F401803

General Info

Members Datasets Scaffolds Average Seq Length
312 200 624 183

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0410930|Ga0436360_0410930_4280_4828
Length 169
Sequence MPPEGDLRAAIVQDADSGRVLMLAWMDAEAELRTRETGEAWFWSRSREELWHKGETSGNVLHVVELRDDCDGDALLVRVRVDGPACHAGSLSCFAPELWRTVVERVKDRPEGSYVASLAEAGVERAAQKARDGRLVQEAADVLFHLYVLLAVAGVDVADVEAELASRRR

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
107 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
110 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
111 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
132 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
133 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
134 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
145 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 7.69
Rhizosphere 91.99
Stem 0
Stem Tuber 0
Unclassified 2.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0410930 3300039438 Bacteria 9073
2 Ga0070676_10069293 3300005328 Bacteria 2113
3 Ga0070676_10247398 3300005328 Bacteria 1188
4 Ga0070683_100847486 3300005329 Bacteria 876
5 Ga0070670_100001149 3300005331 Bacteria 21011
6 Ga0070670_100048822 3300005331 Bacteria 3641
7 Ga0068869_100026222 3300005334 Bacteria 4054
8 Ga0070680_100272727 3300005336 Bacteria 1432
9 Ga0070682_100244799 3300005337 Bacteria 1289
10 Ga0070682_100364522 3300005337 Bacteria 1081
11 Ga0070682_100554503 3300005337 Bacteria 900
12 Ga0068868_100013217 3300005338 Bacteria 6047
13 Ga0070689_100038079 3300005340 Bacteria 3678
14 Ga0070668_100116178 3300005347 Bacteria 2134
15 Ga0070669_100163152 3300005353 Bacteria 1733
16 Ga0070675_100015083 3300005354 Bacteria 6103
17 Ga0070675_100100900 3300005354 Bacteria 2431
18 Ga0070671_100381248 3300005355 Bacteria 1205
19 Ga0070674_100005539 3300005356 Bacteria 7301
20 Ga0070674_100007368 3300005356 Bacteria 6488
21 Ga0070674_100114146 3300005356 Bacteria 1989
22 Ga0070673_100237824 3300005364 Bacteria 1582
23 Ga0070673_100294217 3300005364 Bacteria 1428
24 Ga0070673_100296715 3300005364 Bacteria 1422
25 Ga0070688_100094158 3300005365 Bacteria 1963
26 Ga0070714_100009649 3300005435 Bacteria 7599
27 Ga0070714_101627675 3300005435 Bacteria 631
28 Ga0070713_100245205 3300005436 Bacteria 1632
29 Ga0070713_100492306 3300005436 Bacteria 1156
30 Ga0070713_100728398 3300005436 Bacteria 948
31 Ga0070700_100022140 3300005441 Bacteria 3702
32 Ga0070708_100640579 3300005445 Bacteria 1002
33 Ga0070678_100013774 3300005456 Bacteria 5080
34 Ga0070678_100040742 3300005456 Bacteria 3288
35 Ga0070681_10085474 3300005458 Bacteria 3107
36 Ga0070681_10250764 3300005458 Bacteria 1683
37 Ga0070681_10427143 3300005458 Bacteria 1237
38 Ga0068867_100180775 3300005459 Bacteria 1677
39 Ga0070685_10004403 3300005466 Bacteria 7113
40 Ga0070707_100219579 3300005468 Bacteria 1852
41 Ga0070698_100029687 3300005471 Bacteria 5677
42 Ga0070698_100057152 3300005471 Bacteria 3949
43 Ga0070698_100126590 3300005471 Bacteria 2511
44 Ga0070698_100677781 3300005471 Bacteria 973
45 Ga0070684_100043409 3300005535 Bacteria 3882
46 Ga0070697_100308060 3300005536 Bacteria 1362
47 Ga0070697_100407918 3300005536 Bacteria 1180
48 Ga0070672_100041307 3300005543 Bacteria 3545
49 Ga0070672_100306109 3300005543 Bacteria 1348
50 Ga0070686_100014710 3300005544 Bacteria 4516
51 Ga0070695_100482067 3300005545 Unclassified 956
52 Ga0070696_100231590 3300005546 Bacteria 1390
53 Ga0070665_100013537 3300005548 Bacteria 8205
54 Ga0070704_100265489 3300005549 Bacteria 1416
55 Ga0068855_100953521 3300005563 Bacteria 904
56 Ga0070664_100080620 3300005564 Bacteria 2803
57 Ga0068857_100264922 3300005577 Bacteria 1578
58 Ga0068854_100399533 3300005578 Bacteria 1137
59 Ga0068856_100343515 3300005614 Bacteria 1511
60 Ga0070702_100142600 3300005615 Bacteria 1528
61 Ga0070702_100308204 3300005615 Bacteria 1098
62 Ga0068859_100459483 3300005617 Bacteria 1369
63 Ga0068864_100032027 3300005618 Bacteria 4464
64 Ga0068864_101491596 3300005618 Bacteria 679
65 Ga0068866_10417818 3300005718 Bacteria 869
66 Ga0068870_10016531 3300005840 Bacteria 3527
67 Ga0068870_10027751 3300005840 Bacteria 2835
68 Ga0081455_10031422 3300005937 Bacteria 4805
69 Ga0081538_10000465 3300005981 Bacteria 45439
70 Ga0081538_10002983 3300005981 Bacteria 16132
71 Ga0081538_10037436 3300005981 Bacteria 3147
72 Ga0070717_10174121 3300006028 Bacteria 1873
73 Ga0075365_10633405 3300006038 Bacteria 756
74 Ga0070716_100026552 3300006173 Bacteria 3102
75 Ga0070712_100645998 3300006175 Bacteria 899
76 Ga0097621_100241191 3300006237 Bacteria 1580
77 Ga0075429_100307597 3300006880 Bacteria 1388
78 Ga0068865_100013860 3300006881 Bacteria 5110
79 Ga0097620_100459490 3300006931 Bacteria 1369
80 Ga0105240_10090366 3300009093 Bacteria 3743
81 Ga0111539_10427708 3300009094 Bacteria 1542
82 Ga0111539_11790772 3300009094 Bacteria 712
83 Ga0105247_10731996 3300009101 Bacteria 748
84 Ga0114129_10026263 3300009147 Bacteria 8248
85 Ga0114129_10294350 3300009147 Bacteria 2165
86 Ga0114129_10403567 3300009147 Bacteria 1801
87 Ga0105242_10016410 3300009176 Bacteria 5756
88 Ga0105242_10452611 3300009176 Bacteria 1210
89 Ga0105249_11268493 3300009553 Bacteria 808
90 Ga0105239_11821965 3300010375 Unclassified 705
91 Ga0105246_10011295 3300011119 Bacteria 5541
92 Ga0105246_10274371 3300011119 Unclassified 1350
93 Ga0157374_10995582 3300013296 Bacteria 857
94 Ga0163162_10640625 3300013306 Bacteria 1187
95 Ga0157375_10005984 3300013308 Bacteria 10610
96 Ga0163163_10005969 3300014325 Bacteria 10594
97 Ga0163163_10737028 3300014325 Bacteria 1049
98 Ga0182008_10215758 3300014497 Unclassified 980
99 Ga0157377_10016037 3300014745 Bacteria 3846
100 Ga0157379_11353028 3300014968 Unclassified 689
101 Ga0207699_10051722 3300025906 Bacteria 2428
102 Ga0207645_10134731 3300025907 Bacteria 1608
103 Ga0207643_10003224 3300025908 Bacteria 8793
104 Ga0207643_10008421 3300025908 Bacteria 5534
105 Ga0207643_10148286 3300025908 Bacteria 1405
106 Ga0207707_10035456 3300025912 Bacteria 4363
107 Ga0207707_10191101 3300025912 Bacteria 1786
108 Ga0207707_10454615 3300025912 Bacteria 1096
109 Ga0207693_10157871 3300025915 Bacteria 1784
110 Ga0207660_10502149 3300025917 Bacteria 984
111 Ga0207657_10001762 3300025919 Bacteria 23373
112 Ga0207652_10065772 3300025921 Bacteria 3140
113 Ga0207646_10292647 3300025922 Bacteria 1471
114 Ga0207646_11181589 3300025922 Bacteria 671
115 Ga0207681_10155992 3300025923 Bacteria 1716
116 Ga0207650_10001021 3300025925 Bacteria 21012
117 Ga0207650_10136689 3300025925 Bacteria 1923
118 Ga0207659_10114171 3300025926 Bacteria 2058
119 Ga0207700_10000001 3300025928 Bacteria 1122509
120 Ga0207664_10027096 3300025929 Bacteria 4340
121 Ga0207664_10455220 3300025929 Bacteria 1142
122 Ga0207644_10878276 3300025931 Bacteria 751
123 Ga0207686_10013507 3300025934 Bacteria 4520
124 Ga0207670_10088192 3300025936 Bacteria 2187
125 Ga0207669_10038680 3300025937 Bacteria 2749
126 Ga0207665_10003099 3300025939 Bacteria 11155
127 Ga0207665_10322649 3300025939 Bacteria 1159
128 Ga0207691_10411019 3300025940 Bacteria 1154
129 Ga0207689_10016491 3300025942 Bacteria 6253
130 Ga0207661_10070648 3300025944 Bacteria 2851
131 Ga0207661_10696954 3300025944 Bacteria 934
132 Ga0207679_10132282 3300025945 Bacteria 2003
133 Ga0207667_10276532 3300025949 Bacteria 1716
134 Ga0207651_10056279 3300025960 Bacteria 2706
135 Ga0207668_10213385 3300025972 Bacteria 1545
136 Ga0207708_10005523 3300026075 Bacteria 9332
137 Ga0207702_10290820 3300026078 Bacteria 1548
138 Ga0207648_10167251 3300026089 Bacteria 1943
139 Ga0207648_10958767 3300026089 Bacteria 800
140 Ga0207676_10074181 3300026095 Bacteria 2740
141 Ga0207674_10105311 3300026116 Bacteria 2799
142 Ga0207674_10202496 3300026116 Bacteria 1934
143 Ga0207683_10043496 3300026121 Bacteria 3926
144 Ga0207683_10079034 3300026121 Bacteria 2915
145 Ga0268264_10363605 3300028381 Bacteria 1381
146 Ga0265319_1004497 3300028563 Bacteria 6888
147 Ga0265319_1023845 3300028563 Bacteria 2211
148 Ga0265319_1087812 3300028563 Bacteria 983
149 Ga0265319_1167123 3300028563 Bacteria 679
150 Ga0265334_10009733 3300028573 Bacteria 4062
151 Ga0265334_10081974 3300028573 Bacteria 1187
152 Ga0265334_10109157 3300028573 Bacteria 995
153 Ga0265318_10003690 3300028577 Bacteria 7647
154 Ga0265318_10007972 3300028577 Bacteria 4751
155 Ga0265318_10075336 3300028577 Bacteria 1249
156 Ga0265323_10049997 3300028653 Bacteria 1487
157 Ga0265322_10006136 3300028654 Bacteria 3539
158 Ga0265322_10079778 3300028654 Bacteria 929
159 Ga0265338_10003752 3300028800 Bacteria 21100
160 Ga0265338_10006875 3300028800 Bacteria 14323
161 Ga0265338_10011160 3300028800 Bacteria 10413
162 Ga0265338_10011511 3300028800 Bacteria 10207
163 Ga0265324_10047526 3300029957 Bacteria 1476
164 Ga0265330_10008059 3300031235 Bacteria 5096
165 Ga0265330_10026661 3300031235 Bacteria 2612
166 Ga0265330_10061753 3300031235 Bacteria 1630
167 Ga0265332_10058943 3300031238 Bacteria 1643
168 Ga0265328_10012727 3300031239 Bacteria 3344
169 Ga0265320_10045981 3300031240 Bacteria 2142
170 Ga0265325_10027806 3300031241 Bacteria 3054
171 Ga0265325_10033356 3300031241 Bacteria 2745
172 Ga0265325_10033902 3300031241 Bacteria 2720
173 Ga0265329_10020166 3300031242 Bacteria 2254
174 Ga0265329_10021597 3300031242 Bacteria 2161
175 Ga0265340_10053187 3300031247 Bacteria 1955
176 Ga0265340_10060385 3300031247 Bacteria 1816
177 Ga0265339_10068711 3300031249 Bacteria 1892
178 Ga0265339_10098099 3300031249 Bacteria 1528
179 Ga0265339_10135320 3300031249 Bacteria 1257
180 Ga0265339_10143178 3300031249 Bacteria 1214
181 Ga0265327_10019129 3300031251 Bacteria 4222
182 Ga0265327_10027283 3300031251 Bacteria 3290
183 Ga0265327_10089880 3300031251 Bacteria 1499
184 Ga0265316_10167116 3300031344 Bacteria 1642
185 Ga0265316_10240691 3300031344 Bacteria 1330
186 Ga0265316_10338610 3300031344 Bacteria 1090
187 Ga0265313_10023011 3300031595 Bacteria 3365
188 Ga0265313_10063321 3300031595 Bacteria 1724
189 Ga0265314_10006676 3300031711 Bacteria 10138
190 Ga0265314_10024053 3300031711 Bacteria 4627
191 Ga0265314_10326192 3300031711 Bacteria 852
192 Ga0265342_10036826 3300031712 Bacteria 2986
193 Ga0265342_10039709 3300031712 Bacteria 2857
194 Ga0265342_10113496 3300031712 Bacteria 1531
195 Ga0307409_100960405 3300031995 Bacteria 871
196 Ga0316583_10013934 3300032133 Bacteria 2900
197 Ga0316583_10036772 3300032133 Bacteria 1736
198 Ga0395899_0044729 3300037312 Bacteria 3298
199 Ga0395900_0052899 3300037418 Bacteria 4180
200 Ga0395900_0120409 3300037418 Bacteria 2693
201 Ga0395900_0217357 3300037418 Bacteria 1928
202 Ga0395900_1125420 3300037418 Unclassified 702
203 Ga0395898_0229339 3300037466 Bacteria 1771
204 Ga0395898_0282142 3300037466 Bacteria 1584
205 Ga0395898_0500222 3300037466 Bacteria 1156
206 Ga0395905_0377320 3300037471 Bacteria 1312
207 Ga0395901_0002004 3300038443 Bacteria 20955
208 Ga0395901_0026980 3300038443 Bacteria 5898
209 Ga0395901_0106593 3300038443 Bacteria 2941
210 Ga0395901_0157149 3300038443 Bacteria 2388
211 Ga0439465_0080515 3300041413 Bacteria 1104
212 Ga0451798_0182803 3300041458 Bacteria 888
213 Ga0450910_042588 3300042147 Bacteria 736
214 Ga0439446_0018046 3300042156 Bacteria 1973
215 Ga0439434_0007878 3300042435 Bacteria 3123
216 Ga0466961_0135044 3300044693 Bacteria 1546
217 Ga0466963_0071484 3300044694 Bacteria 2335
218 Ga0466963_0433276 3300044694 Bacteria 927
219 Ga0466964_0496549 3300044706 Bacteria 655
220 Ga0466958_0208148 3300045836 Bacteria 1246
221 Ga0466967_0007997 3300045976 Bacteria 7701
222 Ga0466967_0020981 3300045976 Bacteria 5292
223 Ga0495592_0230068 3300046454 Bacteria 1235
224 Ga0495629_0063827 3300046459 Bacteria 2572
225 Ga0495641_0457249 3300046461 Bacteria 581
226 Ga0495653_0405301 3300046463 Bacteria 866
227 Ga0495584_0289620 3300046491 Bacteria 832
228 Ga0495596_0010775 3300046500 Bacteria 3968
229 Ga0495608_0338919 3300046511 Bacteria 927
230 Ga0495630_0338302 3300046517 Bacteria 1151
231 Ga0495667_0013875 3300046559 Bacteria 5440
232 Ga0495634_0351527 3300046642 Bacteria 882
233 Ga0495658_0344808 3300046683 Bacteria 946
234 Ga0495613_0239383 3300046689 Bacteria 1269
235 Ga0495624_0575734 3300046690 Bacteria 672
236 Ga0495680_0033506 3300047322 Bacteria 4157
237 Ga0495684_0057794 3300047471 Bacteria 2956
238 Ga0495602_0136940 3300048088 Bacteria 1944
239 Ga0496101_0304357 3300048904 Bacteria 1249
240 Ga0496102_0768181 3300048905 Bacteria 886
241 Ga0496103_0279425 3300048906 Bacteria 1074
242 Ga0496104_0174982 3300048907 Bacteria 2057
243 Ga0496105_0195031 3300048908 Bacteria 1655
244 Ga0496106_0002988 3300048909 Bacteria 12595
245 Ga0496106_0737493 3300048909 Bacteria 784
246 Ga0496107_0005199 3300048910 Bacteria 8889
247 Ga0496108_0071573 3300048911 Bacteria 2926
248 Ga0496108_0268003 3300048911 Bacteria 1486
249 Ga0496109_0195218 3300048912 Bacteria 1902
250 Ga0496110_0028653 3300048913 Bacteria 4785
251 Ga0496110_0072271 3300048913 Bacteria 3060
252 Ga0496110_0131739 3300048913 Bacteria 2258
253 Ga0496110_0490651 3300048913 Bacteria 1119
254 Ga0496111_0056241 3300048914 Bacteria 2846
255 Ga0496111_0170125 3300048914 Bacteria 1619
256 Ga0496112_0013869 3300048915 Bacteria 7455
257 Ga0496112_0039718 3300048915 Bacteria 4600
258 Ga0496112_0064655 3300048915 Bacteria 3610
259 Ga0496112_0236241 3300048915 Bacteria 1781
260 Ga0496113_0162663 3300048916 Bacteria 1765
261 Ga0496113_0307449 3300048916 Bacteria 1270
262 Ga0501031_0005864 3300049568 Bacteria 8006
263 Ga0501033_0433884 3300049570 Bacteria 914
264 Ga0501034_1037536 3300049571 Bacteria 703
265 Ga0501036_0019400 3300049572 Bacteria 5708
266 Ga0501038_0067879 3300049574 Bacteria 3033
267 Ga0501039_0056795 3300049575 Bacteria 3032
268 Ga0501040_0047408 3300049576 Bacteria 2935
269 Ga0501042_0001950 3300049578 Bacteria 12427
270 Ga0501042_0099404 3300049578 Bacteria 2092
271 Ga0501043_0235503 3300049579 Bacteria 1413
272 Ga0501043_0444684 3300049579 Bacteria 975
273 Ga0501046_0262016 3300049580 Bacteria 1270
274 Ga0501048_0025123 3300049582 Bacteria 4343
275 Ga0501068_0027744 3300049584 Bacteria 3345
276 Ga0501068_0149951 3300049584 Bacteria 1465
277 Ga0501068_0437669 3300049584 Bacteria 845
278 Ga0501068_0505255 3300049584 Bacteria 784
279 Ga0501069_0246723 3300049585 Bacteria 1041
280 Ga0501071_0003551 3300049587 Bacteria 9762
281 Ga0501071_0167432 3300049587 Bacteria 1645
282 Ga0501072_0003556 3300049588 Bacteria 11728
283 Ga0501072_0393962 3300049588 Bacteria 1099
284 Ga0501074_0056654 3300049590 Bacteria 2825
285 Ga0501075_0012301 3300049591 Bacteria 6079
286 Ga0501076_0074854 3300049592 Bacteria 2713
287 Ga0501077_0026976 3300049593 Bacteria 3647
288 Ga0501079_0018432 3300049741 Bacteria 5333
289 Ga0501079_1063639 3300049741 Bacteria 637
290 Ga0501081_0006567 3300049743 Bacteria 7557
291 Ga0501081_1098616 3300049743 Bacteria 602
292 Ga0501083_0099076 3300049744 Bacteria 1922
293 nmdc:mga05p37_101632_c1 3300050507 Bacteria 3540
294 nmdc:mga05p37_1709751_c1 3300050507 Bacteria 613
295 nmdc:mga05p37_506693_c1 3300050507 Bacteria 1384
296 nmdc:mga08y16_103557_c1 3300050511 Bacteria 2963
297 nmdc:mga08y16_1137016_c1 3300050511 Bacteria 754
298 nmdc:mga0rr50_1067637_c1 3300050513 Unclassified 687
299 nmdc:mga0rr50_188860_c1 3300050513 Bacteria 1687
300 Ga0495595_0212152 3300053084 Bacteria 965
301 Ga0495619_0197519 3300053085 Bacteria 1393
302 Ga0501084_0006738 3300054114 Bacteria 9444
303 Ga0501084_0073701 3300054114 Bacteria 2859
304 Ga0501084_0095003 3300054114 Bacteria 2503
305 Ga0501084_0140538 3300054114 Bacteria 2033
306 Ga0590075_053991 3300059424 Bacteria 1032
307 Ga0590077_032580 3300059426 Bacteria 1142
308 Ga0501082_0020279 3300060353 Bacteria 5731
309 Ga0501082_0349283 3300060353 Bacteria 1289
310 Ga0501082_1791400 3300060353 Bacteria 536
311 Ga0530510_0001091 3300061734 Bacteria 17991
312 Ga0530510_0449365 3300061734 Bacteria 974
313 Ga0436360_0410930
314 Ga0070676_10069293
315 Ga0070676_10247398
316 Ga0070683_100847486
317 Ga0070670_100001149
318 Ga0070670_100048822
319 Ga0068869_100026222
320 Ga0070680_100272727
321 Ga0070682_100244799
322 Ga0070682_100364522
323 Ga0070682_100554503
324 Ga0068868_100013217
325 Ga0070689_100038079
326 Ga0070668_100116178
327 Ga0070669_100163152
328 Ga0070675_100015083
329 Ga0070675_100100900
330 Ga0070671_100381248
331 Ga0070674_100005539
332 Ga0070674_100007368
333 Ga0070674_100114146
334 Ga0070673_100237824
335 Ga0070673_100294217
336 Ga0070673_100296715
337 Ga0070688_100094158
338 Ga0070714_100009649
339 Ga0070714_101627675
340 Ga0070713_100245205
341 Ga0070713_100492306
342 Ga0070713_100728398
343 Ga0070700_100022140
344 Ga0070708_100640579
345 Ga0070678_100013774
346 Ga0070678_100040742
347 Ga0070681_10085474
348 Ga0070681_10250764
349 Ga0070681_10427143
350 Ga0068867_100180775
351 Ga0070685_10004403
352 Ga0070707_100219579
353 Ga0070698_100029687
354 Ga0070698_100057152
355 Ga0070698_100126590
356 Ga0070698_100677781
357 Ga0070684_100043409
358 Ga0070697_100308060
359 Ga0070697_100407918
360 Ga0070672_100041307
361 Ga0070672_100306109
362 Ga0070686_100014710
363 Ga0070695_100482067
364 Ga0070696_100231590
365 Ga0070665_100013537
366 Ga0070704_100265489
367 Ga0068855_100953521
368 Ga0070664_100080620
369 Ga0068857_100264922
370 Ga0068854_100399533
371 Ga0068856_100343515
372 Ga0070702_100142600
373 Ga0070702_100308204
374 Ga0068859_100459483
375 Ga0068864_100032027
376 Ga0068864_101491596
377 Ga0068866_10417818
378 Ga0068870_10016531
379 Ga0068870_10027751
380 Ga0081455_10031422
381 Ga0081538_10000465
382 Ga0081538_10002983
383 Ga0081538_10037436
384 Ga0070717_10174121
385 Ga0075365_10633405
386 Ga0070716_100026552
387 Ga0070712_100645998
388 Ga0097621_100241191
389 Ga0075429_100307597
390 Ga0068865_100013860
391 Ga0097620_100459490
392 Ga0105240_10090366
393 Ga0111539_10427708
394 Ga0111539_11790772
395 Ga0105247_10731996
396 Ga0114129_10026263
397 Ga0114129_10294350
398 Ga0114129_10403567
399 Ga0105242_10016410
400 Ga0105242_10452611
401 Ga0105249_11268493
402 Ga0105239_11821965
403 Ga0105246_10011295
404 Ga0105246_10274371
405 Ga0157374_10995582
406 Ga0163162_10640625
407 Ga0157375_10005984
408 Ga0163163_10005969
409 Ga0163163_10737028
410 Ga0182008_10215758
411 Ga0157377_10016037
412 Ga0157379_11353028
413 Ga0207699_10051722
414 Ga0207645_10134731
415 Ga0207643_10003224
416 Ga0207643_10008421
417 Ga0207643_10148286
418 Ga0207707_10035456
419 Ga0207707_10191101
420 Ga0207707_10454615
421 Ga0207693_10157871
422 Ga0207660_10502149
423 Ga0207657_10001762
424 Ga0207652_10065772
425 Ga0207646_10292647
426 Ga0207646_11181589
427 Ga0207681_10155992
428 Ga0207650_10001021
429 Ga0207650_10136689
430 Ga0207659_10114171
431 Ga0207700_10000001
432 Ga0207664_10027096
433 Ga0207664_10455220
434 Ga0207644_10878276
435 Ga0207686_10013507
436 Ga0207670_10088192
437 Ga0207669_10038680
438 Ga0207665_10003099
439 Ga0207665_10322649
440 Ga0207691_10411019
441 Ga0207689_10016491
442 Ga0207661_10070648
443 Ga0207661_10696954
444 Ga0207679_10132282
445 Ga0207667_10276532
446 Ga0207651_10056279
447 Ga0207668_10213385
448 Ga0207708_10005523
449 Ga0207702_10290820
450 Ga0207648_10167251
451 Ga0207648_10958767
452 Ga0207676_10074181
453 Ga0207674_10105311
454 Ga0207674_10202496
455 Ga0207683_10043496
456 Ga0207683_10079034
457 Ga0268264_10363605
458 Ga0265319_1004497
459 Ga0265319_1023845
460 Ga0265319_1087812
461 Ga0265319_1167123
462 Ga0265334_10009733
463 Ga0265334_10081974
464 Ga0265334_10109157
465 Ga0265318_10003690
466 Ga0265318_10007972
467 Ga0265318_10075336
468 Ga0265323_10049997
469 Ga0265322_10006136
470 Ga0265322_10079778
471 Ga0265338_10003752
472 Ga0265338_10006875
473 Ga0265338_10011160
474 Ga0265338_10011511
475 Ga0265324_10047526
476 Ga0265330_10008059
477 Ga0265330_10026661
478 Ga0265330_10061753
479 Ga0265332_10058943
480 Ga0265328_10012727
481 Ga0265320_10045981
482 Ga0265325_10027806
483 Ga0265325_10033356
484 Ga0265325_10033902
485 Ga0265329_10020166
486 Ga0265329_10021597
487 Ga0265340_10053187
488 Ga0265340_10060385
489 Ga0265339_10068711
490 Ga0265339_10098099
491 Ga0265339_10135320
492 Ga0265339_10143178
493 Ga0265327_10019129
494 Ga0265327_10027283
495 Ga0265327_10089880
496 Ga0265316_10167116
497 Ga0265316_10240691
498 Ga0265316_10338610
499 Ga0265313_10023011
500 Ga0265313_10063321
501 Ga0265314_10006676
502 Ga0265314_10024053
503 Ga0265314_10326192
504 Ga0265342_10036826
505 Ga0265342_10039709
506 Ga0265342_10113496
507 Ga0307409_100960405
508 Ga0316583_10013934
509 Ga0316583_10036772
510 Ga0395899_0044729
511 Ga0395900_0052899
512 Ga0395900_0120409
513 Ga0395900_0217357
514 Ga0395900_1125420
515 Ga0395898_0229339
516 Ga0395898_0282142
517 Ga0395898_0500222
518 Ga0395905_0377320
519 Ga0395901_0002004
520 Ga0395901_0026980
521 Ga0395901_0106593
522 Ga0395901_0157149
523 Ga0439465_0080515
524 Ga0451798_0182803
525 Ga0450910_042588
526 Ga0439446_0018046
527 Ga0439434_0007878
528 Ga0466961_0135044
529 Ga0466963_0071484
530 Ga0466963_0433276
531 Ga0466964_0496549
532 Ga0466958_0208148
533 Ga0466967_0007997
534 Ga0466967_0020981
535 Ga0495592_0230068
536 Ga0495629_0063827
537 Ga0495641_0457249
538 Ga0495653_0405301
539 Ga0495584_0289620
540 Ga0495596_0010775
541 Ga0495608_0338919
542 Ga0495630_0338302
543 Ga0495667_0013875
544 Ga0495634_0351527
545 Ga0495658_0344808
546 Ga0495613_0239383
547 Ga0495624_0575734
548 Ga0495680_0033506
549 Ga0495684_0057794
550 Ga0495602_0136940
551 Ga0496101_0304357
552 Ga0496102_0768181
553 Ga0496103_0279425
554 Ga0496104_0174982
555 Ga0496105_0195031
556 Ga0496106_0002988
557 Ga0496106_0737493
558 Ga0496107_0005199
559 Ga0496108_0071573
560 Ga0496108_0268003
561 Ga0496109_0195218
562 Ga0496110_0028653
563 Ga0496110_0072271
564 Ga0496110_0131739
565 Ga0496110_0490651
566 Ga0496111_0056241
567 Ga0496111_0170125
568 Ga0496112_0013869
569 Ga0496112_0039718
570 Ga0496112_0064655
571 Ga0496112_0236241
572 Ga0496113_0162663
573 Ga0496113_0307449
574 Ga0501031_0005864
575 Ga0501033_0433884
576 Ga0501034_1037536
577 Ga0501036_0019400
578 Ga0501038_0067879
579 Ga0501039_0056795
580 Ga0501040_0047408
581 Ga0501042_0001950
582 Ga0501042_0099404
583 Ga0501043_0235503
584 Ga0501043_0444684
585 Ga0501046_0262016
586 Ga0501048_0025123
587 Ga0501068_0027744
588 Ga0501068_0149951
589 Ga0501068_0437669
590 Ga0501068_0505255
591 Ga0501069_0246723
592 Ga0501071_0003551
593 Ga0501071_0167432
594 Ga0501072_0003556
595 Ga0501072_0393962
596 Ga0501074_0056654
597 Ga0501075_0012301
598 Ga0501076_0074854
599 Ga0501077_0026976
600 Ga0501079_0018432
601 Ga0501079_1063639
602 Ga0501081_0006567
603 Ga0501081_1098616
604 Ga0501083_0099076
605 nmdc:mga05p37_101632_c1
606 nmdc:mga05p37_1709751_c1
607 nmdc:mga05p37_506693_c1
608 nmdc:mga08y16_103557_c1
609 nmdc:mga08y16_1137016_c1
610 nmdc:mga0rr50_1067637_c1
611 nmdc:mga0rr50_188860_c1
612 Ga0495595_0212152
613 Ga0495619_0197519
614 Ga0501084_0006738
615 Ga0501084_0073701
616 Ga0501084_0095003
617 Ga0501084_0140538
618 Ga0590075_053991
619 Ga0590077_032580
620 Ga0501082_0020279
621 Ga0501082_0349283
622 Ga0501082_1791400
623 Ga0530510_0001091
624 Ga0530510_0449365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01502

PRA-CH

Phosphoribosyl-AMP cyclohydrolase

22

95

0.99

PF01503

PRA-PH

Phosphoribosyl-ATP pyrophosphohydrolase

95

168

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hcr-assembly1.cif.gz_T cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.9461 123 161
7t8u-assembly1.cif.gz_A structure of psmbeta2 nanotubes 0.9273 125 161
3c90-assembly1.cif.gz_X the 1.25 a resolution structure of phosphoribosyl-atp pyrophosphohydrolase from mycobacterium tuberculosis, crystal form ii 0.9112 96 174
1z0j-assembly1.cif.gz_B structure of gtp-bound rab22q64l gtpase in complex with the minimal rab binding domain of rabenosyn-5 0.902 119 165
7t8u-assembly1.cif.gz_C structure of psmbeta2 nanotubes 0.9004 125 161
ID Description Score Start End Superfamily
af_P9WMM9_1_93_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9461 96 174 1.10.287.1080
af_P9WMM7_1_97_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9417 5 81 3.10.20.810
1zpsA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9404 3 81 3.10.20.810
af_O59667_194_289_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9397 5 81 3.10.20.810
5zwlE02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9375 123 166 1.10.287.540
ID Description Score Start End GO Terms
AF-A0A7R8WX10-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9677 5 78 GO:0000105
GO:0004635
AF-A0A7W1SMB6-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9619 5 80 GO:0000105
GO:0004635
AF-A0A7X7N0L5-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9614 5 78 GO:0000105
GO:0004635
AF-A0A352CSC9-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9594 5 74 GO:0000105
GO:0004635
AF-A0A7K4FBC3-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9582 5 73 GO:0000105
GO:0004635

Map