F401602

General Info

Members Datasets Scaffolds Average Seq Length
312 191 624 647

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100092472|Ga0070698_1000924722
Length 714
Sequence MWTIRTPLRLLVATATVLPLALHRAGPGDWPAYGGDAGGSRFSPLTQVHRGNVAALRVAWTFHTGEARRGGMLHHASFEATPLVVDGTMYLSTPGGLVIALAPESGRMRWRFDARVDSTTHFGDYVSRGVSTWLDPAAAPGSACRRRILVATVDARLIALDGGTGLPCAGFGTRGTVDLRQGLRNPPAFAGEYEETSPPAVVRGLVIVGSGVADNSRTDAASGEVRAFDARSGALVWTWDPVPQSPDDAAYSTWRGPEAHRTGAANAWSVIAADSARGLVFVPTGSPSVDYFGGGRLGDNRYANSIVALRATTGQVVWQFQTVHHDLWDYDNASPPALVTVRRGGRAIPAVLQATKTGMLFVLDRETGRPIFPVEERPVPRSTVPGEEAAATQPFSTLPLLSPHRFLPDSAFGVSPERRAACRAHVAALRNEGAFTPPSLEGTLALPSNIGGAQWGGVAYDSSRGIVVVPVNRVAAEVRLVDTAGLRMDTLDMSESRIGENWTRMHGTPYVMHRMLLFGPDNVPCTPPPFGTLVAIQLGSGRKLWEVPLGDMSGLAKLPALSGMGSPNLGGPIATAGGLVFIAATVDRQLRAFDIETGREVWSAPLPAGGKATPMTYLGADGRQYVAIAAGGDGGGFGRDDALVAFALPSDGASASPQSRRVPVQRRVLRWPGEGVPQVGGGMAGPVRVPQVGPSQHDEIGAARRQDGVDVGGR

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
173 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
174 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 10.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100092472 3300005471 Bacteria 3005
2 Ga0065707_10002159 3300005295 Bacteria 4932
3 Ga0070658_10002065 3300005327 Bacteria 16840
4 Ga0070683_100004673 3300005329 Bacteria 11313
5 Ga0070683_100005404 3300005329 Bacteria 10664
6 Ga0070683_100015158 3300005329 Bacteria 6766
7 Ga0070683_100143209 3300005329 Bacteria 2264
8 Ga0070690_100041910 3300005330 Bacteria 2899
9 Ga0070670_100017186 3300005331 Bacteria 6205
10 Ga0070670_100021775 3300005331 Bacteria 5512
11 Ga0070670_100028827 3300005331 Unclassified 4779
12 Ga0068869_100001222 3300005334 Bacteria 15106
13 Ga0068869_100002829 3300005334 Bacteria 10516
14 Ga0070666_10073194 3300005335 Unclassified 2334
15 Ga0070680_100026862 3300005336 Bacteria 4605
16 Ga0070680_100060723 3300005336 Bacteria 3093
17 Ga0070689_100021050 3300005340 Unclassified 4848
18 Ga0070661_100003229 3300005344 Bacteria 11234
19 Ga0070661_100010013 3300005344 Bacteria 6580
20 Ga0070661_100010333 3300005344 Bacteria 6489
21 Ga0070692_10000669 3300005345 Bacteria 10936
22 Ga0070668_100005955 3300005347 Bacteria 9041
23 Ga0070668_100011894 3300005347 Bacteria 6479
24 Ga0070669_100015967 3300005353 Bacteria 5357
25 Ga0070675_100004146 3300005354 Bacteria 11009
26 Ga0070675_100010409 3300005354 Bacteria 7265
27 Ga0070675_100026726 3300005354 Bacteria 4631
28 Ga0070675_100032980 3300005354 Bacteria 4195
29 Ga0070673_100007715 3300005364 Bacteria 7122
30 Ga0070659_100003353 3300005366 Bacteria 11396
31 Ga0070659_100030812 3300005366 Unclassified 4151
32 Ga0070703_10000108 3300005406 Bacteria 42921
33 Ga0070709_10073106 3300005434 Bacteria 2219
34 Ga0070711_100000029 3300005439 Bacteria 101028
35 Ga0070705_100037855 3300005440 Bacteria 2724
36 Ga0070694_100009971 3300005444 Bacteria 5838
37 Ga0070708_100000290 3300005445 Bacteria 37791
38 Ga0070708_100050721 3300005445 Bacteria 3675
39 Ga0070681_10001593 3300005458 Bacteria 20182
40 Ga0070681_10033048 3300005458 Bacteria 5192
41 Ga0070706_100004469 3300005467 Bacteria 13496
42 Ga0070706_100033948 3300005467 Bacteria 4710
43 Ga0070706_100101864 3300005467 Bacteria 2669
44 Ga0070706_100130769 3300005467 Bacteria 2342
45 Ga0070707_100023967 3300005468 Bacteria 5774
46 Ga0070698_100000042 3300005471 Bacteria 89194
47 Ga0070698_100006717 3300005471 Bacteria 12478
48 Ga0070698_100046098 3300005471 Bacteria 4458
49 Ga0070698_100153173 3300005471 Bacteria 2252
50 Ga0070699_100029041 3300005518 Bacteria 4768
51 Ga0070699_100033891 3300005518 Bacteria 4412
52 Ga0070699_100041256 3300005518 Bacteria 3995
53 Ga0070679_100001017 3300005530 Bacteria 24457
54 Ga0070679_100022643 3300005530 Bacteria 6143
55 Ga0070679_100157981 3300005530 Bacteria 2242
56 Ga0070697_100044665 3300005536 Bacteria 3589
57 Ga0070672_100006476 3300005543 Bacteria 7874
58 Ga0070672_100022627 3300005543 Bacteria 4621
59 Ga0070695_100009941 3300005545 Bacteria 5671
60 Ga0070695_100011074 3300005545 Bacteria 5391
61 Ga0070695_100017110 3300005545 Bacteria 4397
62 Ga0070696_100019375 3300005546 Unclassified 4608
63 Ga0070693_100018414 3300005547 Bacteria 3647
64 Ga0068855_100102953 3300005563 Unclassified 3286
65 Ga0068855_100208578 3300005563 Unclassified 2197
66 Ga0070664_100003817 3300005564 Bacteria 12161
67 Ga0070664_100012380 3300005564 Bacteria 6933
68 Ga0068857_100009077 3300005577 Bacteria 8625
69 Ga0068857_100041518 3300005577 Unclassified 4079
70 Ga0068857_100041725 3300005577 Unclassified 4068
71 Ga0070702_100003154 3300005615 Bacteria 7306
72 Ga0068852_100017154 3300005616 Bacteria 5673
73 Ga0068859_100002694 3300005617 Bacteria 18037
74 Ga0068859_100004596 3300005617 Bacteria 14079
75 Ga0068859_100033748 3300005617 Bacteria 5138
76 Ga0068864_100008837 3300005618 Bacteria 8306
77 Ga0068864_100010189 3300005618 Bacteria 7759
78 Ga0068861_100093454 3300005719 Bacteria 2378
79 Ga0068863_100006305 3300005841 Bacteria 11640
80 Ga0068863_100016856 3300005841 Bacteria 7006
81 Ga0068860_100011532 3300005843 Bacteria 8711
82 Ga0068860_100030933 3300005843 Bacteria 5147
83 Ga0068862_100001273 3300005844 Bacteria 23646
84 Ga0068862_100005389 3300005844 Bacteria 10701
85 Ga0068862_100069601 3300005844 Bacteria 3037
86 Ga0081455_10000294 3300005937 Bacteria 66269
87 Ga0081455_10091688 3300005937 Bacteria 2460
88 Ga0097621_100018825 3300006237 Bacteria 5285
89 Ga0075428_100000007 3300006844 Bacteria 273226
90 Ga0075428_100031856 3300006844 Bacteria 5825
91 Ga0075428_100042490 3300006844 Bacteria 4998
92 Ga0075428_100053232 3300006844 Bacteria 4434
93 Ga0075428_100073014 3300006844 Bacteria 3747
94 Ga0075430_100052365 3300006846 Bacteria 3438
95 Ga0075430_100091749 3300006846 Bacteria 2540
96 Ga0075431_100010628 3300006847 Bacteria 9254
97 Ga0075431_100016607 3300006847 Bacteria 7472
98 Ga0075431_100081183 3300006847 Unclassified 3348
99 Ga0075433_10022464 3300006852 Bacteria 5295
100 Ga0075434_100001880 3300006871 Bacteria 18178
101 Ga0075434_100003187 3300006871 Bacteria 14636
102 Ga0075434_100029518 3300006871 Bacteria 5396
103 Ga0075429_100014204 3300006880 Bacteria 6903
104 Ga0075436_100015555 3300006914 Bacteria 5208
105 Ga0075436_100018339 3300006914 Bacteria 4791
106 Ga0075436_100027033 3300006914 Unclassified 3951
107 Ga0097620_100002694 3300006931 Bacteria 18037
108 Ga0097620_100004596 3300006931 Bacteria 14079
109 Ga0097620_100033748 3300006931 Bacteria 5138
110 Ga0111539_10000009 3300009094 Bacteria 375223
111 Ga0111539_10000880 3300009094 Bacteria 39227
112 Ga0111539_10047480 3300009094 Bacteria 5131
113 Ga0111539_10105392 3300009094 Unclassified 3308
114 Ga0114129_10019646 3300009147 Bacteria 9617
115 Ga0114129_10051296 3300009147 Bacteria 5793
116 Ga0114129_10166598 3300009147 Bacteria 3007
117 Ga0105243_10041380 3300009148 Bacteria 3604
118 Ga0105241_10061336 3300009174 Bacteria 2895
119 Ga0105248_10004027 3300009177 Bacteria 16254
120 Ga0105248_10004212 3300009177 Bacteria 15909
121 Ga0105248_10034999 3300009177 Bacteria 5619
122 Ga0105248_10063277 3300009177 Bacteria 4153
123 Ga0105249_10001362 3300009553 Bacteria 21360
124 Ga0105249_10048515 3300009553 Unclassified 3871
125 Ga0105239_10033411 3300010375 Bacteria 5650
126 Ga0105239_10074116 3300010375 Bacteria 3743
127 Ga0157371_10007650 3300013102 Bacteria 8711
128 Ga0157371_10014085 3300013102 Bacteria 6049
129 Ga0157369_10001366 3300013105 Bacteria 30083
130 Ga0157374_10009776 3300013296 Bacteria 8238
131 Ga0157374_10032241 3300013296 Bacteria 4769
132 Ga0163162_10061352 3300013306 Unclassified 3797
133 Ga0157372_10009861 3300013307 Bacteria 10157
134 Ga0157372_10021651 3300013307 Bacteria 6949
135 Ga0157372_10030033 3300013307 Bacteria 5943
136 Ga0157375_10002365 3300013308 Bacteria 16303
137 Ga0157375_10261336 3300013308 Bacteria 1893
138 Ga0163163_10012713 3300014325 Bacteria 7679
139 Ga0157380_10010671 3300014326 Bacteria 6616
140 Ga0157377_10002442 3300014745 Bacteria 8211
141 Ga0157379_10002452 3300014968 Bacteria 15542
142 Ga0157376_10056598 3300014969 Unclassified 3277
143 Ga0163161_10007314 3300017792 Bacteria 7619
144 Ga0207653_10000005 3300025885 Bacteria 257928
145 Ga0207680_10030675 3300025903 Unclassified 3036
146 Ga0207645_10002421 3300025907 Bacteria 14693
147 Ga0207705_10001310 3300025909 Bacteria 19962
148 Ga0207684_10003259 3300025910 Bacteria 15925
149 Ga0207707_10056157 3300025912 Bacteria 3425
150 Ga0207663_10000121 3300025916 Bacteria 38099
151 Ga0207660_10012651 3300025917 Bacteria 5527
152 Ga0207660_10021761 3300025917 Bacteria 4315
153 Ga0207657_10014933 3300025919 Bacteria 7547
154 Ga0207657_10025097 3300025919 Bacteria 5504
155 Ga0207657_10026334 3300025919 Bacteria 5345
156 Ga0207652_10012981 3300025921 Bacteria 6741
157 Ga0207652_10042238 3300025921 Bacteria 3879
158 Ga0207646_10001414 3300025922 Bacteria 29802
159 Ga0207646_10032232 3300025922 Bacteria 4742
160 Ga0207681_10001046 3300025923 Bacteria 17950
161 Ga0207681_10047276 3300025923 Bacteria 2898
162 Ga0207650_10046231 3300025925 Bacteria 3205
163 Ga0207650_10069888 3300025925 Unclassified 2638
164 Ga0207650_10080086 3300025925 Unclassified 2475
165 Ga0207659_10014517 3300025926 Bacteria 5083
166 Ga0207659_10050717 3300025926 Bacteria 2949
167 Ga0207690_10037947 3300025932 Bacteria 3131
168 Ga0207690_10064649 3300025932 Bacteria 2499
169 Ga0207706_10000603 3300025933 Bacteria 38228
170 Ga0207706_10026180 3300025933 Bacteria 5221
171 Ga0207670_10011271 3300025936 Bacteria 5182
172 Ga0207704_10012009 3300025938 Unclassified 4285
173 Ga0207691_10000423 3300025940 Bacteria 42013
174 Ga0207691_10045350 3300025940 Bacteria 4042
175 Ga0207711_10029237 3300025941 Bacteria 4646
176 Ga0207689_10003703 3300025942 Bacteria 13941
177 Ga0207689_10076967 3300025942 Bacteria 2743
178 Ga0207661_10046266 3300025944 Unclassified 3450
179 Ga0207679_10001263 3300025945 Bacteria 16032
180 Ga0207679_10107432 3300025945 Bacteria 2196
181 Ga0207667_10076261 3300025949 Unclassified 3479
182 Ga0207651_10003890 3300025960 Bacteria 7412
183 Ga0207712_10000300 3300025961 Bacteria 46213
184 Ga0207712_10020085 3300025961 Unclassified 4371
185 Ga0207712_10023186 3300025961 Unclassified 4094
186 Ga0207668_10016713 3300025972 Bacteria 4585
187 Ga0207658_10043080 3300025986 Unclassified 3279
188 Ga0207702_10002071 3300026078 Bacteria 19406
189 Ga0207641_10007621 3300026088 Bacteria 9001
190 Ga0207676_10005787 3300026095 Bacteria 8741
191 Ga0207676_10054428 3300026095 Unclassified 3136
192 Ga0207674_10000353 3300026116 Bacteria 59263
193 Ga0207674_10000774 3300026116 Bacteria 41719
194 Ga0207674_10004247 3300026116 Bacteria 17277
195 Ga0207675_100009490 3300026118 Bacteria 9106
196 Ga0207698_10023059 3300026142 Bacteria 4342
197 Ga0207698_10080702 3300026142 Bacteria 2622
198 Ga0209588_1000173 3300027671 Bacteria 18123
199 Ga0209966_1001827 3300027695 Unclassified 3603
200 Ga0207428_10000022 3300027907 Bacteria 273333
201 Ga0207428_10000563 3300027907 Bacteria 43835
202 Ga0207428_10063780 3300027907 Bacteria 2910
203 Ga0268265_10004612 3300028380 Bacteria 9525
204 Ga0265332_10007774 3300031238 Bacteria 4841
205 Ga0307408_100004048 3300031548 Bacteria 9997
206 Ga0373934_0000250 3300035086 Bacteria 19303
207 Ga0373923_0006007 3300035111 Bacteria 4164
208 Ga0373953_0009201 3300035117 Bacteria 3386
209 Ga0373954_0032009 3300035118 Unclassified 2430
210 Ga0373956_0007105 3300035119 Bacteria 4505
211 Ga0373957_0000849 3300035120 Bacteria 8002
212 Ga0373955_0001167 3300035172 Bacteria 11154
213 Ga0373933_0001424 3300035724 Bacteria 14033
214 Ga0373937_0000486 3300036401 Bacteria 36276
215 Ga0395905_0146096 3300037471 Bacteria 2225
216 Ga0453683_0002711 3300044673 Bacteria 13514
217 Ga0451576_0007927 3300045051 Bacteria 12567
218 Ga0451576_0091848 3300045051 Bacteria 3157
219 Ga0466967_0018875 3300045976 Bacteria 5529
220 Ga0495592_0000545 3300046454 Bacteria 26864
221 Ga0495629_0002424 3300046459 Bacteria 14328
222 Ga0495629_0020261 3300046459 Bacteria 4749
223 Ga0495651_0004476 3300046462 Bacteria 10701
224 Ga0495653_0000177 3300046463 Bacteria 52704
225 Ga0495594_0004770 3300046499 Bacteria 6983
226 Ga0495608_0000700 3300046511 Bacteria 23284
227 Ga0495628_0001071 3300046516 Bacteria 25095
228 Ga0495630_0000715 3300046517 Bacteria 23478
229 Ga0495652_0000413 3300046529 Bacteria 49775
230 Ga0495587_0000324 3300046536 Bacteria 34041
231 Ga0495645_0002946 3300046543 Bacteria 11532
232 Ga0495667_0001635 3300046559 Bacteria 14837
233 Ga0495635_0000437 3300046663 Bacteria 26340
234 Ga0495657_0000208 3300046675 Bacteria 52718
235 Ga0495599_0000816 3300046678 Bacteria 17521
236 Ga0495623_0000025 3300046679 Bacteria 91529
237 Ga0495646_0001374 3300046680 Bacteria 14426
238 Ga0495613_0007895 3300046689 Bacteria 7915
239 Ga0495600_0000606 3300046809 Bacteria 18514
240 Ga0495604_0000805 3300047317 Bacteria 26391
241 Ga0495674_0001367 3300047319 Bacteria 23791
242 Ga0495672_0005952 3300047320 Bacteria 9556
243 Ga0495680_0001813 3300047322 Bacteria 22560
244 Ga0495684_0003386 3300047471 Bacteria 12517
245 Ga0495602_0000338 3300048088 Bacteria 43283
246 Ga0501031_0045951 3300049568 Bacteria 2849
247 Ga0501032_0011871 3300049569 Bacteria 6240
248 Ga0501032_0070017 3300049569 Bacteria 2340
249 Ga0501033_0006691 3300049570 Bacteria 9006
250 Ga0501034_0042820 3300049571 Bacteria 4583
251 Ga0501036_0000990 3300049572 Bacteria 21476
252 Ga0501037_0027153 3300049573 Bacteria 4229
253 Ga0501038_0003225 3300049574 Bacteria 15222
254 Ga0501038_0012695 3300049574 Bacteria 7699
255 Ga0501039_0005178 3300049575 Bacteria 9876
256 Ga0501043_0001445 3300049579 Bacteria 20746
257 Ga0501043_0094797 3300049579 Bacteria 2346
258 Ga0501046_0002132 3300049580 Bacteria 18695
259 Ga0501046_0021750 3300049580 Bacteria 5289
260 Ga0501047_0008141 3300049581 Bacteria 9895
261 Ga0501047_0042259 3300049581 Bacteria 4405
262 Ga0501047_0085137 3300049581 Bacteria 3037
263 Ga0501047_0109038 3300049581 Bacteria 2651
264 Ga0501048_0027912 3300049582 Bacteria 4099
265 Ga0501068_0002642 3300049584 Bacteria 9496
266 Ga0501069_0001418 3300049585 Bacteria 11749
267 Ga0501070_0009327 3300049586 Bacteria 8298
268 Ga0501070_0021473 3300049586 Bacteria 5416
269 Ga0501072_0001718 3300049588 Bacteria 16313
270 Ga0501072_0011494 3300049588 Bacteria 6767
271 Ga0501073_0002888 3300049589 Bacteria 12877
272 Ga0501073_0081365 3300049589 Bacteria 2253
273 Ga0501075_0015296 3300049591 Bacteria 5504
274 Ga0501076_0005773 3300049592 Bacteria 8927
275 Ga0501076_0027402 3300049592 Bacteria 4419
276 Ga0501077_0053468 3300049593 Bacteria 2564
277 Ga0501235_000388 3300049669 Bacteria 8415
278 Ga0501250_000314 3300049680 Unclassified 3080
279 Ga0501225_0009855 3300049705 Unclassified 2713
280 Ga0501079_0001451 3300049741 Bacteria 16770
281 Ga0501080_0009970 3300049742 Bacteria 8682
282 Ga0501081_0013950 3300049743 Bacteria 5291
283 Ga0501268_001573 3300049765 Unclassified 2870
284 Ga0501035_0047142 3300049822 Bacteria 3870
285 Ga0501035_0125820 3300049822 Bacteria 2237
286 Ga0501044_0020517 3300049823 Bacteria 7056
287 Ga0501044_0039642 3300049823 Bacteria 4913
288 Ga0501044_0126441 3300049823 Bacteria 2553
289 nmdc:mga05p37_162340_c1 3300050507 Unclassified 2728
290 nmdc:mga05p37_21414_c1 3300050507 Bacteria 5776
291 nmdc:mga05p37_63374_c1 3300050507 Bacteria 4549
292 nmdc:mga05p37_89865_c2 3300050507 Plasmid 3506
293 nmdc:mga06r32_17173_c1 3300050510 Bacteria 6605
294 nmdc:mga06r32_19202_c1 3300050510 Bacteria 6273
295 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
296 nmdc:mga08y16_36197_c1 3300050511 Bacteria 5183
297 nmdc:mga08y16_48274_c1 3300050511 Bacteria 4455
298 nmdc:mga0n895_13260_c1 3300050512 Bacteria 7428
299 nmdc:mga0n895_3492_c1 3300050512 Bacteria 12693
300 nmdc:mga0n895_4989_c1 3300050512 Bacteria 11010
301 nmdc:mga08x19_13693_c1 3300050514 Bacteria 4908
302 nmdc:mga08x19_54864_c1 3300050514 Bacteria 2566
303 nmdc:mga0a205_12951_c1 3300050515 Bacteria 7740
304 nmdc:mga0a205_43736_c1 3300050515 Unclassified 4317
305 Ga0495601_0004620 3300053077 Bacteria 7965
306 Ga0495612_0001543 3300053078 Bacteria 9491
307 Ga0495619_0014611 3300053085 Bacteria 4959
308 Ga0501084_0000425 3300054114 Bacteria 32622
309 Ga0501084_0000860 3300054114 Bacteria 23442
310 Ga0501082_0007569 3300060353 Bacteria 9368
311 Ga0501082_0014830 3300060353 Bacteria 6714
312 Ga0501082_0145819 3300060353 Bacteria 2055
313 Ga0070698_100092472
314 Ga0065707_10002159
315 Ga0070658_10002065
316 Ga0070683_100004673
317 Ga0070683_100005404
318 Ga0070683_100015158
319 Ga0070683_100143209
320 Ga0070690_100041910
321 Ga0070670_100017186
322 Ga0070670_100021775
323 Ga0070670_100028827
324 Ga0068869_100001222
325 Ga0068869_100002829
326 Ga0070666_10073194
327 Ga0070680_100026862
328 Ga0070680_100060723
329 Ga0070689_100021050
330 Ga0070661_100003229
331 Ga0070661_100010013
332 Ga0070661_100010333
333 Ga0070692_10000669
334 Ga0070668_100005955
335 Ga0070668_100011894
336 Ga0070669_100015967
337 Ga0070675_100004146
338 Ga0070675_100010409
339 Ga0070675_100026726
340 Ga0070675_100032980
341 Ga0070673_100007715
342 Ga0070659_100003353
343 Ga0070659_100030812
344 Ga0070703_10000108
345 Ga0070709_10073106
346 Ga0070711_100000029
347 Ga0070705_100037855
348 Ga0070694_100009971
349 Ga0070708_100000290
350 Ga0070708_100050721
351 Ga0070681_10001593
352 Ga0070681_10033048
353 Ga0070706_100004469
354 Ga0070706_100033948
355 Ga0070706_100101864
356 Ga0070706_100130769
357 Ga0070707_100023967
358 Ga0070698_100000042
359 Ga0070698_100006717
360 Ga0070698_100046098
361 Ga0070698_100153173
362 Ga0070699_100029041
363 Ga0070699_100033891
364 Ga0070699_100041256
365 Ga0070679_100001017
366 Ga0070679_100022643
367 Ga0070679_100157981
368 Ga0070697_100044665
369 Ga0070672_100006476
370 Ga0070672_100022627
371 Ga0070695_100009941
372 Ga0070695_100011074
373 Ga0070695_100017110
374 Ga0070696_100019375
375 Ga0070693_100018414
376 Ga0068855_100102953
377 Ga0068855_100208578
378 Ga0070664_100003817
379 Ga0070664_100012380
380 Ga0068857_100009077
381 Ga0068857_100041518
382 Ga0068857_100041725
383 Ga0070702_100003154
384 Ga0068852_100017154
385 Ga0068859_100002694
386 Ga0068859_100004596
387 Ga0068859_100033748
388 Ga0068864_100008837
389 Ga0068864_100010189
390 Ga0068861_100093454
391 Ga0068863_100006305
392 Ga0068863_100016856
393 Ga0068860_100011532
394 Ga0068860_100030933
395 Ga0068862_100001273
396 Ga0068862_100005389
397 Ga0068862_100069601
398 Ga0081455_10000294
399 Ga0081455_10091688
400 Ga0097621_100018825
401 Ga0075428_100000007
402 Ga0075428_100031856
403 Ga0075428_100042490
404 Ga0075428_100053232
405 Ga0075428_100073014
406 Ga0075430_100052365
407 Ga0075430_100091749
408 Ga0075431_100010628
409 Ga0075431_100016607
410 Ga0075431_100081183
411 Ga0075433_10022464
412 Ga0075434_100001880
413 Ga0075434_100003187
414 Ga0075434_100029518
415 Ga0075429_100014204
416 Ga0075436_100015555
417 Ga0075436_100018339
418 Ga0075436_100027033
419 Ga0097620_100002694
420 Ga0097620_100004596
421 Ga0097620_100033748
422 Ga0111539_10000009
423 Ga0111539_10000880
424 Ga0111539_10047480
425 Ga0111539_10105392
426 Ga0114129_10019646
427 Ga0114129_10051296
428 Ga0114129_10166598
429 Ga0105243_10041380
430 Ga0105241_10061336
431 Ga0105248_10004027
432 Ga0105248_10004212
433 Ga0105248_10034999
434 Ga0105248_10063277
435 Ga0105249_10001362
436 Ga0105249_10048515
437 Ga0105239_10033411
438 Ga0105239_10074116
439 Ga0157371_10007650
440 Ga0157371_10014085
441 Ga0157369_10001366
442 Ga0157374_10009776
443 Ga0157374_10032241
444 Ga0163162_10061352
445 Ga0157372_10009861
446 Ga0157372_10021651
447 Ga0157372_10030033
448 Ga0157375_10002365
449 Ga0157375_10261336
450 Ga0163163_10012713
451 Ga0157380_10010671
452 Ga0157377_10002442
453 Ga0157379_10002452
454 Ga0157376_10056598
455 Ga0163161_10007314
456 Ga0207653_10000005
457 Ga0207680_10030675
458 Ga0207645_10002421
459 Ga0207705_10001310
460 Ga0207684_10003259
461 Ga0207707_10056157
462 Ga0207663_10000121
463 Ga0207660_10012651
464 Ga0207660_10021761
465 Ga0207657_10014933
466 Ga0207657_10025097
467 Ga0207657_10026334
468 Ga0207652_10012981
469 Ga0207652_10042238
470 Ga0207646_10001414
471 Ga0207646_10032232
472 Ga0207681_10001046
473 Ga0207681_10047276
474 Ga0207650_10046231
475 Ga0207650_10069888
476 Ga0207650_10080086
477 Ga0207659_10014517
478 Ga0207659_10050717
479 Ga0207690_10037947
480 Ga0207690_10064649
481 Ga0207706_10000603
482 Ga0207706_10026180
483 Ga0207670_10011271
484 Ga0207704_10012009
485 Ga0207691_10000423
486 Ga0207691_10045350
487 Ga0207711_10029237
488 Ga0207689_10003703
489 Ga0207689_10076967
490 Ga0207661_10046266
491 Ga0207679_10001263
492 Ga0207679_10107432
493 Ga0207667_10076261
494 Ga0207651_10003890
495 Ga0207712_10000300
496 Ga0207712_10020085
497 Ga0207712_10023186
498 Ga0207668_10016713
499 Ga0207658_10043080
500 Ga0207702_10002071
501 Ga0207641_10007621
502 Ga0207676_10005787
503 Ga0207676_10054428
504 Ga0207674_10000353
505 Ga0207674_10000774
506 Ga0207674_10004247
507 Ga0207675_100009490
508 Ga0207698_10023059
509 Ga0207698_10080702
510 Ga0209588_1000173
511 Ga0209966_1001827
512 Ga0207428_10000022
513 Ga0207428_10000563
514 Ga0207428_10063780
515 Ga0268265_10004612
516 Ga0265332_10007774
517 Ga0307408_100004048
518 Ga0373934_0000250
519 Ga0373923_0006007
520 Ga0373953_0009201
521 Ga0373954_0032009
522 Ga0373956_0007105
523 Ga0373957_0000849
524 Ga0373955_0001167
525 Ga0373933_0001424
526 Ga0373937_0000486
527 Ga0395905_0146096
528 Ga0453683_0002711
529 Ga0451576_0007927
530 Ga0451576_0091848
531 Ga0466967_0018875
532 Ga0495592_0000545
533 Ga0495629_0002424
534 Ga0495629_0020261
535 Ga0495651_0004476
536 Ga0495653_0000177
537 Ga0495594_0004770
538 Ga0495608_0000700
539 Ga0495628_0001071
540 Ga0495630_0000715
541 Ga0495652_0000413
542 Ga0495587_0000324
543 Ga0495645_0002946
544 Ga0495667_0001635
545 Ga0495635_0000437
546 Ga0495657_0000208
547 Ga0495599_0000816
548 Ga0495623_0000025
549 Ga0495646_0001374
550 Ga0495613_0007895
551 Ga0495600_0000606
552 Ga0495604_0000805
553 Ga0495674_0001367
554 Ga0495672_0005952
555 Ga0495680_0001813
556 Ga0495684_0003386
557 Ga0495602_0000338
558 Ga0501031_0045951
559 Ga0501032_0011871
560 Ga0501032_0070017
561 Ga0501033_0006691
562 Ga0501034_0042820
563 Ga0501036_0000990
564 Ga0501037_0027153
565 Ga0501038_0003225
566 Ga0501038_0012695
567 Ga0501039_0005178
568 Ga0501043_0001445
569 Ga0501043_0094797
570 Ga0501046_0002132
571 Ga0501046_0021750
572 Ga0501047_0008141
573 Ga0501047_0042259
574 Ga0501047_0085137
575 Ga0501047_0109038
576 Ga0501048_0027912
577 Ga0501068_0002642
578 Ga0501069_0001418
579 Ga0501070_0009327
580 Ga0501070_0021473
581 Ga0501072_0001718
582 Ga0501072_0011494
583 Ga0501073_0002888
584 Ga0501073_0081365
585 Ga0501075_0015296
586 Ga0501076_0005773
587 Ga0501076_0027402
588 Ga0501077_0053468
589 Ga0501235_000388
590 Ga0501250_000314
591 Ga0501225_0009855
592 Ga0501079_0001451
593 Ga0501080_0009970
594 Ga0501081_0013950
595 Ga0501268_001573
596 Ga0501035_0047142
597 Ga0501035_0125820
598 Ga0501044_0020517
599 Ga0501044_0039642
600 Ga0501044_0126441
601 nmdc:mga05p37_162340_c1
602 nmdc:mga05p37_21414_c1
603 nmdc:mga05p37_63374_c1
604 nmdc:mga05p37_89865_c2
605 nmdc:mga06r32_17173_c1
606 nmdc:mga06r32_19202_c1
607 nmdc:mga08y16_21_c1
608 nmdc:mga08y16_36197_c1
609 nmdc:mga08y16_48274_c1
610 nmdc:mga0n895_13260_c1
611 nmdc:mga0n895_3492_c1
612 nmdc:mga0n895_4989_c1
613 nmdc:mga08x19_13693_c1
614 nmdc:mga08x19_54864_c1
615 nmdc:mga0a205_12951_c1
616 nmdc:mga0a205_43736_c1
617 Ga0495601_0004620
618 Ga0495612_0001543
619 Ga0495619_0014611
620 Ga0501084_0000425
621 Ga0501084_0000860
622 Ga0501082_0007569
623 Ga0501082_0014830
624 Ga0501082_0145819

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01011

PQQ

PQQ enzyme repeat

300

332

0.9

PF01011

PQQ

PQQ enzyme repeat

578

616

0.89

PF13360

PQQ_2

PQQ-like domain

529

654

0.78

PF13570

PQQ_3

PQQ-like domain

541

597

0.72

PF13360

PQQ_2

PQQ-like domain

57

372

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zcw-assembly1.cif.gz_A crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 0.8117 19 632
6zcv-assembly1.cif.gz_A crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 0.8113 19 632
1kb0-assembly1.cif.gz_A crystal structure of quinohemoprotein alcohol dehydrogenase from comamonas testosteroni 0.8105 20 631
1kv9-assembly1.cif.gz_A structure at 1.9 a resolution of a quinohemoprotein alcohol dehydrogenase from pseudomonas putida hk5 0.8018 15 631
7wmd-assembly1.cif.gz_A pqq-dependent alcohol dehydrogenase detoxifying don 0.7984 25 632
ID Description Score Start End Superfamily
af_P15877_153_794_2.140.10.10 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.9032 18 632 2.140.10.10
af_P15877_153_794_2.140.10.10 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.8781 18 632 2.140.10.10
1kb0A01 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.809 20 631 2.140.10.10
af_A0A0R0HX19_6_134_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8088 527 632 2.130.10.10
af_Q4D6Z0_49_199_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.7966 144 318 2.40.128.630
ID Description Score Start End GO Terms
AF-A0A2V7XIQ6-F1-model_v4 Pyrroloquinoline quinone-dependent dehydrogenase 0.9878 23 332 GO:0016491
AF-A0A3N5PSW4-F1-model_v4 Pyrroloquinoline quinone-dependent dehydrogenase 0.9865 287 632 GO:0008876
AF-A0A2V7PH91-F1-model_v4 Pyrroloquinoline quinone-dependent dehydrogenase 0.9861 18 514 GO:0016491
AF-A0A1Q6VE66-F1-model_v4 Pyrroloquinoline quinone-dependent dehydrogenase 0.985 81 632 GO:0008876
GO:0016020
GO:0048038
AF-A0A2V7M1W9-F1-model_v4 Pyrroloquinoline quinone-dependent dehydrogenase 0.9849 18 385 GO:0016491

Map