F401592

General Info

Members Datasets Scaffolds Average Seq Length
312 187 624 263

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10206871|Ga0070681_102068712
Length 281
Sequence MAKARSLIDRYVNASSWQNDGNEMTRTLAAAFLMAIGFIPAQRSGGSIPAAPTYGYEVVRSYPHDHAAFTQGLIFKDGVLYEGTGLNGQSSIRKVNLETGEVLKIQPLPQQYFGEGITDWKGQILQLTWQAELGFVYDMNTFEQQRTFTYKGEGWGLTHDATRIIMSDGSADLRFIDPVTLKESGRITVRDQNGPVTELNELEFVKGEIYANVWQTERIARISPKDGRVVGWIDLHGLLTPAERTGTDVLNGIAYDAARDRLFVTGKWWPRLFEIKLVQRR

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
154 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 0.96
Rhizosphere 98.4
Stem 0
Stem Tuber 0
Unclassified 9.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10206871 3300005458 Unclassified 1879
2 Ga0065704_10092268 3300005289 Bacteria 2664
3 Ga0065715_10036331 3300005293 Bacteria 1260
4 Ga0065715_10200770 3300005293 Unclassified 1363
5 Ga0065715_10238860 3300005293 Bacteria 1206
6 Ga0065707_10083852 3300005295 Bacteria 8103
7 Ga0065707_10109574 3300005295 Bacteria 2455
8 Ga0070658_10102581 3300005327 Bacteria 2366
9 Ga0070683_100047025 3300005329 Bacteria 3987
10 Ga0070683_100385151 3300005329 Bacteria 1336
11 Ga0070677_10094905 3300005333 Bacteria 1304
12 Ga0068869_100512747 3300005334 Bacteria 1003
13 Ga0070666_10098636 3300005335 Bacteria 2012
14 Ga0070680_100363494 3300005336 Bacteria 1231
15 Ga0068868_100083466 3300005338 Bacteria 2565
16 Ga0070660_100003101 3300005339 Bacteria 11420
17 Ga0070689_100004996 3300005340 Bacteria 9008
18 Ga0070689_100074686 3300005340 Bacteria 2653
19 Ga0070689_100251146 3300005340 Bacteria 1459
20 Ga0070691_10181837 3300005341 Bacteria 1095
21 Ga0070692_10066246 3300005345 Bacteria 1914
22 Ga0070668_100016010 3300005347 Bacteria 5611
23 Ga0070669_100004304 3300005353 Bacteria 10290
24 Ga0070669_100025912 3300005353 Bacteria 4216
25 Ga0070669_100316629 3300005353 Unclassified 1259
26 Ga0070675_100002302 3300005354 Bacteria 14178
27 Ga0070675_100058932 3300005354 Bacteria 3167
28 Ga0070675_100095384 3300005354 Bacteria 2497
29 Ga0070675_100123730 3300005354 Bacteria 2199
30 Ga0070671_100231718 3300005355 Bacteria 1567
31 Ga0070674_100007144 3300005356 Bacteria 6570
32 Ga0070673_100058622 3300005364 Bacteria 3045
33 Ga0070673_100208098 3300005364 Bacteria 1688
34 Ga0070688_100012244 3300005365 Bacteria 4801
35 Ga0070659_100080521 3300005366 Bacteria 2600
36 Ga0070659_100093049 3300005366 Bacteria 2419
37 Ga0070703_10106004 3300005406 Unclassified 998
38 Ga0070713_100019103 3300005436 Bacteria 5223
39 Ga0070701_10066934 3300005438 Bacteria 1910
40 Ga0070701_10190895 3300005438 Unclassified 1205
41 Ga0070705_100000380 3300005440 Bacteria 25908
42 Ga0070705_100113219 3300005440 Bacteria 1738
43 Ga0070705_100157415 3300005440 Bacteria 1515
44 Ga0070705_100201526 3300005440 Bacteria 1365
45 Ga0070700_100096177 3300005441 Bacteria 1943
46 Ga0070694_100000208 3300005444 Bacteria 30971
47 Ga0070694_100006046 3300005444 Bacteria 7345
48 Ga0070694_100269139 3300005444 Bacteria 1295
49 Ga0070694_100296355 3300005444 Bacteria 1238
50 Ga0070694_100416973 3300005444 Bacteria 1054
51 Ga0070694_100435374 3300005444 Bacteria 1033
52 Ga0070662_100135671 3300005457 Bacteria 1902
53 Ga0070681_10321885 3300005458 Bacteria 1456
54 Ga0068867_100005930 3300005459 Bacteria 8666
55 Ga0070698_100006383 3300005471 Bacteria 12804
56 Ga0070698_100070698 3300005471 Bacteria 3501
57 Ga0070698_100411047 3300005471 Bacteria 1287
58 Ga0070699_100007703 3300005518 Bacteria 9360
59 Ga0070699_100020440 3300005518 Bacteria 5710
60 Ga0070699_100239763 3300005518 Bacteria 1618
61 Ga0070699_100384036 3300005518 Bacteria 1268
62 Ga0070679_100008442 3300005530 Bacteria 9696
63 Ga0070679_100549815 3300005530 Bacteria 1098
64 Ga0070684_100034680 3300005535 Bacteria 4316
65 Ga0070697_100059670 3300005536 Bacteria 3107
66 Ga0070672_100095352 3300005543 Bacteria 2406
67 Ga0070686_100356078 3300005544 Bacteria 1101
68 Ga0070695_100000037 3300005545 Bacteria 50884
69 Ga0070696_100000444 3300005546 Bacteria 25904
70 Ga0070696_100007625 3300005546 Bacteria 7230
71 Ga0070696_100078646 3300005546 Bacteria 2332
72 Ga0070696_100536225 3300005546 Bacteria 936
73 Ga0070665_100034199 3300005548 Bacteria 5111
74 Ga0070704_100003755 3300005549 Bacteria 8744
75 Ga0070704_100054619 3300005549 Bacteria 2827
76 Ga0070704_100178979 3300005549 Bacteria 1694
77 Ga0070704_100289264 3300005549 Unclassified 1361
78 Ga0068855_100005177 3300005563 Bacteria 15904
79 Ga0070664_100109881 3300005564 Bacteria 2405
80 Ga0068857_100022861 3300005577 Bacteria 5500
81 Ga0068857_100081668 3300005577 Bacteria 2886
82 Ga0068856_100814586 3300005614 Bacteria 953
83 Ga0070702_100251719 3300005615 Bacteria 1198
84 Ga0068852_100170038 3300005616 Unclassified 2042
85 Ga0068859_100020759 3300005617 Bacteria 6592
86 Ga0068859_100022601 3300005617 Bacteria 6305
87 Ga0068859_100169421 3300005617 Bacteria 2264
88 Ga0068859_100228262 3300005617 Bacteria 1950
89 Ga0068864_100008589 3300005618 Bacteria 8430
90 Ga0068866_10158019 3300005718 Bacteria 1319
91 Ga0068861_100010759 3300005719 Bacteria 6358
92 Ga0068861_100188953 3300005719 Bacteria 1720
93 Ga0068870_10050367 3300005840 Bacteria 2200
94 Ga0068863_100849739 3300005841 Unclassified 912
95 Ga0068858_100057080 3300005842 Bacteria 3608
96 Ga0068860_100044322 3300005843 Bacteria 4240
97 Ga0068860_100239902 3300005843 Bacteria 1763
98 Ga0068862_100005000 3300005844 Bacteria 11159
99 Ga0068862_100017403 3300005844 Bacteria 5987
100 Ga0081540_1064208 3300005983 Bacteria 1733
101 Ga0070717_10038274 3300006028 Unclassified 3899
102 Ga0075366_10035698 3300006195 Bacteria 2931
103 Ga0097621_100024715 3300006237 Bacteria 4694
104 Ga0097621_100125973 3300006237 Bacteria 2176
105 Ga0068871_100065842 3300006358 Bacteria 2969
106 Ga0075428_100016744 3300006844 Bacteria 8095
107 Ga0075428_101069484 3300006844 Eukaryota 853
108 Ga0075433_10014179 3300006852 Bacteria 6505
109 Ga0075433_10016998 3300006852 Bacteria 6013
110 Ga0075434_100001987 3300006871 Bacteria 17746
111 Ga0075434_100245471 3300006871 Bacteria 1810
112 Ga0075434_100266918 3300006871 Bacteria 1731
113 Ga0075434_100649016 3300006871 Bacteria 1074
114 Ga0068865_100119093 3300006881 Bacteria 1960
115 Ga0068865_100166736 3300006881 Bacteria 1685
116 Ga0075436_100269279 3300006914 Bacteria 1216
117 Ga0097620_100020758 3300006931 Bacteria 6592
118 Ga0097620_100022603 3300006931 Bacteria 6305
119 Ga0097620_100169418 3300006931 Bacteria 2264
120 Ga0097620_100228261 3300006931 Bacteria 1950
121 Ga0075435_100024099 3300007076 Bacteria 4717
122 Ga0075435_100045698 3300007076 Bacteria 3511
123 Ga0075435_100076690 3300007076 Bacteria 2739
124 Ga0105240_10082397 3300009093 Unclassified 3951
125 Ga0105240_10419082 3300009093 Bacteria 1505
126 Ga0111539_10002436 3300009094 Bacteria 24741
127 Ga0111539_10027981 3300009094 Bacteria 6885
128 Ga0111539_10051452 3300009094 Unclassified 4905
129 Ga0111539_10097240 3300009094 Bacteria 3458
130 Ga0111539_10527423 3300009094 Bacteria 1376
131 Ga0114129_10005948 3300009147 Bacteria 17270
132 Ga0114129_10014644 3300009147 Bacteria 11174
133 Ga0114129_10049645 3300009147 Bacteria 5895
134 Ga0114129_10425119 3300009147 Bacteria 1747
135 Ga0114129_10839020 3300009147 Bacteria 1169
136 Ga0105243_10055670 3300009148 Bacteria 3143
137 Ga0105243_10095764 3300009148 Bacteria 2454
138 Ga0105243_10208795 3300009148 Bacteria 1718
139 Ga0105243_10309638 3300009148 Bacteria 1435
140 Ga0105242_10021551 3300009176 Bacteria 5062
141 Ga0105242_10164803 3300009176 Archaea 1943
142 Ga0105242_10320589 3300009176 Bacteria 1421
143 Ga0105248_10104420 3300009177 Bacteria 3195
144 Ga0105248_10958827 3300009177 Bacteria 966
145 Ga0105248_11089206 3300009177 Bacteria 903
146 Ga0105238_10532889 3300009551 Bacteria 1178
147 Ga0105249_10000869 3300009553 Bacteria 26898
148 Ga0105249_10027353 3300009553 Bacteria 5145
149 Ga0105249_10371620 3300009553 Archaea 1454
150 Ga0105249_10476368 3300009553 Bacteria 1290
151 Ga0157370_10057610 3300013104 Bacteria 3693
152 Ga0157369_10522853 3300013105 Bacteria 1227
153 Ga0157374_10011706 3300013296 Bacteria 7609
154 Ga0157378_10058482 3300013297 Bacteria 3438
155 Ga0157378_10421726 3300013297 Unclassified 1319
156 Ga0163162_10543932 3300013306 Bacteria 1290
157 Ga0157375_10008729 3300013308 Bacteria 8880
158 Ga0157375_10044722 3300013308 Bacteria 4305
159 Ga0157375_10505411 3300013308 Unclassified 1373
160 Ga0163163_10162362 3300014325 Bacteria 2280
161 Ga0157380_10127740 3300014326 Bacteria 2164
162 Ga0182008_10139423 3300014497 Bacteria 1212
163 Ga0157377_10027255 3300014745 Bacteria 3067
164 Ga0157377_10151724 3300014745 Unclassified 1433
165 Ga0157379_10085712 3300014968 Bacteria 2824
166 Ga0157376_10030757 3300014969 Bacteria 4291
167 Ga0157376_10111556 3300014969 Bacteria 2408
168 Ga0157376_10139842 3300014969 Bacteria 2171
169 Ga0157376_10687637 3300014969 Bacteria 1027
170 Ga0163161_10270358 3300017792 Bacteria 1330
171 Ga0207682_10045281 3300025893 Bacteria 1805
172 Ga0207680_10030208 3300025903 Bacteria 3053
173 Ga0207645_10219791 3300025907 Bacteria 1252
174 Ga0207643_10065091 3300025908 Bacteria 2088
175 Ga0207707_10025985 3300025912 Bacteria 5120
176 Ga0207707_10091359 3300025912 Unclassified 2661
177 Ga0207695_10349197 3300025913 Unclassified 1367
178 Ga0207662_10023017 3300025918 Bacteria 3576
179 Ga0207657_10002928 3300025919 Bacteria 18323
180 Ga0207646_10275498 3300025922 Bacteria 1520
181 Ga0207659_10004275 3300025926 Bacteria 8636
182 Ga0207659_10012951 3300025926 Bacteria 5326
183 Ga0207687_10012736 3300025927 Bacteria 5495
184 Ga0207700_10019696 3300025928 Bacteria 4563
185 Ga0207690_10129862 3300025932 Bacteria 1843
186 Ga0207706_10046120 3300025933 Bacteria 3859
187 Ga0207706_10466785 3300025933 Unclassified 1091
188 Ga0207686_10106110 3300025934 Bacteria 1885
189 Ga0207686_10332183 3300025934 Bacteria 1139
190 Ga0207709_10030123 3300025935 Bacteria 3154
191 Ga0207704_10003909 3300025938 Bacteria 6775
192 Ga0207704_10177865 3300025938 Bacteria 1534
193 Ga0207691_10019112 3300025940 Bacteria 6488
194 Ga0207711_10254978 3300025941 Bacteria 1612
195 Ga0207679_10068161 3300025945 Bacteria 2672
196 Ga0207679_10099606 3300025945 Bacteria 2270
197 Ga0207679_10415500 3300025945 Bacteria 1186
198 Ga0207667_10212372 3300025949 Bacteria 1983
199 Ga0207651_10011706 3300025960 Bacteria 4923
200 Ga0207712_10026896 3300025961 Bacteria 3838
201 Ga0207712_10133918 3300025961 Archaea 1893
202 Ga0207668_10100490 3300025972 Bacteria 2148
203 Ga0207668_10162034 3300025972 Bacteria 1744
204 Ga0207677_10064382 3300026023 Bacteria 2553
205 Ga0207703_10051605 3300026035 Bacteria 3334
206 Ga0207703_10088218 3300026035 Bacteria 2603
207 Ga0207708_10122771 3300026075 Bacteria 2025
208 Ga0207648_10000944 3300026089 Bacteria 32838
209 Ga0207676_10012127 3300026095 Bacteria 6170
210 Ga0207676_10034604 3300026095 Bacteria 3826
211 Ga0207676_10385418 3300026095 Bacteria 1306
212 Ga0207674_10030872 3300026116 Bacteria 5632
213 Ga0207675_100004691 3300026118 Bacteria 13159
214 Ga0207675_100194825 3300026118 Bacteria 1945
215 Ga0207675_100201724 3300026118 Bacteria 1911
216 Ga0207683_10206988 3300026121 Bacteria 1784
217 Ga0207428_10004283 3300027907 Bacteria 13648
218 Ga0268266_10035348 3300028379 Bacteria 4250
219 Ga0268265_10001913 3300028380 Bacteria 16547
220 Ga0268264_10016528 3300028381 Bacteria 6041
221 Ga0268264_10137972 3300028381 Bacteria 2171
222 Ga0265331_10024575 3300031250 Bacteria 3047
223 Ga0307408_100459377 3300031548 Unclassified 1106
224 Ga0265314_10046766 3300031711 Unclassified 3051
225 Ga0265342_10034011 3300031712 Viruses 3130
226 Ga0307405_10097763 3300031731 Unclassified 1961
227 Ga0307413_10354670 3300031824 Unclassified 1133
228 Ga0307410_10118994 3300031852 Unclassified 1923
229 Ga0307407_10106757 3300031903 Unclassified 1750
230 Ga0307415_100028136 3300032126 Unclassified 3571
231 Ga0373948_0004682 3300034817 Bacteria 2178
232 Ga0373953_0043439 3300035117 Bacteria 1794
233 Ga0373943_0029064 3300035170 Bacteria 2610
234 Ga0373955_0048845 3300035172 Bacteria 2296
235 Ga0373955_0280578 3300035172 Bacteria 1002
236 Ga0373962_0036017 3300035242 Bacteria 1377
237 Ga0373935_0064099 3300035692 Unclassified 2356
238 Ga0373933_0110414 3300035724 Bacteria 1715
239 Ga0373947_0015711 3300035725 Unclassified 4348
240 Ga0373947_0438803 3300035725 Bacteria 884
241 Ga0373937_0001281 3300036401 Bacteria 21057
242 Ga0373937_0024196 3300036401 Bacteria 5475
243 Ga0373937_0132933 3300036401 Bacteria 2325
244 Ga0373925_0031561 3300037068 Unclassified 3894
245 Ga0373925_0105152 3300037068 Bacteria 2175
246 Ga0439446_0051108 3300042156 Bacteria 1235
247 Ga0451577_0192156 3300042876 Bacteria 1841
248 Ga0451576_0295279 3300045051 Bacteria 1694
249 Ga0495653_0110215 3300046463 Unclassified 1979
250 Ga0495580_0001116 3300046472 Bacteria 23612
251 Ga0495608_0172487 3300046511 Bacteria 1371
252 Ga0495608_0194196 3300046511 Bacteria 1281
253 Ga0495628_0297301 3300046516 Bacteria 1196
254 Ga0495663_0014151 3300046525 Bacteria 2235
255 Ga0495642_0007520 3300046528 Bacteria 4174
256 Ga0495642_0043759 3300046528 Bacteria 1827
257 Ga0495621_0001624 3300046539 Bacteria 5877
258 Ga0495621_0036980 3300046539 Bacteria 1697
259 Ga0495645_0079125 3300046543 Bacteria 2362
260 Ga0495645_0286882 3300046543 Bacteria 1080
261 Ga0495667_0087769 3300046559 Bacteria 2017
262 Ga0495659_0004326 3300046664 Bacteria 4472
263 Ga0495588_0045079 3300046674 Bacteria 2260
264 Ga0495658_0015163 3300046683 Bacteria 3951
265 Ga0495658_0199584 3300046683 Bacteria 1246
266 Ga0495600_0090826 3300046809 Bacteria 1992
267 Ga0495636_0004857 3300047318 Bacteria 5265
268 Ga0495636_0008806 3300047318 Bacteria 3977
269 Ga0495636_0036806 3300047318 Bacteria 2019
270 Ga0495636_0083801 3300047318 Bacteria 1376
271 Ga0495674_0357431 3300047319 Bacteria 1185
272 Ga0495680_0254770 3300047322 Bacteria 1243
273 Ga0495684_0252369 3300047471 Bacteria 1283
274 Ga0496104_0686177 3300048907 Bacteria 932
275 Ga0496106_0416351 3300048909 Bacteria 1080
276 Ga0496115_0166606 3300048918 Bacteria 1822
277 Ga0501034_0185357 3300049571 Bacteria 2045
278 Ga0501067_0265609 3300049583 Bacteria 955
279 Ga0501068_0112491 3300049584 Bacteria 1694
280 Ga0501071_0176784 3300049587 Bacteria 1599
281 Ga0501072_0223594 3300049588 Bacteria 1500
282 Ga0501077_0085353 3300049593 Bacteria 2001
283 nmdc:mga05p37_130639_c1 3300050507 Bacteria 3081
284 nmdc:mga05p37_47237_c1 3300050507 Bacteria 5294
285 nmdc:mga05p37_47958_c1 3300050507 Bacteria 5253
286 nmdc:mga05p37_7212_c1 3300050507 Bacteria 13116
287 nmdc:mga09592_195737_c1 3300050508 Bacteria 1750
288 nmdc:mga06r32_16711_c1 3300050510 Bacteria 6688
289 nmdc:mga08y16_137228_c1 3300050511 Bacteria 2542
290 nmdc:mga08y16_14136_c1 3300050511 Bacteria 8402
291 nmdc:mga08y16_19120_c1 3300050511 Bacteria 7217
292 nmdc:mga08y16_235739_c1 3300050511 Bacteria 1892
293 nmdc:mga08y16_345849_c1 3300050511 Bacteria 1528
294 nmdc:mga0n895_11910_c1 3300050512 Bacteria 7782
295 nmdc:mga0n895_374561_c1 3300050512 Bacteria 1441
296 nmdc:mga0n895_55982_c1 3300050512 Bacteria 3884
297 nmdc:mga0rr50_112824_c1 3300050513 Bacteria 2153
298 nmdc:mga0rr50_16068_c1 3300050513 Bacteria 4959
299 nmdc:mga0rr50_25724_c1 3300050513 Bacteria 4096
300 nmdc:mga0rr50_288575_c1 3300050513 Bacteria 1370
301 nmdc:mga0rr50_71915_c1 3300050513 Bacteria 2640
302 nmdc:mga0a205_15225_c1 3300050515 Bacteria 7185
303 nmdc:mga0a205_28040_c1 3300050515 Bacteria 5380
304 nmdc:mga0a205_360850_c1 3300050515 Bacteria 1320
305 Ga0495601_0078318 3300053077 Bacteria 2118
306 Ga0495601_0093660 3300053077 Bacteria 1935
307 Ga0495595_0239681 3300053084 Bacteria 907
308 Ga0495619_0063397 3300053085 Bacteria 2462
309 Ga0495619_0075958 3300053085 Unclassified 2255
310 Ga0500658_0110743 3300053134 Bacteria 1208
311 Ga0501084_0230553 3300054114 Bacteria 1563
312 Ga0530510_0009693 3300061734 Bacteria 6758
313 Ga0070681_10206871
314 Ga0065704_10092268
315 Ga0065715_10036331
316 Ga0065715_10200770
317 Ga0065715_10238860
318 Ga0065707_10083852
319 Ga0065707_10109574
320 Ga0070658_10102581
321 Ga0070683_100047025
322 Ga0070683_100385151
323 Ga0070677_10094905
324 Ga0068869_100512747
325 Ga0070666_10098636
326 Ga0070680_100363494
327 Ga0068868_100083466
328 Ga0070660_100003101
329 Ga0070689_100004996
330 Ga0070689_100074686
331 Ga0070689_100251146
332 Ga0070691_10181837
333 Ga0070692_10066246
334 Ga0070668_100016010
335 Ga0070669_100004304
336 Ga0070669_100025912
337 Ga0070669_100316629
338 Ga0070675_100002302
339 Ga0070675_100058932
340 Ga0070675_100095384
341 Ga0070675_100123730
342 Ga0070671_100231718
343 Ga0070674_100007144
344 Ga0070673_100058622
345 Ga0070673_100208098
346 Ga0070688_100012244
347 Ga0070659_100080521
348 Ga0070659_100093049
349 Ga0070703_10106004
350 Ga0070713_100019103
351 Ga0070701_10066934
352 Ga0070701_10190895
353 Ga0070705_100000380
354 Ga0070705_100113219
355 Ga0070705_100157415
356 Ga0070705_100201526
357 Ga0070700_100096177
358 Ga0070694_100000208
359 Ga0070694_100006046
360 Ga0070694_100269139
361 Ga0070694_100296355
362 Ga0070694_100416973
363 Ga0070694_100435374
364 Ga0070662_100135671
365 Ga0070681_10321885
366 Ga0068867_100005930
367 Ga0070698_100006383
368 Ga0070698_100070698
369 Ga0070698_100411047
370 Ga0070699_100007703
371 Ga0070699_100020440
372 Ga0070699_100239763
373 Ga0070699_100384036
374 Ga0070679_100008442
375 Ga0070679_100549815
376 Ga0070684_100034680
377 Ga0070697_100059670
378 Ga0070672_100095352
379 Ga0070686_100356078
380 Ga0070695_100000037
381 Ga0070696_100000444
382 Ga0070696_100007625
383 Ga0070696_100078646
384 Ga0070696_100536225
385 Ga0070665_100034199
386 Ga0070704_100003755
387 Ga0070704_100054619
388 Ga0070704_100178979
389 Ga0070704_100289264
390 Ga0068855_100005177
391 Ga0070664_100109881
392 Ga0068857_100022861
393 Ga0068857_100081668
394 Ga0068856_100814586
395 Ga0070702_100251719
396 Ga0068852_100170038
397 Ga0068859_100020759
398 Ga0068859_100022601
399 Ga0068859_100169421
400 Ga0068859_100228262
401 Ga0068864_100008589
402 Ga0068866_10158019
403 Ga0068861_100010759
404 Ga0068861_100188953
405 Ga0068870_10050367
406 Ga0068863_100849739
407 Ga0068858_100057080
408 Ga0068860_100044322
409 Ga0068860_100239902
410 Ga0068862_100005000
411 Ga0068862_100017403
412 Ga0081540_1064208
413 Ga0070717_10038274
414 Ga0075366_10035698
415 Ga0097621_100024715
416 Ga0097621_100125973
417 Ga0068871_100065842
418 Ga0075428_100016744
419 Ga0075428_101069484
420 Ga0075433_10014179
421 Ga0075433_10016998
422 Ga0075434_100001987
423 Ga0075434_100245471
424 Ga0075434_100266918
425 Ga0075434_100649016
426 Ga0068865_100119093
427 Ga0068865_100166736
428 Ga0075436_100269279
429 Ga0097620_100020758
430 Ga0097620_100022603
431 Ga0097620_100169418
432 Ga0097620_100228261
433 Ga0075435_100024099
434 Ga0075435_100045698
435 Ga0075435_100076690
436 Ga0105240_10082397
437 Ga0105240_10419082
438 Ga0111539_10002436
439 Ga0111539_10027981
440 Ga0111539_10051452
441 Ga0111539_10097240
442 Ga0111539_10527423
443 Ga0114129_10005948
444 Ga0114129_10014644
445 Ga0114129_10049645
446 Ga0114129_10425119
447 Ga0114129_10839020
448 Ga0105243_10055670
449 Ga0105243_10095764
450 Ga0105243_10208795
451 Ga0105243_10309638
452 Ga0105242_10021551
453 Ga0105242_10164803
454 Ga0105242_10320589
455 Ga0105248_10104420
456 Ga0105248_10958827
457 Ga0105248_11089206
458 Ga0105238_10532889
459 Ga0105249_10000869
460 Ga0105249_10027353
461 Ga0105249_10371620
462 Ga0105249_10476368
463 Ga0157370_10057610
464 Ga0157369_10522853
465 Ga0157374_10011706
466 Ga0157378_10058482
467 Ga0157378_10421726
468 Ga0163162_10543932
469 Ga0157375_10008729
470 Ga0157375_10044722
471 Ga0157375_10505411
472 Ga0163163_10162362
473 Ga0157380_10127740
474 Ga0182008_10139423
475 Ga0157377_10027255
476 Ga0157377_10151724
477 Ga0157379_10085712
478 Ga0157376_10030757
479 Ga0157376_10111556
480 Ga0157376_10139842
481 Ga0157376_10687637
482 Ga0163161_10270358
483 Ga0207682_10045281
484 Ga0207680_10030208
485 Ga0207645_10219791
486 Ga0207643_10065091
487 Ga0207707_10025985
488 Ga0207707_10091359
489 Ga0207695_10349197
490 Ga0207662_10023017
491 Ga0207657_10002928
492 Ga0207646_10275498
493 Ga0207659_10004275
494 Ga0207659_10012951
495 Ga0207687_10012736
496 Ga0207700_10019696
497 Ga0207690_10129862
498 Ga0207706_10046120
499 Ga0207706_10466785
500 Ga0207686_10106110
501 Ga0207686_10332183
502 Ga0207709_10030123
503 Ga0207704_10003909
504 Ga0207704_10177865
505 Ga0207691_10019112
506 Ga0207711_10254978
507 Ga0207679_10068161
508 Ga0207679_10099606
509 Ga0207679_10415500
510 Ga0207667_10212372
511 Ga0207651_10011706
512 Ga0207712_10026896
513 Ga0207712_10133918
514 Ga0207668_10100490
515 Ga0207668_10162034
516 Ga0207677_10064382
517 Ga0207703_10051605
518 Ga0207703_10088218
519 Ga0207708_10122771
520 Ga0207648_10000944
521 Ga0207676_10012127
522 Ga0207676_10034604
523 Ga0207676_10385418
524 Ga0207674_10030872
525 Ga0207675_100004691
526 Ga0207675_100194825
527 Ga0207675_100201724
528 Ga0207683_10206988
529 Ga0207428_10004283
530 Ga0268266_10035348
531 Ga0268265_10001913
532 Ga0268264_10016528
533 Ga0268264_10137972
534 Ga0265331_10024575
535 Ga0307408_100459377
536 Ga0265314_10046766
537 Ga0265342_10034011
538 Ga0307405_10097763
539 Ga0307413_10354670
540 Ga0307410_10118994
541 Ga0307407_10106757
542 Ga0307415_100028136
543 Ga0373948_0004682
544 Ga0373953_0043439
545 Ga0373943_0029064
546 Ga0373955_0048845
547 Ga0373955_0280578
548 Ga0373962_0036017
549 Ga0373935_0064099
550 Ga0373933_0110414
551 Ga0373947_0015711
552 Ga0373947_0438803
553 Ga0373937_0001281
554 Ga0373937_0024196
555 Ga0373937_0132933
556 Ga0373925_0031561
557 Ga0373925_0105152
558 Ga0439446_0051108
559 Ga0451577_0192156
560 Ga0451576_0295279
561 Ga0495653_0110215
562 Ga0495580_0001116
563 Ga0495608_0172487
564 Ga0495608_0194196
565 Ga0495628_0297301
566 Ga0495663_0014151
567 Ga0495642_0007520
568 Ga0495642_0043759
569 Ga0495621_0001624
570 Ga0495621_0036980
571 Ga0495645_0079125
572 Ga0495645_0286882
573 Ga0495667_0087769
574 Ga0495659_0004326
575 Ga0495588_0045079
576 Ga0495658_0015163
577 Ga0495658_0199584
578 Ga0495600_0090826
579 Ga0495636_0004857
580 Ga0495636_0008806
581 Ga0495636_0036806
582 Ga0495636_0083801
583 Ga0495674_0357431
584 Ga0495680_0254770
585 Ga0495684_0252369
586 Ga0496104_0686177
587 Ga0496106_0416351
588 Ga0496115_0166606
589 Ga0501034_0185357
590 Ga0501067_0265609
591 Ga0501068_0112491
592 Ga0501071_0176784
593 Ga0501072_0223594
594 Ga0501077_0085353
595 nmdc:mga05p37_130639_c1
596 nmdc:mga05p37_47237_c1
597 nmdc:mga05p37_47958_c1
598 nmdc:mga05p37_7212_c1
599 nmdc:mga09592_195737_c1
600 nmdc:mga06r32_16711_c1
601 nmdc:mga08y16_137228_c1
602 nmdc:mga08y16_14136_c1
603 nmdc:mga08y16_19120_c1
604 nmdc:mga08y16_235739_c1
605 nmdc:mga08y16_345849_c1
606 nmdc:mga0n895_11910_c1
607 nmdc:mga0n895_374561_c1
608 nmdc:mga0n895_55982_c1
609 nmdc:mga0rr50_112824_c1
610 nmdc:mga0rr50_16068_c1
611 nmdc:mga0rr50_25724_c1
612 nmdc:mga0rr50_288575_c1
613 nmdc:mga0rr50_71915_c1
614 nmdc:mga0a205_15225_c1
615 nmdc:mga0a205_28040_c1
616 nmdc:mga0a205_360850_c1
617 Ga0495601_0078318
618 Ga0495601_0093660
619 Ga0495595_0239681
620 Ga0495619_0063397
621 Ga0495619_0075958
622 Ga0500658_0110743
623 Ga0501084_0230553
624 Ga0530510_0009693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05096

Glu_cyclase_2

Glutamine cyclotransferase

29

277

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2faw-assembly2.cif.gz_B crystal structure of papaya glutaminyl cyclase 0.9582 37 267
3nom-assembly2.cif.gz_B crystal structure of zymomonas mobilis glutaminyl cyclase (monoclinic form) 0.9579 36 266
3mbr-assembly1.cif.gz_X crystal structure of the glutaminyl cyclase from xanthomonas campestris 0.9433 35 267
3nom-assembly2.cif.gz_B crystal structure of zymomonas mobilis glutaminyl cyclase (monoclinic form) 0.9417 36 266
3mbr-assembly1.cif.gz_X crystal structure of the glutaminyl cyclase from xanthomonas campestris 0.9276 35 267
ID Description Score Start End Superfamily
af_Q5VRH1_75_319_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9612 35 261 2.130.10.10
af_A0A144A3U7_117_356_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9071 63 259 2.130.10.10
af_Q5VRH1_75_319_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8881 35 261 2.130.10.10
af_E9QIR4_212_349_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7985 52 139 2.130.10.10
af_Q60259_9_76_2.40.10.480 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.796 59 132 2.40.10.480
ID Description Score Start End GO Terms
AF-A0A4Q3TD38-F1-model_v4 deleted 0.9989 40 103
AF-A0A2E5GTY6-F1-model_v4 Glutamine cyclotransferase 0.9978 41 135 GO:0016603
AF-A0A524KWW7-F1-model_v4 Glutaminyl-peptide cyclotransferase 0.9928 34 266 GO:0016603
AF-A0A539EBX7-F1-model_v4 Glutamine cyclotransferase 0.9927 59 127 GO:0016603
AF-A0A524H0I5-F1-model_v4 Glutaminyl-peptide cyclotransferase 0.9922 40 143 GO:0016603

Map