F401705

General Info

Members Datasets Scaffolds Average Seq Length
312 156 624 216

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10189784|Ga0157372_101897843
Length 229
Sequence MARNGHAAKTKTQNFYDRIAEVHNFAMKLNGYRASVSKYLRSLDLELGPDSYVLDAGSGTGIVTLAMQDAGIKPKRTFALDLSFNSLRIAREQFAKRKRSAKAISCVQGNILKLPFPDNSFDLVMTCGVLEYVNLDDGLCELSRVLKPNGKLVLIPVKAGFVGAMLELLYNFKIHPMKEVRRIAQRYFTIVGNHEFPISEPISWSKTIFLLEKKPHRTKTRPIDAHQMA

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
132 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
133 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
134 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
137 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
146 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
147 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
148 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
149 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
150 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
151 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
152 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
153 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.28
Rhizosphere 97.12
Stem 0
Stem Tuber 0
Unclassified 22.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10189784 3300013307 Bacteria 2380
2 LJQas_1001756 3300000549 Bacteria 3177
3 rootL2_10035202 3300003322 Bacteria 3647
4 Ga0065707_10343539 3300005295 Unclassified 929
5 Ga0070658_10131776 3300005327 Bacteria 2083
6 Ga0070683_100054624 3300005329 Unclassified 3704
7 Ga0070690_100008274 3300005330 Bacteria 5983
8 Ga0070670_100011780 3300005331 Bacteria 7479
9 Ga0070670_100145309 3300005331 Bacteria 2052
10 Ga0070670_100147237 3300005331 Unclassified 2038
11 Ga0070670_100270153 3300005331 Bacteria 1484
12 Ga0070677_10011561 3300005333 Bacteria 3048
13 Ga0068869_100139112 3300005334 Unclassified 1873
14 Ga0068869_100653705 3300005334 Unclassified 893
15 Ga0070666_10223735 3300005335 Bacteria 1328
16 Ga0070666_10452732 3300005335 Bacteria 927
17 Ga0070680_100153355 3300005336 Bacteria 1935
18 Ga0070680_100453850 3300005336 Bacteria 1095
19 Ga0070682_100212764 3300005337 Bacteria 1371
20 Ga0068868_100036682 3300005338 Unclassified 3797
21 Ga0070660_100133525 3300005339 Bacteria 1988
22 Ga0070689_100012418 3300005340 Bacteria 6136
23 Ga0070689_100051364 3300005340 Bacteria 3187
24 Ga0070689_100279920 3300005340 Unclassified 1383
25 Ga0070661_100082336 3300005344 Bacteria 2376
26 Ga0070661_100198995 3300005344 Unclassified 1530
27 Ga0070668_100067477 3300005347 Unclassified 2779
28 Ga0070671_100010510 3300005355 Bacteria 7428
29 Ga0070671_100085514 3300005355 Bacteria 2639
30 Ga0070671_100264547 3300005355 Bacteria 1462
31 Ga0070674_100218239 3300005356 Bacteria 1482
32 Ga0070673_100217369 3300005364 Bacteria 1653
33 Ga0070688_100014117 3300005365 Bacteria 4520
34 Ga0070659_100038640 3300005366 Bacteria 3723
35 Ga0070667_100054597 3300005367 Bacteria 3373
36 Ga0070678_100234878 3300005456 Bacteria 1530
37 Ga0070662_100024883 3300005457 Bacteria 4130
38 Ga0070681_10032308 3300005458 Bacteria 5252
39 Ga0070681_10037356 3300005458 Bacteria 4874
40 Ga0068867_100576516 3300005459 Unclassified 978
41 Ga0070685_10012677 3300005466 Bacteria 4434
42 Ga0070679_100179336 3300005530 Bacteria 2091
43 Ga0068853_100066831 3300005539 Unclassified 3123
44 Ga0068853_100077366 3300005539 Bacteria 2906
45 Ga0068853_100155993 3300005539 Bacteria 2057
46 Ga0068853_100214248 3300005539 Bacteria 1757
47 Ga0070672_100211751 3300005543 Bacteria 1623
48 Ga0070672_101026091 3300005543 Bacteria 731
49 Ga0070693_100121883 3300005547 Bacteria 1618
50 Ga0070665_100039919 3300005548 Bacteria 4719
51 Ga0068855_100571940 3300005563 Bacteria 1221
52 Ga0068855_100692810 3300005563 Unclassified 1091
53 Ga0070664_100006426 3300005564 Bacteria 9480
54 Ga0070664_100060787 3300005564 Bacteria 3218
55 Ga0068857_100012294 3300005577 Bacteria 7447
56 Ga0068857_100444325 3300005577 Bacteria 1212
57 Ga0068857_100510206 3300005577 Unclassified 1129
58 Ga0068857_100994838 3300005577 Bacteria 807
59 Ga0068857_101046545 3300005577 Unclassified 787
60 Ga0068854_100345118 3300005578 Unclassified 1217
61 Ga0068854_100736967 3300005578 Unclassified 854
62 Ga0068856_100297227 3300005614 Bacteria 1632
63 Ga0068856_101366176 3300005614 Bacteria 723
64 Ga0070702_100028202 3300005615 Bacteria 3041
65 Ga0068852_100096154 3300005616 Bacteria 2661
66 Ga0068852_100159081 3300005616 Bacteria 2107
67 Ga0068852_100186358 3300005616 Unclassified 1955
68 Ga0068852_100488094 3300005616 Bacteria 1225
69 Ga0068852_100844405 3300005616 Bacteria 931
70 Ga0068859_100019828 3300005617 Bacteria 6750
71 Ga0068859_100022483 3300005617 Bacteria 6323
72 Ga0068864_100011134 3300005618 Bacteria 7434
73 Ga0068864_100059322 3300005618 Bacteria 3310
74 Ga0068864_100223570 3300005618 Unclassified 1738
75 Ga0068866_10052402 3300005718 Unclassified 2082
76 Ga0068851_10062538 3300005834 Bacteria 1910
77 Ga0068870_10028640 3300005840 Bacteria 2798
78 Ga0068863_100017689 3300005841 Bacteria 6823
79 Ga0068863_100927137 3300005841 Unclassified 872
80 Ga0068858_100028445 3300005842 Bacteria 5192
81 Ga0068858_100120339 3300005842 Bacteria 2455
82 Ga0068858_100130640 3300005842 Bacteria 2355
83 Ga0068858_100320767 3300005842 Unclassified 1481
84 Ga0068860_100051608 3300005843 Unclassified 3913
85 Ga0068860_100106138 3300005843 Bacteria 2682
86 Ga0068862_100264559 3300005844 Bacteria 1571
87 Ga0068862_100395549 3300005844 Bacteria 1292
88 Ga0068862_100425735 3300005844 Unclassified 1247
89 Ga0068862_100600717 3300005844 Bacteria 1056
90 Ga0068871_100141570 3300006358 Bacteria 2045
91 Ga0097620_100019828 3300006931 Bacteria 6750
92 Ga0097620_100022484 3300006931 Bacteria 6323
93 Ga0105240_10050087 3300009093 Bacteria 5268
94 Ga0105240_10316398 3300009093 Bacteria 1780
95 Ga0111539_10033755 3300009094 Bacteria 6211
96 Ga0111539_10423164 3300009094 Bacteria 1551
97 Ga0111539_10624908 3300009094 Unclassified 1254
98 Ga0105247_10034541 3300009101 Bacteria 3080
99 Ga0105247_10038200 3300009101 Bacteria 2930
100 Ga0105247_10258236 3300009101 Bacteria 1194
101 Ga0114129_10576900 3300009147 Unclassified 1460
102 Ga0105243_10036433 3300009148 Bacteria 3819
103 Ga0105241_10049910 3300009174 Bacteria 3189
104 Ga0105241_10254031 3300009174 Bacteria 1491
105 Ga0105241_10282082 3300009174 Bacteria 1419
106 Ga0105241_10355860 3300009174 Unclassified 1272
107 Ga0105242_10115257 3300009176 Unclassified 2297
108 Ga0105248_10598016 3300009177 Bacteria 1245
109 Ga0105237_10076548 3300009545 Bacteria 3336
110 Ga0105249_10011866 3300009553 Bacteria 7660
111 Ga0105249_10171007 3300009553 Unclassified 2107
112 Ga0105249_10234413 3300009553 Bacteria 1811
113 Ga0105249_10409081 3300009553 Bacteria 1388
114 Ga0105239_10097399 3300010375 Bacteria 3251
115 Ga0105239_10125261 3300010375 Bacteria 2855
116 Ga0105239_10568294 3300010375 Bacteria 1292
117 Ga0157373_10066882 3300013100 Bacteria 2541
118 Ga0157373_10082817 3300013100 Bacteria 2261
119 Ga0157373_10430370 3300013100 Unclassified 948
120 Ga0157370_10173572 3300013104 Bacteria 2004
121 Ga0157370_10187770 3300013104 Bacteria 1919
122 Ga0157369_10102184 3300013105 Bacteria 3055
123 Ga0157369_10246103 3300013105 Bacteria 1867
124 Ga0157369_10466785 3300013105 Bacteria 1307
125 Ga0157374_10205984 3300013296 Bacteria 1928
126 Ga0157378_10117564 3300013297 Bacteria 2446
127 Ga0163162_10073618 3300013306 Bacteria 3472
128 Ga0163162_10115273 3300013306 Bacteria 2787
129 Ga0163162_10223108 3300013306 Bacteria 2014
130 Ga0163162_10250049 3300013306 Bacteria 1905
131 Ga0157372_10091838 3300013307 Bacteria 3453
132 Ga0157372_10137132 3300013307 Bacteria 2818
133 Ga0157372_10567388 3300013307 Bacteria 1323
134 Ga0157375_10013576 3300013308 Bacteria 7254
135 Ga0157375_10141029 3300013308 Unclassified 2537
136 Ga0157375_10165215 3300013308 Bacteria 2358
137 Ga0157375_10351254 3300013308 Bacteria 1640
138 Ga0163163_10076218 3300014325 Unclassified 3348
139 Ga0163163_10320060 3300014325 Bacteria 1605
140 Ga0163163_10532811 3300014325 Unclassified 1237
141 Ga0163163_10558700 3300014325 Unclassified 1207
142 Ga0157380_10089751 3300014326 Bacteria 2533
143 Ga0157377_10076350 3300014745 Bacteria 1948
144 Ga0157379_10720646 3300014968 Bacteria 937
145 Ga0157376_10161430 3300014969 Bacteria 2032
146 Ga0163161_10010702 3300017792 Bacteria 6353
147 Ga0163161_10144753 3300017792 Unclassified 1802
148 Ga0207682_10028779 3300025893 Bacteria 2219
149 Ga0207710_10083029 3300025900 Unclassified 1489
150 Ga0207645_10148663 3300025907 Bacteria 1528
151 Ga0207643_10038123 3300025908 Bacteria 2699
152 Ga0207705_10201881 3300025909 Bacteria 1506
153 Ga0207654_10062446 3300025911 Bacteria 2183
154 Ga0207654_10117860 3300025911 Unclassified 1662
155 Ga0207654_10212752 3300025911 Unclassified 1278
156 Ga0207707_10005548 3300025912 Bacteria 11034
157 Ga0207671_10073431 3300025914 Bacteria 2555
158 Ga0207660_10137985 3300025917 Bacteria 1862
159 Ga0207660_10483090 3300025917 Bacteria 1004
160 Ga0207657_10020528 3300025919 Bacteria 6240
161 Ga0207652_10145805 3300025921 Bacteria 2119
162 Ga0207652_10466787 3300025921 Bacteria 1137
163 Ga0207650_10123870 3300025925 Bacteria 2015
164 Ga0207650_10156332 3300025925 Bacteria 1803
165 Ga0207644_10028023 3300025931 Bacteria 3895
166 Ga0207644_10213870 3300025931 Bacteria 1525
167 Ga0207644_10543810 3300025931 Bacteria 961
168 Ga0207690_10035757 3300025932 Bacteria 3211
169 Ga0207706_10033321 3300025933 Bacteria 4587
170 Ga0207686_10096476 3300025934 Unclassified 1965
171 Ga0207670_10197351 3300025936 Unclassified 1527
172 Ga0207670_10222266 3300025936 Bacteria 1446
173 Ga0207669_10246330 3300025937 Bacteria 1328
174 Ga0207691_10036504 3300025940 Bacteria 4554
175 Ga0207689_10094019 3300025942 Bacteria 2462
176 Ga0207661_10586366 3300025944 Bacteria 1023
177 Ga0207679_10243565 3300025945 Unclassified 1525
178 Ga0207679_10347200 3300025945 Bacteria 1292
179 Ga0207667_10307272 3300025949 Bacteria 1620
180 Ga0207667_10518848 3300025949 Unclassified 1207
181 Ga0207712_10026677 3300025961 Bacteria 3852
182 Ga0207712_10220912 3300025961 Bacteria 1515
183 Ga0207712_10322153 3300025961 Bacteria 1276
184 Ga0207668_10342115 3300025972 Unclassified 1248
185 Ga0207640_10028895 3300025981 Bacteria 3396
186 Ga0207640_10224296 3300025981 Unclassified 1441
187 Ga0207640_10383874 3300025981 Bacteria 1139
188 Ga0207677_10035668 3300026023 Unclassified 3233
189 Ga0207703_10036464 3300026035 Bacteria 3914
190 Ga0207703_10056533 3300026035 Unclassified 3196
191 Ga0207703_10067905 3300026035 Unclassified 2936
192 Ga0207703_10219283 3300026035 Unclassified 1700
193 Ga0207639_10028727 3300026041 Bacteria 4063
194 Ga0207639_10074131 3300026041 Bacteria 2671
195 Ga0207639_10373854 3300026041 Unclassified 1278
196 Ga0207678_10710433 3300026067 Unclassified 885
197 Ga0207702_10371038 3300026078 Bacteria 1374
198 Ga0207702_11110309 3300026078 Bacteria 785
199 Ga0207641_10036278 3300026088 Bacteria 4114
200 Ga0207676_10264897 3300026095 Bacteria 1553
201 Ga0207676_10388400 3300026095 Bacteria 1301
202 Ga0207674_10012024 3300026116 Bacteria 9697
203 Ga0207674_10536367 3300026116 Unclassified 1130
204 Ga0207675_100300831 3300026118 Bacteria 1562
205 Ga0207683_10152468 3300026121 Bacteria 2086
206 Ga0207683_10840475 3300026121 Unclassified 852
207 Ga0207698_10170106 3300026142 Bacteria 1917
208 Ga0207698_10262188 3300026142 Unclassified 1588
209 Ga0268266_10200693 3300028379 Bacteria 1825
210 Ga0268265_10083378 3300028380 Bacteria 2531
211 Ga0268265_10154200 3300028380 Bacteria 1941
212 Ga0268265_10280770 3300028380 Bacteria 1490
213 Ga0268264_10075160 3300028381 Bacteria 2872
214 Ga0268264_10105760 3300028381 Bacteria 2455
215 Ga0268264_10258725 3300028381 Unclassified 1620
216 Ga0307408_100064747 3300031548 Unclassified 2679
217 Ga0307408_100109368 3300031548 Bacteria 2120
218 Ga0307408_100271821 3300031548 Bacteria 1407
219 Ga0307405_10033145 3300031731 Bacteria 3060
220 Ga0307405_10041147 3300031731 Bacteria 2803
221 Ga0307405_10056144 3300031731 Bacteria 2468
222 Ga0307405_10095704 3300031731 Bacteria 1978
223 Ga0307405_10145847 3300031731 Bacteria 1658
224 Ga0307405_10226987 3300031731 Bacteria 1374
225 Ga0307405_10488972 3300031731 Bacteria 984
226 Ga0307413_10003726 3300031824 Bacteria 6482
227 Ga0307413_10006046 3300031824 Bacteria 5482
228 Ga0307413_10019905 3300031824 Bacteria 3558
229 Ga0307413_10050934 3300031824 Bacteria 2492
230 Ga0307413_10061508 3300031824 Bacteria 2317
231 Ga0307413_10146632 3300031824 Bacteria 1639
232 Ga0307410_10000474 3300031852 Bacteria 16263
233 Ga0307410_10003936 3300031852 Bacteria 7560
234 Ga0307410_10118522 3300031852 Bacteria 1926
235 Ga0307410_10139321 3300031852 Bacteria 1792
236 Ga0307410_10146472 3300031852 Bacteria 1753
237 Ga0307410_10166685 3300031852 Bacteria 1656
238 Ga0307410_10544944 3300031852 Unclassified 961
239 Ga0307406_10002954 3300031901 Bacteria 9266
240 Ga0307406_10019114 3300031901 Bacteria 4018
241 Ga0307406_10030164 3300031901 Bacteria 3290
242 Ga0307406_10084486 3300031901 Bacteria 2120
243 Ga0307406_10090586 3300031901 Bacteria 2058
244 Ga0307406_10763531 3300031901 Unclassified 813
245 Ga0307407_10005688 3300031903 Bacteria 5443
246 Ga0307407_10045579 3300031903 Bacteria 2478
247 Ga0307407_10047396 3300031903 Bacteria 2439
248 Ga0307407_10080258 3300031903 Bacteria 1971
249 Ga0307407_10089118 3300031903 Bacteria 1886
250 Ga0307407_10251838 3300031903 Bacteria 1210
251 Ga0307407_10389115 3300031903 Unclassified 997
252 Ga0307412_10012589 3300031911 Bacteria 4936
253 Ga0307412_10060354 3300031911 Bacteria 2545
254 Ga0307412_10086595 3300031911 Bacteria 2181
255 Ga0307409_100015793 3300031995 Bacteria 4970
256 Ga0307409_100149819 3300031995 Bacteria 2023
257 Ga0307409_100175899 3300031995 Bacteria 1889
258 Ga0307409_100266544 3300031995 Bacteria 1575
259 Ga0307409_100280142 3300031995 Bacteria 1541
260 Ga0307409_100576818 3300031995 Bacteria 1108
261 Ga0307416_100067533 3300032002 Bacteria 2950
262 Ga0307416_100135795 3300032002 Bacteria 2224
263 Ga0307416_100178701 3300032002 Bacteria 1986
264 Ga0307416_100453261 3300032002 Unclassified 1336
265 Ga0307416_100478362 3300032002 Unclassified 1305
266 Ga0307416_100950245 3300032002 Bacteria 961
267 Ga0307414_10009040 3300032004 Bacteria 5700
268 Ga0307414_10021870 3300032004 Bacteria 4025
269 Ga0307411_10015167 3300032005 Bacteria 4318
270 Ga0307411_10018059 3300032005 Bacteria 4038
271 Ga0307411_10116649 3300032005 Bacteria 1922
272 Ga0307411_10143383 3300032005 Bacteria 1764
273 Ga0307411_10172187 3300032005 Bacteria 1634
274 Ga0307411_10179661 3300032005 Unclassified 1605
275 Ga0307415_100004076 3300032126 Bacteria 7539
276 Ga0307415_100030771 3300032126 Bacteria 3449
277 Ga0307415_100142822 3300032126 Bacteria 1831
278 Ga0307415_100207005 3300032126 Unclassified 1562
279 Ga0307415_100208365 3300032126 Bacteria 1557
280 Ga0307415_100260586 3300032126 Bacteria 1414
281 Ga0307415_100626251 3300032126 Bacteria 961
282 Ga0373937_0298044 3300036401 Bacteria 1524
283 Ga0373937_0395585 3300036401 Bacteria 1311
284 Ga0436363_1213062 3300039450 Unclassified 986
285 Ga0439465_0067054 3300041413 Bacteria 1197
286 Ga0451791_1076542 3300041451 Unclassified 1011
287 Ga0451837_0099871 3300041494 Bacteria 1569
288 Ga0451849_0831745 3300041505 Unclassified 2660
289 Ga0451853_0208120 3300041512 Bacteria 1401
290 Ga0439432_044186 3300042006 Bacteria 1404
291 Ga0495598_0008852 3300046537 Bacteria 2356
292 Ga0495621_0093356 3300046539 Bacteria 1137
293 Ga0495668_0000716 3300046616 Bacteria 39924
294 Ga0495658_0062237 3300046683 Bacteria 2145
295 Ga0496104_0409343 3300048907 Bacteria 1269
296 Ga0496105_0142574 3300048908 Unclassified 1972
297 Ga0496113_0284452 3300048916 Bacteria 1323
298 Ga0501074_0119564 3300049590 Unclassified 1884
299 Ga0501202_047274 3300049652 Bacteria 945
300 Ga0501235_017690 3300049669 Unclassified 1578
301 Ga0501248_008861 3300049678 Bacteria 867
302 Ga0501249_008598 3300049679 Bacteria 2119
303 Ga0501221_014501 3300049704 Bacteria 1466
304 Ga0501225_0100430 3300049705 Bacteria 845
305 Ga0501225_0131468 3300049705 Unclassified 750
306 Ga0501263_003583 3300049760 Bacteria 1666
307 Ga0501268_000236 3300049765 Bacteria 5525
308 Ga0501270_014339 3300049767 Bacteria 1114
309 Ga0501270_022638 3300049767 Bacteria 972
310 nmdc:mga05p37_795983_c1 3300050507 Bacteria 1035
311 nmdc:mga08y16_46548_c1 3300050511 Unclassified 4541
312 Ga0495619_0060386 3300053085 Unclassified 2520
313 Ga0157372_10189784
314 LJQas_1001756
315 rootL2_10035202
316 Ga0065707_10343539
317 Ga0070658_10131776
318 Ga0070683_100054624
319 Ga0070690_100008274
320 Ga0070670_100011780
321 Ga0070670_100145309
322 Ga0070670_100147237
323 Ga0070670_100270153
324 Ga0070677_10011561
325 Ga0068869_100139112
326 Ga0068869_100653705
327 Ga0070666_10223735
328 Ga0070666_10452732
329 Ga0070680_100153355
330 Ga0070680_100453850
331 Ga0070682_100212764
332 Ga0068868_100036682
333 Ga0070660_100133525
334 Ga0070689_100012418
335 Ga0070689_100051364
336 Ga0070689_100279920
337 Ga0070661_100082336
338 Ga0070661_100198995
339 Ga0070668_100067477
340 Ga0070671_100010510
341 Ga0070671_100085514
342 Ga0070671_100264547
343 Ga0070674_100218239
344 Ga0070673_100217369
345 Ga0070688_100014117
346 Ga0070659_100038640
347 Ga0070667_100054597
348 Ga0070678_100234878
349 Ga0070662_100024883
350 Ga0070681_10032308
351 Ga0070681_10037356
352 Ga0068867_100576516
353 Ga0070685_10012677
354 Ga0070679_100179336
355 Ga0068853_100066831
356 Ga0068853_100077366
357 Ga0068853_100155993
358 Ga0068853_100214248
359 Ga0070672_100211751
360 Ga0070672_101026091
361 Ga0070693_100121883
362 Ga0070665_100039919
363 Ga0068855_100571940
364 Ga0068855_100692810
365 Ga0070664_100006426
366 Ga0070664_100060787
367 Ga0068857_100012294
368 Ga0068857_100444325
369 Ga0068857_100510206
370 Ga0068857_100994838
371 Ga0068857_101046545
372 Ga0068854_100345118
373 Ga0068854_100736967
374 Ga0068856_100297227
375 Ga0068856_101366176
376 Ga0070702_100028202
377 Ga0068852_100096154
378 Ga0068852_100159081
379 Ga0068852_100186358
380 Ga0068852_100488094
381 Ga0068852_100844405
382 Ga0068859_100019828
383 Ga0068859_100022483
384 Ga0068864_100011134
385 Ga0068864_100059322
386 Ga0068864_100223570
387 Ga0068866_10052402
388 Ga0068851_10062538
389 Ga0068870_10028640
390 Ga0068863_100017689
391 Ga0068863_100927137
392 Ga0068858_100028445
393 Ga0068858_100120339
394 Ga0068858_100130640
395 Ga0068858_100320767
396 Ga0068860_100051608
397 Ga0068860_100106138
398 Ga0068862_100264559
399 Ga0068862_100395549
400 Ga0068862_100425735
401 Ga0068862_100600717
402 Ga0068871_100141570
403 Ga0097620_100019828
404 Ga0097620_100022484
405 Ga0105240_10050087
406 Ga0105240_10316398
407 Ga0111539_10033755
408 Ga0111539_10423164
409 Ga0111539_10624908
410 Ga0105247_10034541
411 Ga0105247_10038200
412 Ga0105247_10258236
413 Ga0114129_10576900
414 Ga0105243_10036433
415 Ga0105241_10049910
416 Ga0105241_10254031
417 Ga0105241_10282082
418 Ga0105241_10355860
419 Ga0105242_10115257
420 Ga0105248_10598016
421 Ga0105237_10076548
422 Ga0105249_10011866
423 Ga0105249_10171007
424 Ga0105249_10234413
425 Ga0105249_10409081
426 Ga0105239_10097399
427 Ga0105239_10125261
428 Ga0105239_10568294
429 Ga0157373_10066882
430 Ga0157373_10082817
431 Ga0157373_10430370
432 Ga0157370_10173572
433 Ga0157370_10187770
434 Ga0157369_10102184
435 Ga0157369_10246103
436 Ga0157369_10466785
437 Ga0157374_10205984
438 Ga0157378_10117564
439 Ga0163162_10073618
440 Ga0163162_10115273
441 Ga0163162_10223108
442 Ga0163162_10250049
443 Ga0157372_10091838
444 Ga0157372_10137132
445 Ga0157372_10567388
446 Ga0157375_10013576
447 Ga0157375_10141029
448 Ga0157375_10165215
449 Ga0157375_10351254
450 Ga0163163_10076218
451 Ga0163163_10320060
452 Ga0163163_10532811
453 Ga0163163_10558700
454 Ga0157380_10089751
455 Ga0157377_10076350
456 Ga0157379_10720646
457 Ga0157376_10161430
458 Ga0163161_10010702
459 Ga0163161_10144753
460 Ga0207682_10028779
461 Ga0207710_10083029
462 Ga0207645_10148663
463 Ga0207643_10038123
464 Ga0207705_10201881
465 Ga0207654_10062446
466 Ga0207654_10117860
467 Ga0207654_10212752
468 Ga0207707_10005548
469 Ga0207671_10073431
470 Ga0207660_10137985
471 Ga0207660_10483090
472 Ga0207657_10020528
473 Ga0207652_10145805
474 Ga0207652_10466787
475 Ga0207650_10123870
476 Ga0207650_10156332
477 Ga0207644_10028023
478 Ga0207644_10213870
479 Ga0207644_10543810
480 Ga0207690_10035757
481 Ga0207706_10033321
482 Ga0207686_10096476
483 Ga0207670_10197351
484 Ga0207670_10222266
485 Ga0207669_10246330
486 Ga0207691_10036504
487 Ga0207689_10094019
488 Ga0207661_10586366
489 Ga0207679_10243565
490 Ga0207679_10347200
491 Ga0207667_10307272
492 Ga0207667_10518848
493 Ga0207712_10026677
494 Ga0207712_10220912
495 Ga0207712_10322153
496 Ga0207668_10342115
497 Ga0207640_10028895
498 Ga0207640_10224296
499 Ga0207640_10383874
500 Ga0207677_10035668
501 Ga0207703_10036464
502 Ga0207703_10056533
503 Ga0207703_10067905
504 Ga0207703_10219283
505 Ga0207639_10028727
506 Ga0207639_10074131
507 Ga0207639_10373854
508 Ga0207678_10710433
509 Ga0207702_10371038
510 Ga0207702_11110309
511 Ga0207641_10036278
512 Ga0207676_10264897
513 Ga0207676_10388400
514 Ga0207674_10012024
515 Ga0207674_10536367
516 Ga0207675_100300831
517 Ga0207683_10152468
518 Ga0207683_10840475
519 Ga0207698_10170106
520 Ga0207698_10262188
521 Ga0268266_10200693
522 Ga0268265_10083378
523 Ga0268265_10154200
524 Ga0268265_10280770
525 Ga0268264_10075160
526 Ga0268264_10105760
527 Ga0268264_10258725
528 Ga0307408_100064747
529 Ga0307408_100109368
530 Ga0307408_100271821
531 Ga0307405_10033145
532 Ga0307405_10041147
533 Ga0307405_10056144
534 Ga0307405_10095704
535 Ga0307405_10145847
536 Ga0307405_10226987
537 Ga0307405_10488972
538 Ga0307413_10003726
539 Ga0307413_10006046
540 Ga0307413_10019905
541 Ga0307413_10050934
542 Ga0307413_10061508
543 Ga0307413_10146632
544 Ga0307410_10000474
545 Ga0307410_10003936
546 Ga0307410_10118522
547 Ga0307410_10139321
548 Ga0307410_10146472
549 Ga0307410_10166685
550 Ga0307410_10544944
551 Ga0307406_10002954
552 Ga0307406_10019114
553 Ga0307406_10030164
554 Ga0307406_10084486
555 Ga0307406_10090586
556 Ga0307406_10763531
557 Ga0307407_10005688
558 Ga0307407_10045579
559 Ga0307407_10047396
560 Ga0307407_10080258
561 Ga0307407_10089118
562 Ga0307407_10251838
563 Ga0307407_10389115
564 Ga0307412_10012589
565 Ga0307412_10060354
566 Ga0307412_10086595
567 Ga0307409_100015793
568 Ga0307409_100149819
569 Ga0307409_100175899
570 Ga0307409_100266544
571 Ga0307409_100280142
572 Ga0307409_100576818
573 Ga0307416_100067533
574 Ga0307416_100135795
575 Ga0307416_100178701
576 Ga0307416_100453261
577 Ga0307416_100478362
578 Ga0307416_100950245
579 Ga0307414_10009040
580 Ga0307414_10021870
581 Ga0307411_10015167
582 Ga0307411_10018059
583 Ga0307411_10116649
584 Ga0307411_10143383
585 Ga0307411_10172187
586 Ga0307411_10179661
587 Ga0307415_100004076
588 Ga0307415_100030771
589 Ga0307415_100142822
590 Ga0307415_100207005
591 Ga0307415_100208365
592 Ga0307415_100260586
593 Ga0307415_100626251
594 Ga0373937_0298044
595 Ga0373937_0395585
596 Ga0436363_1213062
597 Ga0439465_0067054
598 Ga0451791_1076542
599 Ga0451837_0099871
600 Ga0451849_0831745
601 Ga0451853_0208120
602 Ga0439432_044186
603 Ga0495598_0008852
604 Ga0495621_0093356
605 Ga0495668_0000716
606 Ga0495658_0062237
607 Ga0496104_0409343
608 Ga0496105_0142574
609 Ga0496113_0284452
610 Ga0501074_0119564
611 Ga0501202_047274
612 Ga0501235_017690
613 Ga0501248_008861
614 Ga0501249_008598
615 Ga0501221_014501
616 Ga0501225_0100430
617 Ga0501225_0131468
618 Ga0501263_003583
619 Ga0501268_000236
620 Ga0501270_014339
621 Ga0501270_022638
622 nmdc:mga05p37_795983_c1
623 nmdc:mga08y16_46548_c1
624 Ga0495619_0060386

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

54

154

0.97

PF08242

Methyltransf_12

Methyltransferase domain

54

152

0.94

PF13649

Methyltransf_25

Methyltransferase domain

53

150

0.94

PF13847

Methyltransf_31

Methyltransferase domain

47

200

0.85

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

7

178

0.79

PF13489

Methyltransf_23

Methyltransferase domain

29

187

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mgg-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina mazei 0.8963 45 158
7v6h-assembly2.cif.gz_B crystal structure of the spnl 0.8358 33 194
4krh-assembly2.cif.gz_B semet haemonchus contortus phosphoethanolamine n-methyltransferase 2 in complex with s-adenosyl-l-methionine 0.8165 33 196
3vc1-assembly11.cif.gz_K crystal structure of geranyl diphosphate c-methyltransferase from streptomyces coelicolor a3(2) in complex with mg2+, geranyl-s-thiolodiphosphate, and s-adenosyl-l-homocysteine 0.7987 33 214
3ujc-assembly1.cif.gz_A phosphoethanolamine methyltransferase mutant (h132a) from plasmodium falciparum in complex with phosphocholine 0.7974 33 195
ID Description Score Start End Superfamily
af_A0A0P0Y1E1_35_188_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8512 32 152 3.40.50.150
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8401 36 156 3.40.50.150
af_P30866_6_206_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8396 75 194 3.40.50.150
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8253 34 160 3.40.50.150
af_A0A0N7KI91_1_189_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8159 36 192 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7V9GEA1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9435 29 214 GO:0008757
GO:0032259
AF-A0A7V9GEA1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9338 29 214 GO:0008757
GO:0032259
AF-A0A7V9SME7-F1-model_v4 Class I SAM-dependent methyltransferase 0.9126 69 214 GO:0008757
GO:0032259
AF-A0A7V9SME7-F1-model_v4 Class I SAM-dependent methyltransferase 0.9067 69 214 GO:0008757
GO:0032259
AF-A0A0A1TQX2-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.8665 46 160 GO:0008757
GO:0032259

Map