F401816

General Info

Members Datasets Scaffolds Average Seq Length
312 199 624 126

Family's Representative Sequence

Representative Sequence 3300042993|Ga0439440_0027859|Ga0439440_0027859_132_566
Length 144
Sequence LGSTATRCGPRAPATLHENPKGSVPTLSSLEQARRIAALAQEKLAEDVIILDLRPVTAYTDFFVLATGRNARQTKAIYDEVHGQLKQESRLLPRAVDGQQEAEWIIADYLDVVLHVFTPETRQFYRLEDLWGDVPAVDVEAATA

Samples

Sample ID Description Type Environment
1 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
2 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
67 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
68 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
69 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
70 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
71 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
72 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
73 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
85 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
86 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
87 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
88 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
89 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
90 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
91 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
92 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
93 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
94 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
95 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
96 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
97 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.09
Rhizosphere 93.27
Stem 0
Stem Tuber 0
Unclassified 13.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439440_0027859 3300042993 Bacteria 1316
2 Ga0070691_10570973 3300005341 Bacteria 664
3 Ga0070668_101188838 3300005347 Bacteria 691
4 Ga0070668_102262086 3300005347 Bacteria 503
5 Ga0070671_100248180 3300005355 Bacteria 1512
6 Ga0070709_10346924 3300005434 Unclassified 1096
7 Ga0070714_100101629 3300005435 Bacteria 2534
8 Ga0070714_100184990 3300005435 Bacteria 1898
9 Ga0070714_100918871 3300005435 Bacteria 850
10 Ga0070713_100307044 3300005436 Bacteria 1462
11 Ga0070701_10363788 3300005438 Bacteria 907
12 Ga0070711_100328340 3300005439 Bacteria 1224
13 Ga0070681_10746120 3300005458 Bacteria 895
14 Ga0070685_10904553 3300005466 Bacteria 657
15 Ga0070707_100264311 3300005468 Bacteria 1673
16 Ga0070707_100501452 3300005468 Bacteria 1175
17 Ga0070707_100559583 3300005468 Bacteria 1106
18 Ga0070707_101177266 3300005468 Unclassified 733
19 Ga0070707_101707054 3300005468 Bacteria 597
20 Ga0070698_100121969 3300005471 Bacteria 2565
21 Ga0070698_101176929 3300005471 Bacteria 716
22 Ga0070699_100026151 3300005518 Bacteria 5034
23 Ga0070699_100132336 3300005518 Bacteria 2199
24 Ga0070699_101534055 3300005518 Unclassified 611
25 Ga0070684_100523037 3300005535 Bacteria 1100
26 Ga0070697_100752834 3300005536 Bacteria 861
27 Ga0070697_101411505 3300005536 Bacteria 622
28 Ga0070696_100255714 3300005546 Bacteria 1326
29 Ga0070696_101325513 3300005546 Bacteria 612
30 Ga0070704_100077960 3300005549 Bacteria 2429
31 Ga0070704_100183743 3300005549 Bacteria 1675
32 Ga0068856_100942142 3300005614 Bacteria 882
33 Ga0068856_101808394 3300005614 Unclassified 623
34 Ga0070702_100559295 3300005615 Bacteria 851
35 Ga0068861_101682306 3300005719 Unclassified 627
36 Ga0068870_10339220 3300005840 Unclassified 961
37 Ga0068860_102075034 3300005843 Bacteria 590
38 Ga0081539_10005347 3300005985 Bacteria 13158
39 Ga0081539_10256951 3300005985 Bacteria 773
40 Ga0081539_10312682 3300005985 Bacteria 671
41 Ga0070712_100684927 3300006175 Bacteria 873
42 Ga0097621_102255476 3300006237 Bacteria 521
43 Ga0075433_10149484 3300006852 Bacteria 2077
44 Ga0075433_11278592 3300006852 Bacteria 636
45 Ga0075434_100171651 3300006871 Bacteria 2189
46 Ga0075436_101291940 3300006914 Bacteria 552
47 Ga0075435_100217701 3300007076 Bacteria 1621
48 Ga0111539_10446711 3300009094 Unclassified 1506
49 Ga0111539_12004600 3300009094 Bacteria 671
50 Ga0105245_10029500 3300009098 Bacteria 4847
51 Ga0105245_10603900 3300009098 Bacteria 1124
52 Ga0114129_10093512 3300009147 Bacteria 4165
53 Ga0114129_10631987 3300009147 Bacteria 1384
54 Ga0114129_12654521 3300009147 Bacteria 597
55 Ga0105243_10935304 3300009148 Unclassified 865
56 Ga0105242_10464077 3300009176 Bacteria 1196
57 Ga0105248_11310430 3300009177 Unclassified 819
58 Ga0105238_10531032 3300009551 Bacteria 1180
59 Ga0105238_10834413 3300009551 Unclassified 938
60 Ga0105249_11418457 3300009553 Bacteria 766
61 Ga0105246_10042824 3300011119 Bacteria 3067
62 Ga0105246_11998387 3300011119 Unclassified 559
63 Ga0157342_1036549 3300012507 Unclassified 641
64 Ga0157369_10001378 3300013105 Bacteria 29916
65 Ga0157375_10263252 3300013308 Bacteria 1886
66 Ga0163163_10754554 3300014325 Bacteria 1036
67 Ga0157380_11062213 3300014326 Bacteria 847
68 Ga0182008_10218118 3300014497 Bacteria 975
69 Ga0182008_10459192 3300014497 Unclassified 694
70 Ga0157377_10088099 3300014745 Bacteria 1828
71 Ga0163161_11244109 3300017792 Bacteria 645
72 Ga0207688_10171837 3300025901 Bacteria 1289
73 Ga0207684_10548441 3300025910 Bacteria 989
74 Ga0207663_10444478 3300025916 Bacteria 999
75 Ga0207646_10261297 3300025922 Unclassified 1564
76 Ga0207646_10512266 3300025922 Unclassified 1080
77 Ga0207646_11061747 3300025922 Bacteria 714
78 Ga0207664_10052648 3300025929 Bacteria 3220
79 Ga0207664_10381018 3300025929 Bacteria 1252
80 Ga0207664_10547515 3300025929 Bacteria 1038
81 Ga0207644_10656599 3300025931 Bacteria 873
82 Ga0207686_10151274 3300025934 Bacteria 1616
83 Ga0207709_10182857 3300025935 Bacteria 1482
84 Ga0207709_10419056 3300025935 Bacteria 1028
85 Ga0207661_10562647 3300025944 Bacteria 1045
86 Ga0207661_11036813 3300025944 Unclassified 755
87 Ga0207668_10825897 3300025972 Bacteria 822
88 Ga0207678_11618549 3300026067 Bacteria 570
89 Ga0207708_10070886 3300026075 Bacteria 2669
90 Ga0207708_10302060 3300026075 Bacteria 1302
91 Ga0207702_10847549 3300026078 Bacteria 905
92 Ga0207675_100695872 3300026118 Bacteria 1025
93 Ga0265313_10081419 3300031595 Unclassified 1470
94 Ga0307406_10067919 3300031901 Bacteria 2326
95 Ga0307416_100376861 3300032002 Bacteria 1447
96 Ga0307416_100798992 3300032002 Unclassified 1039
97 Ga0307416_101298307 3300032002 Unclassified 834
98 Ga0307415_100132625 3300032126 Bacteria 1889
99 Ga0373938_0114977 3300034957 Bacteria 688
100 Ga0373944_0074890 3300035089 Bacteria 1109
101 Ga0373951_0135339 3300035091 Unclassified 681
102 Ga0373939_0090020 3300035114 Unclassified 1035
103 Ga0373945_0255481 3300035116 Bacteria 741
104 Ga0373954_0575559 3300035118 Bacteria 558
105 Ga0373956_0419996 3300035119 Bacteria 638
106 Ga0373942_0079526 3300035207 Bacteria 971
107 Ga0373931_1116448 3300035691 Bacteria 537
108 Ga0373927_0174833 3300035695 Unclassified 1408
109 Ga0373947_0067041 3300035725 Bacteria 2191
110 Ga0373947_0800926 3300035725 Unclassified 643
111 Ga0373937_0280378 3300036401 Bacteria 1574
112 Ga0373925_0019578 3300037068 Bacteria 4925
113 Ga0395899_0093408 3300037312 Unclassified 2178
114 Ga0395899_0206559 3300037312 Bacteria 1367
115 Ga0395899_0554436 3300037312 Bacteria 738
116 Ga0395899_0719668 3300037312 Unclassified 624
117 Ga0395900_0100990 3300037418 Bacteria 2963
118 Ga0395900_0138965 3300037418 Bacteria 2488
119 Ga0395900_0145069 3300037418 Bacteria 2428
120 Ga0395900_0149672 3300037418 Bacteria 2385
121 Ga0395900_0471851 3300037418 Bacteria 1208
122 Ga0395900_0796869 3300037418 Unclassified 873
123 Ga0395898_0048882 3300037466 Bacteria 4146
124 Ga0395898_0086888 3300037466 Bacteria 3013
125 Ga0395898_0091935 3300037466 Bacteria 2918
126 Ga0395898_0239808 3300037466 Bacteria 1729
127 Ga0395905_0172580 3300037471 Unclassified 2031
128 Ga0395905_0172842 3300037471 Bacteria 2029
129 Ga0395905_0209381 3300037471 Bacteria 1827
130 Ga0395905_0267368 3300037471 Bacteria 1596
131 Ga0395901_0005302 3300038443 Bacteria 13034
132 Ga0395901_0082234 3300038443 Bacteria 3364
133 Ga0395901_0129928 3300038443 Bacteria 2647
134 Ga0395901_0142855 3300038443 Bacteria 2516
135 Ga0395901_0184928 3300038443 Bacteria 2185
136 Ga0395901_0215194 3300038443 Bacteria 2010
137 Ga0395901_0271583 3300038443 Bacteria 1763
138 Ga0395901_0438041 3300038443 Unclassified 1338
139 Ga0395901_0899666 3300038443 Bacteria 867
140 Ga0439439_0061031 3300041406 Bacteria 1001
141 Ga0439453_0049082 3300041408 Bacteria 849
142 Ga0439461_0007063 3300041410 Bacteria 1976
143 Ga0439461_0009029 3300041410 Bacteria 1801
144 Ga0451789_0331939 3300041443 Unclassified 598
145 Ga0451845_0062394 3300041501 Bacteria 831
146 Ga0451853_2547788 3300041512 Bacteria 1233
147 Ga0439431_0187847 3300041997 Bacteria 599
148 Ga0439450_173449 3300042008 Bacteria 571
149 Ga0439454_028954 3300042011 Bacteria 859
150 Ga0450920_039961 3300042122 Bacteria 935
151 Ga0450905_061869 3300042142 Bacteria 626
152 Ga0450907_087928 3300042146 Bacteria 540
153 Ga0439446_0006988 3300042156 Bacteria 2958
154 Ga0439435_0104672 3300042436 Bacteria 873
155 Ga0466969_0110057 3300044656 Unclassified 1290
156 Ga0466963_0042463 3300044694 Bacteria 2986
157 Ga0466964_0301969 3300044706 Unclassified 807
158 Ga0466957_0209157 3300044842 Bacteria 1284
159 Ga0466959_1142525 3300045049 Unclassified 518
160 Ga0451576_0369672 3300045051 Bacteria 1502
161 Ga0466958_0127348 3300045836 Unclassified 1597
162 Ga0466967_0141090 3300045976 Bacteria 2244
163 Ga0495592_0200487 3300046454 Bacteria 1347
164 Ga0495603_0265940 3300046455 Bacteria 987
165 Ga0495603_0520183 3300046455 Unclassified 681
166 Ga0495591_107086 3300046458 Bacteria 689
167 Ga0495641_0117109 3300046461 Bacteria 1188
168 Ga0495641_0493318 3300046461 Unclassified 558
169 Ga0495651_0914073 3300046462 Bacteria 536
170 Ga0495653_0371029 3300046463 Bacteria 916
171 Ga0495580_0023220 3300046472 Bacteria 4557
172 Ga0495639_0369895 3300046475 Bacteria 721
173 Ga0495584_0425650 3300046491 Bacteria 675
174 Ga0495594_0205372 3300046499 Bacteria 1123
175 Ga0495596_0039762 3300046500 Bacteria 1857
176 Ga0495607_0270030 3300046501 Bacteria 811
177 Ga0495607_0416413 3300046501 Bacteria 609
178 Ga0495608_0754952 3300046511 Bacteria 576
179 Ga0495618_0757903 3300046514 Bacteria 567
180 Ga0495628_0385020 3300046516 Bacteria 1026
181 Ga0495630_0224677 3300046517 Bacteria 1434
182 Ga0495630_0760043 3300046517 Bacteria 741
183 Ga0495631_0229070 3300046518 Bacteria 793
184 Ga0495652_0435178 3300046529 Bacteria 921
185 Ga0495654_0274171 3300046530 Bacteria 696
186 Ga0495665_0222314 3300046531 Bacteria 976
187 Ga0495665_0648169 3300046531 Bacteria 526
188 Ga0495587_0347589 3300046536 Bacteria 827
189 Ga0495587_0569343 3300046536 Bacteria 625
190 Ga0495587_0661086 3300046536 Bacteria 574
191 Ga0495621_0219640 3300046539 Unclassified 769
192 Ga0495656_0178955 3300046615 Bacteria 1041
193 Ga0495656_0184538 3300046615 Bacteria 1027
194 Ga0495634_0527562 3300046642 Bacteria 690
195 Ga0495611_0149115 3300046648 Bacteria 1092
196 Ga0495635_0438573 3300046663 Bacteria 864
197 Ga0495659_0164081 3300046664 Unclassified 898
198 Ga0495670_0534900 3300046691 Bacteria 637
199 Ga0495589_0092608 3300046794 Bacteria 1467
200 Ga0495589_0259835 3300046794 Bacteria 810
201 Ga0495604_0336508 3300047317 Bacteria 1006
202 Ga0495676_0377221 3300047321 Bacteria 944
203 Ga0495680_0407151 3300047322 Bacteria 938
204 Ga0495675_0140543 3300047444 Bacteria 1497
205 Ga0495685_213464 3300047447 Bacteria 617
206 Ga0495684_0185825 3300047471 Bacteria 1539
207 Ga0495614_0285980 3300048089 Bacteria 760
208 Ga0495615_0047889 3300048090 Bacteria 1091
209 Ga0496101_0588174 3300048904 Bacteria 880
210 Ga0496102_0612785 3300048905 Unclassified 1012
211 Ga0496104_0542848 3300048907 Unclassified 1073
212 Ga0496105_0163777 3300048908 Bacteria 1825
213 Ga0496106_0275421 3300048909 Bacteria 1348
214 Ga0496107_0868130 3300048910 Bacteria 659
215 Ga0496108_0348971 3300048911 Bacteria 1291
216 Ga0496108_1253647 3300048911 Bacteria 625
217 Ga0496109_0129854 3300048912 Bacteria 2351
218 Ga0496109_1312993 3300048912 Bacteria 659
219 Ga0496110_0160578 3300048913 Bacteria 2037
220 Ga0496110_0552310 3300048913 Bacteria 1047
221 Ga0496110_0657592 3300048913 Bacteria 948
222 Ga0496111_0729479 3300048914 Bacteria 720
223 Ga0496112_0081026 3300048915 Bacteria 3210
224 Ga0496113_0286851 3300048916 Unclassified 1317
225 Ga0496114_1186706 3300048917 Bacteria 649
226 Ga0496114_1207061 3300048917 Bacteria 642
227 Ga0501031_0000819 3300049568 Bacteria 18701
228 Ga0501031_0140693 3300049568 Bacteria 1577
229 Ga0501032_0089075 3300049569 Bacteria 2049
230 Ga0501032_0126468 3300049569 Bacteria 1688
231 Ga0501033_0071971 3300049570 Bacteria 2539
232 Ga0501033_0332528 3300049570 Bacteria 1066
233 Ga0501034_0524529 3300049571 Unclassified 1096
234 Ga0501036_0000706 3300049572 Bacteria 24664
235 Ga0501036_0010894 3300049572 Bacteria 7516
236 Ga0501036_0414883 3300049572 Bacteria 1123
237 Ga0501037_0041329 3300049573 Bacteria 3391
238 Ga0501038_0007371 3300049574 Bacteria 10147
239 Ga0501038_0044128 3300049574 Bacteria 3875
240 Ga0501039_0037114 3300049575 Bacteria 3761
241 Ga0501039_0043705 3300049575 Bacteria 3460
242 Ga0501040_0002996 3300049576 Bacteria 10926
243 Ga0501040_0049389 3300049576 Bacteria 2876
244 Ga0501040_0502874 3300049576 Bacteria 874
245 Ga0501041_0007497 3300049577 Bacteria 6403
246 Ga0501042_0030574 3300049578 Bacteria 3804
247 Ga0501042_0066767 3300049578 Bacteria 2571
248 Ga0501043_0158658 3300049579 Bacteria 1768
249 Ga0501043_0172160 3300049579 Bacteria 1689
250 Ga0501043_0358590 3300049579 Bacteria 1107
251 Ga0501046_0006937 3300049580 Bacteria 9982
252 Ga0501046_0019171 3300049580 Bacteria 5675
253 Ga0501046_0808289 3300049580 Bacteria 657
254 Ga0501047_0087969 3300049581 Bacteria 2984
255 Ga0501047_0413150 3300049581 Bacteria 1181
256 Ga0501048_0000808 3300049582 Bacteria 22984
257 Ga0501048_0007123 3300049582 Bacteria 8498
258 Ga0501067_0188458 3300049583 Bacteria 1149
259 Ga0501068_0041703 3300049584 Bacteria 2759
260 Ga0501069_0023970 3300049585 Bacteria 3328
261 Ga0501069_0120883 3300049585 Bacteria 1496
262 Ga0501070_0048814 3300049586 Bacteria 3516
263 Ga0501070_0141813 3300049586 Bacteria 1984
264 Ga0501070_0710230 3300049586 Bacteria 794
265 Ga0501071_0000147 3300049587 Bacteria 29379
266 Ga0501071_0024250 3300049587 Bacteria 4241
267 Ga0501072_0002075 3300049588 Bacteria 14903
268 Ga0501072_0093492 3300049588 Bacteria 2388
269 Ga0501073_0667546 3300049589 Bacteria 717
270 Ga0501074_0002698 3300049590 Bacteria 12433
271 Ga0501074_0195566 3300049590 Bacteria 1441
272 Ga0501075_0000414 3300049591 Bacteria 24946
273 Ga0501075_0004978 3300049591 Bacteria 9060
274 Ga0501075_0844033 3300049591 Bacteria 697
275 Ga0501076_0000225 3300049592 Bacteria 34157
276 Ga0501076_0001855 3300049592 Bacteria 14375
277 Ga0501076_0092678 3300049592 Bacteria 2431
278 Ga0501077_0008504 3300049593 Bacteria 6361
279 Ga0501077_0643835 3300049593 Unclassified 681
280 Ga0501079_0008795 3300049741 Bacteria 7650
281 Ga0501079_1408364 3300049741 Bacteria 548
282 Ga0501080_0015940 3300049742 Bacteria 6932
283 Ga0501080_0016593 3300049742 Bacteria 6803
284 Ga0501080_0242945 3300049742 Bacteria 1643
285 Ga0501081_0009783 3300049743 Bacteria 6246
286 Ga0501081_0616648 3300049743 Bacteria 812
287 Ga0501083_0039679 3300049744 Bacteria 3197
288 Ga0501083_0294996 3300049744 Bacteria 1054
289 Ga0501083_0319739 3300049744 Bacteria 1009
290 Ga0501035_0006655 3300049822 Bacteria 10810
291 Ga0501035_0105799 3300049822 Bacteria 2467
292 Ga0501035_0718042 3300049822 Bacteria 805
293 Ga0501044_0146661 3300049823 Bacteria 2345
294 Ga0501044_0264115 3300049823 Bacteria 1659
295 Ga0501045_0004699 3300049824 Bacteria 9432
296 Ga0501045_0064134 3300049824 Bacteria 2696
297 nmdc:mga05p37_342142_c1 3300050507 Bacteria 1764
298 nmdc:mga05p37_657172_c1 3300050507 Bacteria 1172
299 nmdc:mga0n895_601939_c1 3300050512 Bacteria 1101
300 nmdc:mga0rr50_665983_c1 3300050513 Bacteria 888
301 nmdc:mga08x19_1338436_c1 3300050514 Unclassified 507
302 nmdc:mga0a205_116170_c1 3300050515 Bacteria 2574
303 Ga0495612_0319935 3300053078 Bacteria 698
304 Ga0495595_0124721 3300053084 Bacteria 1256
305 Ga0495595_0293408 3300053084 Bacteria 817
306 Ga0495619_0253709 3300053085 Bacteria 1219
307 Ga0501084_0000445 3300054114 Bacteria 31921
308 Ga0501084_0003309 3300054114 Bacteria 13039
309 Ga0501082_0008602 3300060353 Bacteria 8804
310 Ga0501082_0211667 3300060353 Bacteria 1686
311 Ga0530510_0000775 3300061734 Bacteria 20781
312 Ga0530510_0013350 3300061734 Bacteria 5775
313 Ga0439440_0027859
314 Ga0070691_10570973
315 Ga0070668_101188838
316 Ga0070668_102262086
317 Ga0070671_100248180
318 Ga0070709_10346924
319 Ga0070714_100101629
320 Ga0070714_100184990
321 Ga0070714_100918871
322 Ga0070713_100307044
323 Ga0070701_10363788
324 Ga0070711_100328340
325 Ga0070681_10746120
326 Ga0070685_10904553
327 Ga0070707_100264311
328 Ga0070707_100501452
329 Ga0070707_100559583
330 Ga0070707_101177266
331 Ga0070707_101707054
332 Ga0070698_100121969
333 Ga0070698_101176929
334 Ga0070699_100026151
335 Ga0070699_100132336
336 Ga0070699_101534055
337 Ga0070684_100523037
338 Ga0070697_100752834
339 Ga0070697_101411505
340 Ga0070696_100255714
341 Ga0070696_101325513
342 Ga0070704_100077960
343 Ga0070704_100183743
344 Ga0068856_100942142
345 Ga0068856_101808394
346 Ga0070702_100559295
347 Ga0068861_101682306
348 Ga0068870_10339220
349 Ga0068860_102075034
350 Ga0081539_10005347
351 Ga0081539_10256951
352 Ga0081539_10312682
353 Ga0070712_100684927
354 Ga0097621_102255476
355 Ga0075433_10149484
356 Ga0075433_11278592
357 Ga0075434_100171651
358 Ga0075436_101291940
359 Ga0075435_100217701
360 Ga0111539_10446711
361 Ga0111539_12004600
362 Ga0105245_10029500
363 Ga0105245_10603900
364 Ga0114129_10093512
365 Ga0114129_10631987
366 Ga0114129_12654521
367 Ga0105243_10935304
368 Ga0105242_10464077
369 Ga0105248_11310430
370 Ga0105238_10531032
371 Ga0105238_10834413
372 Ga0105249_11418457
373 Ga0105246_10042824
374 Ga0105246_11998387
375 Ga0157342_1036549
376 Ga0157369_10001378
377 Ga0157375_10263252
378 Ga0163163_10754554
379 Ga0157380_11062213
380 Ga0182008_10218118
381 Ga0182008_10459192
382 Ga0157377_10088099
383 Ga0163161_11244109
384 Ga0207688_10171837
385 Ga0207684_10548441
386 Ga0207663_10444478
387 Ga0207646_10261297
388 Ga0207646_10512266
389 Ga0207646_11061747
390 Ga0207664_10052648
391 Ga0207664_10381018
392 Ga0207664_10547515
393 Ga0207644_10656599
394 Ga0207686_10151274
395 Ga0207709_10182857
396 Ga0207709_10419056
397 Ga0207661_10562647
398 Ga0207661_11036813
399 Ga0207668_10825897
400 Ga0207678_11618549
401 Ga0207708_10070886
402 Ga0207708_10302060
403 Ga0207702_10847549
404 Ga0207675_100695872
405 Ga0265313_10081419
406 Ga0307406_10067919
407 Ga0307416_100376861
408 Ga0307416_100798992
409 Ga0307416_101298307
410 Ga0307415_100132625
411 Ga0373938_0114977
412 Ga0373944_0074890
413 Ga0373951_0135339
414 Ga0373939_0090020
415 Ga0373945_0255481
416 Ga0373954_0575559
417 Ga0373956_0419996
418 Ga0373942_0079526
419 Ga0373931_1116448
420 Ga0373927_0174833
421 Ga0373947_0067041
422 Ga0373947_0800926
423 Ga0373937_0280378
424 Ga0373925_0019578
425 Ga0395899_0093408
426 Ga0395899_0206559
427 Ga0395899_0554436
428 Ga0395899_0719668
429 Ga0395900_0100990
430 Ga0395900_0138965
431 Ga0395900_0145069
432 Ga0395900_0149672
433 Ga0395900_0471851
434 Ga0395900_0796869
435 Ga0395898_0048882
436 Ga0395898_0086888
437 Ga0395898_0091935
438 Ga0395898_0239808
439 Ga0395905_0172580
440 Ga0395905_0172842
441 Ga0395905_0209381
442 Ga0395905_0267368
443 Ga0395901_0005302
444 Ga0395901_0082234
445 Ga0395901_0129928
446 Ga0395901_0142855
447 Ga0395901_0184928
448 Ga0395901_0215194
449 Ga0395901_0271583
450 Ga0395901_0438041
451 Ga0395901_0899666
452 Ga0439439_0061031
453 Ga0439453_0049082
454 Ga0439461_0007063
455 Ga0439461_0009029
456 Ga0451789_0331939
457 Ga0451845_0062394
458 Ga0451853_2547788
459 Ga0439431_0187847
460 Ga0439450_173449
461 Ga0439454_028954
462 Ga0450920_039961
463 Ga0450905_061869
464 Ga0450907_087928
465 Ga0439446_0006988
466 Ga0439435_0104672
467 Ga0466969_0110057
468 Ga0466963_0042463
469 Ga0466964_0301969
470 Ga0466957_0209157
471 Ga0466959_1142525
472 Ga0451576_0369672
473 Ga0466958_0127348
474 Ga0466967_0141090
475 Ga0495592_0200487
476 Ga0495603_0265940
477 Ga0495603_0520183
478 Ga0495591_107086
479 Ga0495641_0117109
480 Ga0495641_0493318
481 Ga0495651_0914073
482 Ga0495653_0371029
483 Ga0495580_0023220
484 Ga0495639_0369895
485 Ga0495584_0425650
486 Ga0495594_0205372
487 Ga0495596_0039762
488 Ga0495607_0270030
489 Ga0495607_0416413
490 Ga0495608_0754952
491 Ga0495618_0757903
492 Ga0495628_0385020
493 Ga0495630_0224677
494 Ga0495630_0760043
495 Ga0495631_0229070
496 Ga0495652_0435178
497 Ga0495654_0274171
498 Ga0495665_0222314
499 Ga0495665_0648169
500 Ga0495587_0347589
501 Ga0495587_0569343
502 Ga0495587_0661086
503 Ga0495621_0219640
504 Ga0495656_0178955
505 Ga0495656_0184538
506 Ga0495634_0527562
507 Ga0495611_0149115
508 Ga0495635_0438573
509 Ga0495659_0164081
510 Ga0495670_0534900
511 Ga0495589_0092608
512 Ga0495589_0259835
513 Ga0495604_0336508
514 Ga0495676_0377221
515 Ga0495680_0407151
516 Ga0495675_0140543
517 Ga0495685_213464
518 Ga0495684_0185825
519 Ga0495614_0285980
520 Ga0495615_0047889
521 Ga0496101_0588174
522 Ga0496102_0612785
523 Ga0496104_0542848
524 Ga0496105_0163777
525 Ga0496106_0275421
526 Ga0496107_0868130
527 Ga0496108_0348971
528 Ga0496108_1253647
529 Ga0496109_0129854
530 Ga0496109_1312993
531 Ga0496110_0160578
532 Ga0496110_0552310
533 Ga0496110_0657592
534 Ga0496111_0729479
535 Ga0496112_0081026
536 Ga0496113_0286851
537 Ga0496114_1186706
538 Ga0496114_1207061
539 Ga0501031_0000819
540 Ga0501031_0140693
541 Ga0501032_0089075
542 Ga0501032_0126468
543 Ga0501033_0071971
544 Ga0501033_0332528
545 Ga0501034_0524529
546 Ga0501036_0000706
547 Ga0501036_0010894
548 Ga0501036_0414883
549 Ga0501037_0041329
550 Ga0501038_0007371
551 Ga0501038_0044128
552 Ga0501039_0037114
553 Ga0501039_0043705
554 Ga0501040_0002996
555 Ga0501040_0049389
556 Ga0501040_0502874
557 Ga0501041_0007497
558 Ga0501042_0030574
559 Ga0501042_0066767
560 Ga0501043_0158658
561 Ga0501043_0172160
562 Ga0501043_0358590
563 Ga0501046_0006937
564 Ga0501046_0019171
565 Ga0501046_0808289
566 Ga0501047_0087969
567 Ga0501047_0413150
568 Ga0501048_0000808
569 Ga0501048_0007123
570 Ga0501067_0188458
571 Ga0501068_0041703
572 Ga0501069_0023970
573 Ga0501069_0120883
574 Ga0501070_0048814
575 Ga0501070_0141813
576 Ga0501070_0710230
577 Ga0501071_0000147
578 Ga0501071_0024250
579 Ga0501072_0002075
580 Ga0501072_0093492
581 Ga0501073_0667546
582 Ga0501074_0002698
583 Ga0501074_0195566
584 Ga0501075_0000414
585 Ga0501075_0004978
586 Ga0501075_0844033
587 Ga0501076_0000225
588 Ga0501076_0001855
589 Ga0501076_0092678
590 Ga0501077_0008504
591 Ga0501077_0643835
592 Ga0501079_0008795
593 Ga0501079_1408364
594 Ga0501080_0015940
595 Ga0501080_0016593
596 Ga0501080_0242945
597 Ga0501081_0009783
598 Ga0501081_0616648
599 Ga0501083_0039679
600 Ga0501083_0294996
601 Ga0501083_0319739
602 Ga0501035_0006655
603 Ga0501035_0105799
604 Ga0501035_0718042
605 Ga0501044_0146661
606 Ga0501044_0264115
607 Ga0501045_0004699
608 Ga0501045_0064134
609 nmdc:mga05p37_342142_c1
610 nmdc:mga05p37_657172_c1
611 nmdc:mga0n895_601939_c1
612 nmdc:mga0rr50_665983_c1
613 nmdc:mga08x19_1338436_c1
614 nmdc:mga0a205_116170_c1
615 Ga0495612_0319935
616 Ga0495595_0124721
617 Ga0495595_0293408
618 Ga0495619_0253709
619 Ga0501084_0000445
620 Ga0501084_0003309
621 Ga0501082_0008602
622 Ga0501082_0211667
623 Ga0530510_0000775
624 Ga0530510_0013350

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02410

RsfS

Ribosomal silencing factor during starvation

34

131

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wcw-assembly1.cif.gz_B ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9122 9 115
7bl5-assembly1.cif.gz_6 pre-50s-obge particle 0.9103 22 105
4wcw-assembly2.cif.gz_C ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9092 9 120
6sj6-assembly1.cif.gz_9 cryo-em structure of 50s-rsfs complex from staphylococcus aureus 0.8876 7 117
2o5a-assembly1.cif.gz_B crystal structure of q9kd89 from bacillus halodurans. northeast structural genomics target bhr21 0.8775 10 118
ID Description Score Start End Superfamily
af_P0AAT6_2_105_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9494 12 111 3.30.460.10
af_A0A0R0INC8_150_261_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9484 8 120 3.30.460.10
af_A0A0R0INC8_150_261_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9323 8 120 3.30.460.10
4wcwD01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9128 9 115 3.30.460.10
af_P0AAT6_2_105_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.8973 12 111 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A7W1RRH7-F1-model_v4 Ribosome silencing factor 0.9881 10 95 GO:0017148
GO:0043023
GO:0090071
AF-A0A1Q7UJP6-F1-model_v4 Ribosomal silencing factor RsfS 0.9871 7 119 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A6I2VTX4-F1-model_v4 Ribosome silencing factor 0.976 7 102 GO:0017148
GO:0043023
GO:0090071
AF-A0A538K758-F1-model_v4 Ribosomal silencing factor RsfS 0.973 7 122 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A7V9MG07-F1-model_v4 Ribosomal silencing factor RsfS 0.9726 7 117 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071

Map