1005301 3300009765 Bacteria 11483
40 Ga0105239_10104823 3300010375 Bacteria 3131
41 Ga0105239_10143243 3300010375 Bacteria 2664
42 Ga0157369_10095461 3300013105 Bacteria 3173
43 Ga0209436_100031 3300025208 Bacteria 82827
44 Ga0209437_100104 3300025233 Bacteria 220736
45 Ga0207425_1000032 3300025245 Bacteria 253689
46 Ga0207425_1006033 3300025245 Bacteria 3368
47 Ga0209026_1000083 3300025250 Bacteria 190199
48 Ga0209759_1000245 3300025256 Bacteria 80951
49 Ga0209129_1000016 3300025258 Bacteria 485491
50 Ga0209129_1000056 3300025258 Bacteria 253689
51 Ga0209129_1013065 3300025258 Bacteria 1853
52 Ga0209233_1000054 3300025261 Bacteria 439669
53 Ga0209673_1000005 3300025273 Bacteria 692788
54 Ga0209673_1010266 3300025273 Bacteria 3961
55 Ga0209673_1015294 3300025273 Bacteria 2923
56 Ga0209673_1026275 3300025273 Bacteria 1915
57 Ga0209130_1000031 3300025284 Bacteria 322932
58 Ga0209130_1000251 3300025284 Bacteria 67741
59 Ga0209025_1000090 3300025294 Bacteria 253689
60 Ga0209025_1001269 3300025294 Bacteria 34765
61 Ga0209025_1010720 3300025294 Bacteria 6164
62 Ga0209564_1000586 3300025295 Bacteria 57490
63 Ga0209564_1022013 3300025295 Bacteria 2267
64 Ga0209758_1000084 3300025297 Bacteria 256346
65 Ga0209758_1004426 3300025297 Bacteria 11703
66 Ga0209758_1008658 3300025297 Bacteria 6529
67 Ga0209758_1008943 3300025297 Bacteria 6346
68 Ga0209758_1013033 3300025297 Bacteria 4579
69 Ga0209256_1000209 3300025299 Bacteria 110253
70 Ga0209256_1006307 3300025299 Bacteria 6348
71 Ga0207426_1000042 3300025302 Bacteria 433289
72 Ga0207426_1000082 3300025302 Bacteria 298939
73 Ga0209051_1020197 3300025303 Bacteria 2878
74 Ga0209051_1023701 3300025303 Bacteria 2545
75 Ga0207647_10003498 3300025904 Bacteria 11777
76 Ga0207695_10284990 3300025913 Bacteria 1545
77 Ga0207671_10031734 3300025914 Bacteria 3935
78 Ga0207694_10032679 3300025924 Bacteria 3984
79 Ga0207650_10003085 3300025925 Bacteria 11473
80 Ga0207639_10007956 3300026041 Bacteria 7241
81 Ga0207674_10142589 3300026116 Bacteria 2355
82 Ga0207698_10156463 3300026142 Bacteria 1987
83 Ga0268266_10119570 3300028379 Bacteria 2343
84 Ga0307515_10000112 3300028794 Bacteria 195015
85 Ga0307515_10004268 3300028794 Bacteria 29669
86 Ga0307515_10039751 3300028794 Bacteria 7466
87 Ga0307513_10000463 3300031456 Bacteria 58389
88 Ga0307513_10185194 3300031456 Bacteria 1940
89 Ga0307516_10167715 3300031730 Bacteria 1939
90 Ga0307412_10003936 3300031911 Bacteria 8276
91 Ga0395900_0118024 3300037418 Bacteria 2723
92 Ga0395905_0001088 3300037471 Bacteria 34174
93 Ga0395905_0018868 3300037471 Bacteria 6542
94 Ga0395905_0128214 3300037471 Bacteria 2386
95 Ga0395905_0191867 3300037471 Bacteria 1916
96 Ga0451845_0178623 3300041501 Bacteria 3896
97 Ga0451853_0363902 3300041512 Bacteria 4532
98 Ga0466972_0036194 3300044658 Bacteria 2416
99 Ga0495629_0026077 3300046459 Bacteria 4154
100 Ga0495638_0000169 3300046460 Bacteria 101640
101 Ga0495638_0092738 3300046460 Bacteria 1817
102 Ga0495605_0001734 3300046474 Bacteria 13979
103 Ga0495585_0023275 3300046492 Bacteria 3555
104 Ga0495607_0049286 3300046501 Bacteria 2457
105 Ga0495607_0066594 3300046501 Bacteria 2026
106 Ga0495583_0001097 3300046506 Bacteria 29963
107 Ga0495606_0005218 3300046507 Bacteria 12536
108 Ga0495606_0114589 3300046507 Bacteria 1621
109 Ga0495610_0010775 3300046512 Bacteria 5651
110 Ga0495610_0014841 3300046512 Bacteria 4556
111 Ga0495610_0032361 3300046512 Bacteria 2717
112 Ga0495610_0052430 3300046512 Bacteria 1980
113 Ga0495616_0075126 3300046513 Bacteria 1627
114 Ga0495631_0044719 3300046518 Bacteria 1950
115 Ga0495632_0011772 3300046519 Bacteria 5090
116 Ga0495643_0002913 3300046522 Bacteria 12977
117 Ga0495643_0045556 3300046522 Bacteria 2381
118 Ga0495609_0070187 3300046538 Bacteria 1540
119 Ga0495622_0018616 3300046557 Bacteria 3236
120 Ga0495656_0007231 3300046615 Bacteria 3920
121 Ga0495668_0005707 3300046616 Bacteria 8331
122 Ga0495611_0058856 3300046648 Bacteria 1743
123 Ga0495625_0007260 3300046660 Bacteria 9692
124 Ga0495625_0050359 3300046660 Bacteria 2989
125 Ga0495625_0161327 3300046660 Bacteria 1502
126 Ga0495657_0045767 3300046675 Bacteria 2967
127 Ga0495671_0122011 3300046692 Bacteria 1271
128 Ga0495649_0032062 3300046694 Bacteria 2897
129 Ga0495660_0035034 3300046810 Bacteria 2806
130 Ga0495672_0013476 3300047320 Bacteria 5640
131 Ga0495683_0082203 3300047323 Bacteria 1570
132 Ga0495687_005219 3300047443 Bacteria 8380
133 Ga0495686_0000574 3300047472 Bacteria 52228
134 Ga0495686_0007540 3300047472 Bacteria 8143
135 Ga0496102_0068344 3300048905 Bacteria 3260
136 Ga0496103_0143003 3300048906 Bacteria 1531
137 Ga0496106_0000288 3300048909 Bacteria 35636
138 Ga0496110_0289106 3300048913 Bacteria 1493
139 Ga0496111_0004346 3300048914 Bacteria 8944
140 Ga0496116_0001654 3300048919 Bacteria 24516
141 Ga0496116_0039032 3300048919 Bacteria 3288
142 Ga0496116_0066483 3300048919 Bacteria 2306
143 Ga0496117_0010564 3300048920 Bacteria 8392
144 Ga0496118_0008221 3300048921 Bacteria 10828
145 Ga0496118_0035371 3300048921 Bacteria 4057
146 Ga0496118_0063185 3300048921 Bacteria 2725
147 Ga0496118_0099761 3300048921 Bacteria 1967
148 Ga0496119_0023155 3300048922 Bacteria 4419
149 Ga0496119_0041520 3300048922 Bacteria 2928
150 Ga0496120_0003106 3300048923 Bacteria 15606
151 Ga0496121_0004293 3300048924 Bacteria 19319
152 Ga0496121_0017850 3300048924 Bacteria 7204
153 Ga0496121_0035687 3300048924 Bacteria 4448
154 Ga0496121_0139931 3300048924 Bacteria 1797
155 Ga0496122_0000172 3300048925 Bacteria 153862
156 Ga0496122_0003433 3300048925 Bacteria 20846
157 Ga0496122_0010880 3300048925 Bacteria 9311
158 Ga0496122_0015992 3300048925 Bacteria 7135
159 Ga0496122_0026961 3300048925 Bacteria 4931
160 Ga0496122_0050045 3300048925 Bacteria 3190
161 Ga0496123_0000132 3300048926 Bacteria 153568
162 Ga0496123_0008874 3300048926 Bacteria 9154
163 Ga0496123_0024946 3300048926 Bacteria 4524
164 Ga0496123_0026580 3300048926 Bacteria 4331
165 Ga0496124_0000200 3300048927 Bacteria 117910
166 Ga0496124_0003345 3300048927 Bacteria 19735
167 Ga0496124_0018816 3300048927 Bacteria 6452
168 Ga0496124_0029772 3300048927 Bacteria 4857
169 Ga0496124_0115284 3300048927 Bacteria 2156
170 Ga0496125_0009987 3300048928 Bacteria 9647
171 Ga0496125_0139313 3300048928 Bacteria 1690
172 Ga0496126_0060116 3300048929 Bacteria 3419
173 Ga0501032_0135381 3300049569 Bacteria 1624
174 Ga0501033_0217532 3300049570 Bacteria 1361
175 Ga0501067_0024261 3300049583 Bacteria 3364
176 Ga0501068_0201280 3300049584 Bacteria 1263
177 Ga0501083_0028341 3300049744 Bacteria 3859
178 Ga0501083_0231970 3300049744 Bacteria 1202
179 nmdc:mga0yw44_21969_c1 3300050492 Bacteria 3569
180 nmdc:mga0sz30_39783_c1 3300050516 Bacteria 1974
181 Ga0500610_0001314 3300053079 Bacteria 8358
182 Ga0495619_0240293 3300053085 Bacteria 1255
183 Ga0500578_0034389 3300053086 Bacteria 3256
184 Ga0500644_0007768 3300053088 Bacteria 2805
185 Ga0500557_000277 3300053105 Bacteria 6975
186 Ga0500569_009830 3300053109 Bacteria 2233
187 Ga0500608_069770 3300053122 Bacteria 1671
188 Ga0500618_004032 3300053125 Bacteria 4829
189 Ga0500658_0001111 3300053134 Bacteria 11004
190 Ga0500658_0006130 3300053134 Bacteria 4475
191 Ga0500568_0000825 3300053139 Bacteria 21796
192 Ga0500568_0001804 3300053139 Bacteria 13190
193 Ga0500573_0001805 3300053140 Bacteria 10400
194 Ga0500590_000086 3300053148 Bacteria 24076
195 Ga0500604_0013401 3300053151 Bacteria 2222
196 Ga0500616_0005936 3300053153 Bacteria 8153
197 Ga0500622_0000476 3300053156 Bacteria 37766
198 Ga0500636_0057814 3300053177 Bacteria 2269
199 Ga0501082_0033640 3300060353 Bacteria 4422

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221643 2644241092 340
2 3300046513 Ga0495616_0075126 Ga0495616_0075126_517_1593 344
3 3300046692 Ga0495671_0122011 Ga0495671_0122011_177_1253 344
4 3300049584 Ga0501068_0201280 Ga0501068_0201280_156_1232 344
5 3300053085 Ga0495619_0240293 Ga0495619_0240293_28_1107 345
6 3300028794 Ga0307515_10004268 Ga0307515_1000426824 354
7 3300053140 Ga0500573_0001805 Ga0500573_0001805_619_1794 354
8 iso_pu_bacteria 2582581294 2585200904 355
9 iso_pu_bacteria 2600254933 2600375902 357
10 iso_pu_bacteria 2510065019 2510136587 359
11 iso_pu_bacteria 2510461076 2510900149 359
12 iso_pu_bacteria 2510917030 2511195659 359
13 iso_pu_bacteria 2513237084 2513569551 359
14 iso_pu_bacteria 2513237085 2513576385 359
15 iso_pu_bacteria 2513237093 2513635227 359
16 iso_pu_bacteria 2513237103 2513709873 359
17 iso_pu_bacteria 2513237144 2513912208 359
18 iso_pu_bacteria 2513237162 2514018859 359
19 iso_pu_bacteria 2515075009 2515115171 359
20 iso_pu_bacteria 2515154113 2515633346 359
21 iso_pu_bacteria 2515154114 2515645473 359
22 iso_pu_bacteria 2515154116 2515658539 359
23 iso_pu_bacteria 2515154134 2515742013 359
24 iso_pu_bacteria 2516653077 2517041835 359
25 iso_pu_bacteria 2516653085 2517081139 359
26 iso_pu_bacteria 2517093000 2517098534 359
27 iso_pu_bacteria 2582581298 2585222406 359
28 iso_pu_bacteria 2582581299 2585228242 359
29 iso_pu_bacteria 2585427526 2585524253 359
30 iso_pu_bacteria 2585427529 2585544642 359
31 iso_pu_bacteria 2599185236 2599719696 359
32 iso_pu_bacteria 2724679232 2725946238 359
33 iso_pu_bacteria 2738541293 2738803416 359
34 iso_pu_bacteria 2765235802 2765466850 359
35 iso_pu_bacteria 2765235942 2766068465 359
36 iso_pu_bacteria 2802429633 2806045943 359
37 iso_pu_bacteria 2802429634 2806053516 359
38 iso_pu_bacteria 2802429635 2806061231 359
39 iso_pu_bacteria 2818991461 2819683283 359
40 iso_pu_bacteria 2838686498 2838692901 359
41 iso_pu_bacteria 2838729681 2838736703 359
42 iso_pu_bacteria 2838742623 2838749664 359
43 iso_pu_bacteria 2839993093 2839997774 359
44 iso_pu_bacteria 2841851746 2841853269 359
45 iso_pu_bacteria 2842110456 2842115716 359
46 iso_pu_bacteria 2842156927 2842161646 359
47 iso_pu_bacteria 2842163707 2842167132 359
48 iso_pu_bacteria 2842180545 2842185553 359
49 iso_pu_bacteria 2842217011 2842222170 359
50 iso_pu_bacteria 2842229732 2842234276 359
51 iso_pu_bacteria 2842243621 2842250642 359
52 iso_pu_bacteria 2842257432 2842264509 359
53 iso_pu_bacteria 2842271015 2842277370 359
54 iso_pu_bacteria 2842304105 2842310843 359
55 iso_pu_bacteria 2844454524 2844461009 359
56 iso_pu_bacteria 2857516855 2857519268 359
57 iso_pu_bacteria 2904578770 2904583914 359
58 iso_pu_bacteria 2919100787 2919102979 359
59 iso_pu_bacteria 2919119836 2919123288 359
60 iso_pu_bacteria 2933570622 2933577337 359
61 iso_pu_bacteria 2933586486 2933591683 359
62 iso_pu_bacteria 2935901341 2935905842 359
63 iso_pu_bacteria 2936367885 2936370275 359
64 iso_pu_bacteria 2936375103 2936377945 359
65 iso_pu_bacteria 3005409236 3005413592 359
66 iso_pu_bacteria 3005445848 3005450897 359
67 iso_pu_bacteria 639633055 639651801 359
68 iso_pu_bacteria 8005307578 8005313029 359
69 iso_pu_bacteria 8005376324 8005381955 359
70 iso_pu_bacteria 8005460587 8005466898 359
71 iso_pu_bacteria 8005556819 8005562192 359
72 iso_pu_bacteria 8005563573 8005567048 359
73 iso_pu_bacteria 8005570704 8005576384 359
74 iso_pu_bacteria 8018163183 8018165987 359
75 iso_pu_bacteria 8023680758 8023688133 359
76 iso_pu_bacteria 8024479707 8024483778 359
77 iso_pu_bacteria 8057874678 8057878601 359
78 iso_pu_bacteria 2510461069 2510842195 360
79 iso_pu_bacteria 2510917028 2511186775 360
80 iso_pu_bacteria 2643221557 2643809263 360
81 iso_pu_bacteria 2643221607 2644051668 360
82 iso_pu_bacteria 2643221610 2644069251 360
83 iso_pu_bacteria 2643221636 2644200152 360
84 iso_pu_bacteria 2643221668 2644379826 360
85 iso_pu_bacteria 2643221675 2644420404 360
86 iso_pu_bacteria 2643221680 2644453930 360
87 iso_pu_bacteria 2643221686 2644480537 360
88 iso_pu_bacteria 2643221689 2644498755 360
89 iso_pu_bacteria 2643221726 2644686297 360
90 iso_pu_bacteria 2775507266 2778174509 360
91 iso_pu_bacteria 2818991272 2819244912 360
92 iso_pu_bacteria 2842482326 2842485426 360
93 iso_pu_bacteria 2852387548 2852391843 360
94 iso_pu_bacteria 2989776772 2989780811 360
95 iso_pu_bacteria 3002141150 3002146127 360
96 iso_pu_bacteria 8005246636 8005250586 360
97 iso_pu_bacteria 8024486573 8024489242 360
98 iso_pu_bacteria 8046767195 8046767352 360
99 3300046519 Ga0495632_0011772 Ga0495632_0011772_3209_4339 361
100 iso_pu_bacteria 2671180139 2671695262 361
101 iso_pu_bacteria 2738543031 2739351748 361
102 iso_pu_bacteria 2888350351 2888354256 361
103 iso_pu_bacteria 2889010040 2889015968 361
104 iso_pu_bacteria 2889016732 2889018980 361
105 iso_pu_bacteria 2906354277 2906355378 361
106 iso_pu_bacteria 2922185730 2922190986 361
107 iso_pu_bacteria 2958100919 2958106528 361
108 iso_pu_bacteria 2958172287 2958172932 361
109 iso_pu_bacteria 2965119406 2965121076 361
110 iso_pu_bacteria 2968117919 2968123418 361
111 iso_pu_bacteria 2977971508 2977974020 361
112 iso_pu_bacteria 2979710463 2979713407 361
113 iso_pu_bacteria 2987652177 2987657574 361
114 iso_pu_bacteria 8004640170 8004641772 361
115 3300046512 Ga0495610_0014841 Ga0495610_0014841_884_2017 362
116 3300048925 Ga0496122_0000172 Ga0496122_0000172_107967_109127 362
117 3300048926 Ga0496123_0000132 Ga0496123_0000132_108015_109175 362
118 3300002739 JGI25158J39367_1000099 JGI25158J39367_10000996 363
119 3300002773 JGI25152J39213_1007291 JGI25152J39213_10072912 363
120 3300002987 JGI25159J45721_1003977 JGI25159J45721_10039772 363
121 3300003215 JGI25153J46596_10004089 JGI25153J46596_100040897 363
122 3300003215 JGI25153J46596_10026433 JGI25153J46596_100264332 363
123 3300003354 JGI25160J50197_1012864 JGI25160J50197_10128641 363
124 3300003374 JGI25161J50226_1000050 JGI25161J50226_100005075 363
125 3300003771 Ga0055526_1002823 Ga0055526_10028232 363
126 3300003775 Ga0055524_1010795 Ga0055524_10107952 363
127 3300003790 Ga0055528_1000109 Ga0055528_100010918 363
128 3300003790 Ga0055528_1011137 Ga0055528_10111372 363
129 3300003790 Ga0055528_1023997 Ga0055528_10239971 363
130 3300003792 Ga0055540_1011184 Ga0055540_10111842 363
131 3300004625 Ga0055543_1000977 Ga0055543_10009776 363
132 3300005262 Ga0065165_1004707 Ga0065165_10047072 363
133 3300005331 Ga0070670_100002591 Ga0070670_10000259110 363
134 3300025208 Ga0209436_100031 Ga0209436_10003147 363
135 3300025245 Ga0207425_1006033 Ga0207425_10060332 363
136 3300025258 Ga0209129_1000016 Ga0209129_100001651 363
137 3300025258 Ga0209129_1013065 Ga0209129_10130652 363
138 3300025273 Ga0209673_1000005 Ga0209673_1000005515 363
139 3300025273 Ga0209673_1010266 Ga0209673_10102664 363
140 3300025273 Ga0209673_1015294 Ga0209673_10152942 363
141 3300025284 Ga0209130_1000031 Ga0209130_100003126 363
142 3300025294 Ga0209025_1001269 Ga0209025_10012699 363
143 3300025294 Ga0209025_1010720 Ga0209025_10107203 363
144 3300025295 Ga0209564_1000586 Ga0209564_100058626 363
145 3300025295 Ga0209564_1022013 Ga0209564_10220132 363
146 3300025297 Ga0209758_1004426 Ga0209758_100442610 363
147 3300025297 Ga0209758_1008658 Ga0209758_10086586 363
148 3300025297 Ga0209758_1008943 Ga0209758_10089436 363
149 3300025297 Ga0209758_1013033 Ga0209758_10130334 363
150 3300025299 Ga0209256_1006307 Ga0209256_10063073 363
151 3300025302 Ga0207426_1000042 Ga0207426_1000042384 363
152 3300025303 Ga0209051_1020197 Ga0209051_10201973 363
153 3300025303 Ga0209051_1023701 Ga0209051_10237013 363
154 3300025925 Ga0207650_10003085 Ga0207650_1000308510 363
155 3300028379 Ga0268266_10119570 Ga0268266_101195702 363
156 3300037471 Ga0395905_0191867 Ga0395905_0191867_686_1819 363
157 3300041501 Ga0451845_0178623 Ga0451845_0178623_543_1676 363
158 3300041512 Ga0451853_0363902 Ga0451853_0363902_2961_4094 363
159 3300046460 Ga0495638_0092738 Ga0495638_0092738_150_1283 363
160 3300046492 Ga0495585_0023275 Ga0495585_0023275_2327_3460 363
161 3300046501 Ga0495607_0066594 Ga0495607_0066594_800_1933 363
162 3300046506 Ga0495583_0001097 Ga0495583_0001097_26930_28063 363
163 3300046507 Ga0495606_0114589 Ga0495606_0114589_74_1207 363
164 3300046512 Ga0495610_0010775 Ga0495610_0010775_1150_2283 363
165 3300046512 Ga0495610_0032361 Ga0495610_0032361_515_1648 363
166 3300046522 Ga0495643_0002913 Ga0495643_0002913_8800_9933 363
167 3300046522 Ga0495643_0045556 Ga0495643_0045556_922_2055 363
168 3300046615 Ga0495656_0007231 Ga0495656_0007231_2383_3516 363
169 3300046660 Ga0495625_0007260 Ga0495625_0007260_7301_8434 363
170 3300046660 Ga0495625_0161327 Ga0495625_0161327_245_1381 363
171 3300046694 Ga0495649_0032062 Ga0495649_0032062_1129_2262 363
172 3300047323 Ga0495683_0082203 Ga0495683_0082203_45_1178 363
173 3300047472 Ga0495686_0000574 Ga0495686_0000574_39139_40272 363
174 3300047472 Ga0495686_0007540 Ga0495686_0007540_4279_5412 363
175 3300048909 Ga0496106_0000288 Ga0496106_0000288_691_1824 363
176 3300048913 Ga0496110_0289106 Ga0496110_0289106_71_1204 363
177 3300048914 Ga0496111_0004346 Ga0496111_0004346_358_1491 363
178 3300048921 Ga0496118_0099761 Ga0496118_0099761_209_1342 363
179 3300048924 Ga0496121_0139931 Ga0496121_0139931_577_1710 363
180 3300048925 Ga0496122_0003433 Ga0496122_0003433_19361_20494 363
181 3300048925 Ga0496122_0026961 Ga0496122_0026961_167_1300 363
182 3300048925 Ga0496122_0050045 Ga0496122_0050045_519_1652 363
183 3300048926 Ga0496123_0008874 Ga0496123_0008874_1274_2407 363
184 3300048926 Ga0496123_0024946 Ga0496123_0024946_1646_2779 363
185 3300048926 Ga0496123_0026580 Ga0496123_0026580_864_1997 363
186 3300048927 Ga0496124_0018816 Ga0496124_0018816_3695_4828 363
187 3300048927 Ga0496124_0029772 Ga0496124_0029772_351_1484 363
188 3300048928 Ga0496125_0009987 Ga0496125_0009987_5056_6189 363
189 3300048929 Ga0496126_0060116 Ga0496126_0060116_959_2092 363
190 3300049744 Ga0501083_0231970 Ga0501083_0231970_50_1183 363
191 3300050492 nmdc:mga0yw44_21969_c1 nmdc:mga0yw44_21969_c1_387_1520 363
192 3300053086 Ga0500578_0034389 Ga0500578_0034389_2082_3215 363
193 3300053134 Ga0500658_0001111 Ga0500658_0001111_5933_7066 363
194 3300053134 Ga0500658_0006130 Ga0500658_0006130_1219_2352 363
195 3300053153 Ga0500616_0005936 Ga0500616_0005936_3459_4592 363
196 3300053156 Ga0500622_0000476 Ga0500622_0000476_36327_37460 363
197 3300003214 JGI25165J46597_1000263 JGI25165J46597_100026337 364
198 3300003354 JGI25160J50197_1000022 JGI25160J50197_1000022111 364
199 3300003374 JGI25161J50226_1000024 JGI25161J50226_100002421 364
200 3300003775 Ga0055524_1000939 Ga0055524_100093913 364
201 3300004625 Ga0055543_1000025 Ga0055543_1000025111 364
202 3300005262 Ga0065165_1000439 Ga0065165_100043936 364
203 3300006038 Ga0075365_10002739 Ga0075365_100027396 364
204 3300006186 Ga0075369_10003728 Ga0075369_100037285 364
205 3300009763 Ga0123340_1006119 Ga0123340_100611911 364
206 3300009765 Ga0123341_1005301 Ga0123341_100530111 364
207 3300025233 Ga0209437_100104 Ga0209437_10010450 364
208 3300025261 Ga0209233_1000054 Ga0209233_100005486 364
209 3300025284 Ga0209130_1000251 Ga0209130_100025121 364
210 3300025299 Ga0209256_1000209 Ga0209256_100020969 364
211 3300025302 Ga0207426_1000082 Ga0207426_1000082124 364
212 3300028794 Ga0307515_10039751 Ga0307515_100397515 364
213 3300031456 Ga0307513_10000463 Ga0307513_1000046345 364
214 3300037471 Ga0395905_0018868 Ga0395905_0018868_3456_4592 364
215 3300046459 Ga0495629_0026077 Ga0495629_0026077_277_1413 364
216 3300046512 Ga0495610_0052430 Ga0495610_0052430_765_1901 364
217 3300046557 Ga0495622_0018616 Ga0495622_0018616_1002_2138 364
218 3300046675 Ga0495657_0045767 Ga0495657_0045767_99_1235 364
219 3300047443 Ga0495687_005219 Ga0495687_005219_366_1502 364
220 3300049570 Ga0501033_0217532 Ga0501033_0217532_124_1260 364
221 3300050516 nmdc:mga0sz30_39783_c1 nmdc:mga0sz30_39783_c1_357_1493 364
222 3300053088 Ga0500644_0007768 Ga0500644_0007768_1517_2653 364
223 3300053122 Ga0500608_069770 Ga0500608_069770_339_1475 364
224 3300053125 Ga0500618_004032 Ga0500618_004032_3549_4685 364
225 3300053148 Ga0500590_000086 Ga0500590_000086_8298_9434 364
226 3300053177 Ga0500636_0057814 Ga0500636_0057814_218_1354 364
227 3300005834 Ga0068851_10071004 Ga0068851_100710042 365
228 3300025904 Ga0207647_10003498 Ga0207647_100034982 365
229 3300026116 Ga0207674_10142589 Ga0207674_101425893 365
230 3300048924 Ga0496121_0017850 Ga0496121_0017850_527_1678 365
231 3300031456 Ga0307513_10185194 Ga0307513_101851942 366
232 3300031730 Ga0307516_10167715 Ga0307516_101677152 366
233 iso_pu_bacteria 2599185156 2599334555 368
234 iso_pu_bacteria 2842922631 2842925329 368
235 iso_pu_bacteria 8057575449 8057578525 368
236 3300002773 JGI25152J39213_1000001 JGI25152J39213_100000165 371
237 3300002773 JGI25152J39213_1000015 JGI25152J39213_100001543 371
238 3300002774 JGI25150J39212_1000007 JGI25150J39212_1000007167 371
239 3300003187 JGI25151J46595_10000013 JGI25151J46595_10000013168 371
240 3300025245 Ga0207425_1000032 Ga0207425_1000032164 371
241 3300025258 Ga0209129_1000056 Ga0209129_1000056164 371
242 3300025273 Ga0209673_1026275 Ga0209673_10262752 371
243 3300025294 Ga0209025_1000090 Ga0209025_1000090164 371
244 3300025297 Ga0209758_1000084 Ga0209758_1000084164 371
245 3300028794 Ga0307515_10000112 Ga0307515_100001125 371
246 3300031911 Ga0307412_10003936 Ga0307412_100039363 371
247 3300037471 Ga0395905_0001088 Ga0395905_0001088_24089_25252 371
248 3300046460 Ga0495638_0000169 Ga0495638_0000169_36207_37379 371
249 3300046474 Ga0495605_0001734 Ga0495605_0001734_12755_13915 371
250 3300046518 Ga0495631_0044719 Ga0495631_0044719_157_1317 371
251 3300046538 Ga0495609_0070187 Ga0495609_0070187_196_1356 371
252 3300046616 Ga0495668_0005707 Ga0495668_0005707_603_1763 371
253 3300046648 Ga0495611_0058856 Ga0495611_0058856_393_1553 371
254 3300046660 Ga0495625_0050359 Ga0495625_0050359_755_1915 371
255 3300046810 Ga0495660_0035034 Ga0495660_0035034_83_1243 371
256 3300047320 Ga0495672_0013476 Ga0495672_0013476_3793_4965 371
257 3300048906 Ga0496103_0143003 Ga0496103_0143003_210_1367 371
258 3300048919 Ga0496116_0001654 Ga0496116_0001654_12802_13959 371
259 3300048919 Ga0496116_0039032 Ga0496116_0039032_1906_3066 371
260 3300048919 Ga0496116_0066483 Ga0496116_0066483_454_1611 371
261 3300048920 Ga0496117_0010564 Ga0496117_0010564_2752_3909 371
262 3300048921 Ga0496118_0008221 Ga0496118_0008221_9223_10380 371
263 3300048921 Ga0496118_0035371 Ga0496118_0035371_80_1255 371
264 3300048921 Ga0496118_0063185 Ga0496118_0063185_851_2026 371
265 3300048922 Ga0496119_0041520 Ga0496119_0041520_1528_2685 371
266 3300048924 Ga0496121_0035687 Ga0496121_0035687_298_1455 371
267 3300048925 Ga0496122_0010880 Ga0496122_0010880_696_1853 371
268 3300048925 Ga0496122_0015992 Ga0496122_0015992_5503_6678 371
269 3300048927 Ga0496124_0000200 Ga0496124_0000200_95935_97110 371
270 3300048927 Ga0496124_0003345 Ga0496124_0003345_801_1958 371
271 3300048928 Ga0496125_0139313 Ga0496125_0139313_76_1233 371
272 3300049569 Ga0501032_0135381 Ga0501032_0135381_400_1560 371
273 3300049583 Ga0501067_0024261 Ga0501067_0024261_553_1704 371
274 3300049744 Ga0501083_0028341 Ga0501083_0028341_809_1969 371
275 3300053079 Ga0500610_0001314 Ga0500610_0001314_3778_4938 371
276 3300053105 Ga0500557_000277 Ga0500557_000277_2579_3739 371
277 3300053109 Ga0500569_009830 Ga0500569_009830_389_1549 371
278 3300053139 Ga0500568_0000825 Ga0500568_0000825_8562_9734 371
279 3300060353 Ga0501082_0033640 Ga0501082_0033640_2626_3786 371
280 iso_pu_bacteria 2523231067 2523466644 371
281 3300003323 rootH1_10131954 rootH1_101319542 372
282 3300046501 Ga0495607_0049286 Ga0495607_0049286_1046_2209 372
283 3300053151 Ga0500604_0013401 Ga0500604_0013401_974_2137 372
284 3300010375 Ga0105239_10104823 Ga0105239_101048232 374
285 3300048923 Ga0496120_0003106 Ga0496120_0003106_4066_5244 374
286 3300048927 Ga0496124_0115284 Ga0496124_0115284_497_1669 374
287 3300053139 Ga0500568_0001804 Ga0500568_0001804_7563_8735 374
288 3300046507 Ga0495606_0005218 Ga0495606_0005218_1720_2964 381
289 3300048924 Ga0496121_0004293 Ga0496121_0004293_13594_14838 381
290 iso_pu_bacteria 2582581283 2585164396 381
291 iso_pu_bacteria 2791355123 2792749980 382
292 3300048922 Ga0496119_0023155 Ga0496119_0023155_457_1680 384
293 3300002705 JGI25156J39149_1006481 JGI25156J39149_10064813 386
294 3300002741 JGI25157J39369_1000893 JGI25157J39369_100089312 386
295 3300005539 Ga0068853_100106564 Ga0068853_1001065644 386
296 3300005616 Ga0068852_100319310 Ga0068852_1003193102 386
297 3300009093 Ga0105240_10080397 Ga0105240_100803975 386
298 3300009545 Ga0105237_10018706 Ga0105237_100187064 386
299 3300009551 Ga0105238_10006813 Ga0105238_100068138 386
300 3300010375 Ga0105239_10143243 Ga0105239_101432433 386
301 3300013105 Ga0157369_10095461 Ga0157369_100954613 386
302 3300025250 Ga0209026_1000083 Ga0209026_100008344 386
303 3300025256 Ga0209759_1000245 Ga0209759_100024527 386
304 3300025913 Ga0207695_10284990 Ga0207695_102849902 386
305 3300025914 Ga0207671_10031734 Ga0207671_100317344 386
306 3300025924 Ga0207694_10032679 Ga0207694_100326793 386
307 3300026041 Ga0207639_10007956 Ga0207639_100079565 386
308 3300026142 Ga0207698_10156463 Ga0207698_101564632 386
309 3300037418 Ga0395900_0118024 Ga0395900_0118024_849_2051 386
310 3300037471 Ga0395905_0128214 Ga0395905_0128214_986_2188 386
311 3300044658 Ga0466972_0036194 Ga0466972_0036194_752_1954 386
312 3300048905 Ga0496102_0068344 Ga0496102_0068344_1272_2474 386

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13433

Peripla_BP_5

Periplasmic binding protein domain

42

403

0.98

PF13458

Peripla_BP_6

Periplasmic binding protein

41

383

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qo0-assembly1.cif.gz_B amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the negative regulator amir. 0.8853 26 371
4rp8-assembly1.cif.gz_C bacterial vitamin c transporter ulaa/sgat in p21 form 0.8841 36 66
1qnl-assembly1.cif.gz_A amide receptor/negative regulator of the amidase operon of pseudomonas aeruginosa (amic) complexed with butyramide 0.8764 26 371
7s6f-assembly1.cif.gz_A crystal structure of urta1 from synechococcus wh8102 in complex with urea and calcium 0.8576 25 369
8hic-assembly1.cif.gz_A crystal structure of urta from prochlorococcus marinus str. mit 9313 in complex with urea and calcium 0.8521 24 369
ID Description Score Start End Superfamily
af_A0A0R0JSN9_31_182_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8941 26 119 3.40.50.2300
1qo0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8901 26 340 3.40.50.2300
af_Q9SHV1_60_153_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8823 63 120 3.40.50.2300
af_Q69L11_28_153_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.88 24 119 3.40.50.2300
1qo0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8727 26 340 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A401TVV8-F1-model_v4 Leucine-binding protein domain-containing protein 0.9288 24 150 GO:0006865
AF-W1YJL9-F1-model_v4 Extracellular ligand-binding receptor 0.924 24 115
AF-A0A211ZK88-F1-model_v4 Amidase 0.9231 24 371 GO:0033218
AF-A0A520D8Z4-F1-model_v4 Urea ABC transporter substrate-binding protein 0.9182 24 141
AF-A0A1Q9A6G6-F1-model_v4 Branched-chain amino acid transport system substrate-binding protein 0.9181 24 372

Feature Viewer

pLDDT pTM Quality
81.07 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map