F401374

General Info

Members Datasets Scaffolds Average Seq Length
311 169 622 397

Family's Representative Sequence

Representative Sequence 3300046535|Ga0495586_0149685|Ga0495586_0149685_171_1268
Length 356
Sequence MISERDHVSLRPEQAMIPPGHSWNRLPVIGAACAVLGVNPKQFFFSWLVSFLFFLSLGLGALFFVLIQYASQVPGAAEHDALLRWKAPFLNVPFFLIRAVFYFGCWSVIALLYYNGSRRQDETGDTAVSARLRRFAGPAIIVVALTQTFASIDWIVSLTPHWYSTMFGVYFFAGAFVGFIALLSVVAPAMRAARLLDTVITAEHLHDIGKFLFAFTAFWAYIAFSQFFLIWYANLPEETIWFKARLEGSWEIVSLLLMAGHFGAPFFFLMGRDVKRRASTLALGGTWLLVMHFVDLYWQIMPTLHPEGVRPSALDAAAFLAIGGCFVATAGWRLRRQALVPLRDPRIAESLAFENA

Samples

Sample ID Description Type Environment
1 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
121 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
122 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
166 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
167 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 2.89
Rhizosphere 96.46
Stem 0
Stem Tuber 0
Unclassified 8.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495586_0149685 3300046535 Bacteria 1313
2 JGI25406J46586_10002715 3300003203 Bacteria 8344
3 Ga0065714_10072380 3300005288 Bacteria 3380
4 Ga0065704_10096130 3300005289 Bacteria 2453
5 Ga0065712_10000389 3300005290 Bacteria 11944
6 Ga0065712_10007552 3300005290 Bacteria 2917
7 Ga0065715_10000231 3300005293 Bacteria 39804
8 Ga0065715_10014649 3300005293 Bacteria 3820
9 Ga0065715_10021957 3300005293 Unclassified 1581
10 Ga0065715_10094727 3300005293 Bacteria 4257
11 Ga0065715_10127180 3300005293 Unclassified 2092
12 Ga0065707_10099185 3300005295 Bacteria 3025
13 Ga0065707_10114083 3300005295 Bacteria 2307
14 Ga0070676_10039732 3300005328 Unclassified 2722
15 Ga0070690_100004670 3300005330 Bacteria 7633
16 Ga0070690_100020604 3300005330 Bacteria 4018
17 Ga0070670_100009318 3300005331 Bacteria 8388
18 Ga0070670_100019345 3300005331 Bacteria 5842
19 Ga0070677_10004038 3300005333 Bacteria 4766
20 Ga0070677_10034226 3300005333 Bacteria 1961
21 Ga0068869_100002584 3300005334 Bacteria 10930
22 Ga0068869_100012538 3300005334 Bacteria 5606
23 Ga0070666_10021137 3300005335 Bacteria 4216
24 Ga0068868_100156813 3300005338 Bacteria 1878
25 Ga0070689_100080762 3300005340 Bacteria 2552
26 Ga0070692_10153374 3300005345 Bacteria 1314
27 Ga0070668_100096749 3300005347 Bacteria 2334
28 Ga0070668_100187593 3300005347 Bacteria 1692
29 Ga0070669_100008280 3300005353 Bacteria 7424
30 Ga0070669_100030883 3300005353 Bacteria 3867
31 Ga0070675_100006842 3300005354 Bacteria 8757
32 Ga0070675_100022234 3300005354 Bacteria 5066
33 Ga0070675_100104409 3300005354 Bacteria 2390
34 Ga0070674_100217631 3300005356 Bacteria 1484
35 Ga0070673_100014833 3300005364 Bacteria 5449
36 Ga0070673_100030310 3300005364 Bacteria 4045
37 Ga0070688_100000591 3300005365 Bacteria 18259
38 Ga0070688_100036628 3300005365 Bacteria 2985
39 Ga0070667_100059362 3300005367 Bacteria 3236
40 Ga0070667_100083305 3300005367 Bacteria 2740
41 Ga0070713_100011224 3300005436 Bacteria 6514
42 Ga0070701_10037364 3300005438 Bacteria 2451
43 Ga0070701_10062983 3300005438 Bacteria 1961
44 Ga0070705_100008651 3300005440 Bacteria 5041
45 Ga0070705_100039847 3300005440 Bacteria 2668
46 Ga0070700_100003724 3300005441 Bacteria 7881
47 Ga0070700_100005576 3300005441 Bacteria 6671
48 Ga0070694_100018219 3300005444 Bacteria 4455
49 Ga0070708_100085719 3300005445 Bacteria 2860
50 Ga0070678_100097176 3300005456 Bacteria 2274
51 Ga0070678_100140988 3300005456 Bacteria 1929
52 Ga0070662_100021062 3300005457 Bacteria 4447
53 Ga0070662_100123409 3300005457 Bacteria 1988
54 Ga0070707_100165699 3300005468 Bacteria 2154
55 Ga0070698_100018061 3300005471 Bacteria 7426
56 Ga0070698_100024919 3300005471 Bacteria 6236
57 Ga0070698_100136090 3300005471 Bacteria 2410
58 Ga0070699_100019695 3300005518 Bacteria 5815
59 Ga0070699_100039049 3300005518 Bacteria 4110
60 Ga0070699_100058147 3300005518 Bacteria 3349
61 Ga0070672_100000166 3300005543 Bacteria 36328
62 Ga0070686_100051625 3300005544 Unclassified 2618
63 Ga0070686_100087479 3300005544 Bacteria 2077
64 Ga0070695_100000064 3300005545 Bacteria 42035
65 Ga0070695_100229052 3300005545 Bacteria 1342
66 Ga0070696_100016047 3300005546 Bacteria 5037
67 Ga0070696_100025154 3300005546 Bacteria 4046
68 Ga0070693_100022660 3300005547 Bacteria 3343
69 Ga0070704_100155805 3300005549 Bacteria 1801
70 Ga0070664_100094899 3300005564 Bacteria 2587
71 Ga0070702_100010112 3300005615 Bacteria 4637
72 Ga0068852_100094132 3300005616 Bacteria 2687
73 Ga0068859_100012409 3300005617 Bacteria 8572
74 Ga0068861_100039224 3300005719 Bacteria 3534
75 Ga0068863_100033019 3300005841 Bacteria 4930
76 Ga0068858_100016453 3300005842 Bacteria 6944
77 Ga0068858_100108684 3300005842 Bacteria 2589
78 Ga0068862_100022428 3300005844 Bacteria 5281
79 Ga0081539_10000122 3300005985 Bacteria 183393
80 Ga0075365_10063606 3300006038 Bacteria 2471
81 Ga0075428_100005221 3300006844 Bacteria 14441
82 Ga0075428_100008399 3300006844 Bacteria 11449
83 Ga0075428_100020645 3300006844 Bacteria 7293
84 Ga0075428_100059523 3300006844 Bacteria 4183
85 Ga0075428_100076139 3300006844 Bacteria 3664
86 Ga0075428_100113150 3300006844 Bacteria 2956
87 Ga0075428_100117586 3300006844 Bacteria 2896
88 Ga0075430_100005040 3300006846 Bacteria 11122
89 Ga0075430_100037752 3300006846 Bacteria 4094
90 Ga0075431_100092733 3300006847 Bacteria 3117
91 Ga0075431_100145445 3300006847 Bacteria 2443
92 Ga0075433_10000236 3300006852 Bacteria 31700
93 Ga0075433_10003922 3300006852 Bacteria 11519
94 Ga0075433_10102405 3300006852 Unclassified 2536
95 Ga0075434_100003430 3300006871 Bacteria 14176
96 Ga0075434_100005302 3300006871 Bacteria 11729
97 Ga0075434_100029205 3300006871 Bacteria 5422
98 Ga0075434_100057960 3300006871 Bacteria 3850
99 Ga0075434_100100930 3300006871 Bacteria 2892
100 Ga0075434_100137489 3300006871 Bacteria 2463
101 Ga0075429_100016079 3300006880 Bacteria 6481
102 Ga0075429_100045031 3300006880 Bacteria 3839
103 Ga0075429_100049578 3300006880 Bacteria 3651
104 Ga0075429_100133618 3300006880 Unclassified 2171
105 Ga0075429_100193919 3300006880 Bacteria 1780
106 Ga0068865_100039853 3300006881 Bacteria 3189
107 Ga0097620_100012412 3300006931 Bacteria 8572
108 Ga0075435_100014147 3300007076 Bacteria 5955
109 Ga0075435_100068022 3300007076 Unclassified 2901
110 Ga0075435_100087733 3300007076 Bacteria 2564
111 Ga0075435_100100000 3300007076 Bacteria 2402
112 Ga0111539_10002317 3300009094 Bacteria 25338
113 Ga0111539_10008236 3300009094 Bacteria 13270
114 Ga0111539_10008858 3300009094 Bacteria 12750
115 Ga0111539_10011387 3300009094 Bacteria 11166
116 Ga0111539_10077626 3300009094 Bacteria 3908
117 Ga0111539_10083691 3300009094 Bacteria 3751
118 Ga0111539_10134425 3300009094 Bacteria 2896
119 Ga0111539_10173326 3300009094 Bacteria 2520
120 Ga0105245_10091242 3300009098 Bacteria 2803
121 Ga0114129_10005112 3300009147 Bacteria 18461
122 Ga0114129_10023573 3300009147 Bacteria 8723
123 Ga0114129_10087951 3300009147 Bacteria 4308
124 Ga0114129_10121792 3300009147 Bacteria 3589
125 Ga0114129_10166778 3300009147 Bacteria 3005
126 Ga0114129_10192053 3300009147 Bacteria 2772
127 Ga0114129_10480070 3300009147 Unclassified 1627
128 Ga0105243_10135587 3300009148 Bacteria 2094
129 Ga0105242_10038854 3300009176 Bacteria 3830
130 Ga0105242_10053738 3300009176 Bacteria 3290
131 Ga0105242_10076899 3300009176 Bacteria 2784
132 Ga0105242_10081891 3300009176 Bacteria 2700
133 Ga0105248_10048766 3300009177 Bacteria 4751
134 Ga0105248_10111020 3300009177 Bacteria 3092
135 Ga0105248_10119851 3300009177 Bacteria 2968
136 Ga0105248_10147177 3300009177 Unclassified 2658
137 Ga0105248_10185055 3300009177 Bacteria 2347
138 Ga0105248_10433039 3300009177 Bacteria 1481
139 Ga0105238_10038025 3300009551 Bacteria 4890
140 Ga0105249_10035406 3300009553 Bacteria 4529
141 Ga0105249_10039059 3300009553 Bacteria 4308
142 Ga0105239_10439753 3300010375 Bacteria 1479
143 Ga0105246_10149061 3300011119 Unclassified 1769
144 Ga0163162_10069026 3300013306 Bacteria 3587
145 Ga0157375_10021167 3300013308 Bacteria 5957
146 Ga0157375_10092931 3300013308 Unclassified 3081
147 Ga0163163_10024812 3300014325 Bacteria 5709
148 Ga0163163_10109350 3300014325 Bacteria 2791
149 Ga0157380_10055156 3300014326 Bacteria 3155
150 Ga0157377_10040916 3300014745 Bacteria 2568
151 Ga0157376_10119278 3300014969 Bacteria 2335
152 Ga0207697_10043480 3300025315 Bacteria 1847
153 Ga0207682_10006650 3300025893 Bacteria 4645
154 Ga0207682_10020241 3300025893 Bacteria 2611
155 Ga0207688_10015094 3300025901 Bacteria 4190
156 Ga0207688_10036083 3300025901 Bacteria 2740
157 Ga0207680_10009600 3300025903 Bacteria 4806
158 Ga0207645_10050073 3300025907 Unclassified 2667
159 Ga0207660_10152695 3300025917 Bacteria 1776
160 Ga0207662_10077120 3300025918 Bacteria 2027
161 Ga0207681_10007304 3300025923 Bacteria 6770
162 Ga0207650_10007091 3300025925 Bacteria 7636
163 Ga0207650_10014247 3300025925 Bacteria 5524
164 Ga0207659_10000585 3300025926 Bacteria 21814
165 Ga0207659_10037025 3300025926 Bacteria 3385
166 Ga0207644_10121871 3300025931 Bacteria 1986
167 Ga0207706_10020644 3300025933 Bacteria 5920
168 Ga0207686_10059809 3300025934 Bacteria 2409
169 Ga0207686_10095905 3300025934 Bacteria 1969
170 Ga0207709_10089350 3300025935 Bacteria 2008
171 Ga0207670_10010486 3300025936 Bacteria 5342
172 Ga0207670_10048122 3300025936 Bacteria 2843
173 Ga0207669_10007218 3300025937 Bacteria 5121
174 Ga0207669_10091821 3300025937 Bacteria 1979
175 Ga0207691_10000888 3300025940 Bacteria 29662
176 Ga0207711_10065513 3300025941 Bacteria 3141
177 Ga0207711_10091408 3300025941 Bacteria 2677
178 Ga0207711_10097411 3300025941 Bacteria 2597
179 Ga0207689_10005502 3300025942 Bacteria 11327
180 Ga0207679_10134542 3300025945 Bacteria 1989
181 Ga0207651_10075604 3300025960 Bacteria 2404
182 Ga0207712_10023261 3300025961 Bacteria 4088
183 Ga0207712_10050189 3300025961 Unclassified 2912
184 Ga0207668_10019404 3300025972 Bacteria 4298
185 Ga0207668_10060557 3300025972 Bacteria 2658
186 Ga0207640_10148824 3300025981 Bacteria 1717
187 Ga0207658_10038262 3300025986 Bacteria 3454
188 Ga0207708_10022350 3300026075 Bacteria 4776
189 Ga0207708_10030313 3300026075 Bacteria 4101
190 Ga0207641_10012980 3300026088 Bacteria 6835
191 Ga0207675_100079360 3300026118 Bacteria 3076
192 Ga0207683_10168160 3300026121 Bacteria 1985
193 Ga0207428_10001048 3300027907 Bacteria 30412
194 Ga0207428_10005616 3300027907 Bacteria 11662
195 Ga0207428_10009116 3300027907 Bacteria 8917
196 Ga0207428_10029704 3300027907 Bacteria 4527
197 Ga0207428_10039196 3300027907 Bacteria 3846
198 Ga0268266_10005560 3300028379 Bacteria 11731
199 Ga0268265_10013981 3300028380 Bacteria 5466
200 Ga0307408_100097136 3300031548 Bacteria 2237
201 Ga0307408_100136323 3300031548 Bacteria 1921
202 Ga0307410_10045114 3300031852 Unclassified 2933
203 Ga0307410_10080267 3300031852 Bacteria 2288
204 Ga0307410_10192703 3300031852 Bacteria 1551
205 Ga0307406_10040820 3300031901 Bacteria 2888
206 Ga0307409_100253895 3300031995 Unclassified 1609
207 Ga0307416_100021642 3300032002 Bacteria 4622
208 Ga0307416_100068232 3300032002 Bacteria 2937
209 Ga0307416_100086451 3300032002 Bacteria 2673
210 Ga0307416_100407377 3300032002 Bacteria 1399
211 Ga0307411_10032554 3300032005 Bacteria 3223
212 Ga0307411_10055417 3300032005 Bacteria 2608
213 Ga0307411_10099327 3300032005 Unclassified 2054
214 Ga0373932_0011268 3300035112 Unclassified 2181
215 Ga0373936_0016206 3300035113 Bacteria 2866
216 Ga0373962_0014537 3300035242 Bacteria 2007
217 Ga0373935_0066373 3300035692 Unclassified 2318
218 Ga0373937_0008019 3300036401 Bacteria 9154
219 Ga0373925_0143377 3300037068 Bacteria 1871
220 Ga0439434_0010609 3300042435 Bacteria 2717
221 Ga0439434_0023508 3300042435 Unclassified 1857
222 Ga0439464_0050586 3300042439 Bacteria 1201
223 Ga0439460_0027556 3300042461 Bacteria 1597
224 Ga0451577_0005412 3300042876 Bacteria 13097
225 Ga0451576_0006845 3300045051 Bacteria 13828
226 Ga0451576_0100788 3300045051 Bacteria 3003
227 Ga0451576_0158260 3300045051 Bacteria 2363
228 Ga0495603_0074440 3300046455 Unclassified 1994
229 Ga0495584_0023961 3300046491 Bacteria 3094
230 Ga0495608_0194746 3300046511 Bacteria 1279
231 Ga0495598_0008975 3300046537 Bacteria 2346
232 Ga0495621_0009505 3300046539 Bacteria 2954
233 Ga0495659_0011671 3300046664 Unclassified 2832
234 Ga0495659_0068625 3300046664 Bacteria 1324
235 Ga0495669_0061067 3300046684 Bacteria 1705
236 Ga0495613_0142353 3300046689 Bacteria 1713
237 Ga0495600_0208234 3300046809 Bacteria 1254
238 Ga0495674_0152694 3300047319 Bacteria 1936
239 Ga0496101_0034166 3300048904 Bacteria 3590
240 Ga0496101_0086491 3300048904 Bacteria 2325
241 Ga0496104_0029634 3300048907 Bacteria 5077
242 Ga0496104_0100747 3300048907 Bacteria 2765
243 Ga0496105_0076959 3300048908 Bacteria 2755
244 Ga0496106_0192959 3300048909 Bacteria 1620
245 Ga0496109_0004351 3300048912 Bacteria 11839
246 Ga0496112_0006706 3300048915 Bacteria 10140
247 Ga0496114_0003715 3300048917 Bacteria 11751
248 Ga0501031_0036322 3300049568 Bacteria 3214
249 Ga0501034_0057291 3300049571 Bacteria 3918
250 Ga0501036_0056324 3300049572 Bacteria 3331
251 Ga0501039_0055543 3300049575 Bacteria 3067
252 Ga0501039_0120612 3300049575 Bacteria 2055
253 Ga0501040_0021619 3300049576 Bacteria 4299
254 Ga0501046_0027727 3300049580 Bacteria 4618
255 Ga0501047_0209378 3300049581 Bacteria 1809
256 Ga0501071_0105523 3300049587 Bacteria 2080
257 Ga0501072_0088088 3300049588 Bacteria 2463
258 Ga0501072_0099433 3300049588 Bacteria 2312
259 Ga0501075_0144168 3300049591 Bacteria 1815
260 Ga0501075_0252249 3300049591 Bacteria 1345
261 Ga0501076_0025118 3300049592 Bacteria 4609
262 Ga0501076_0030338 3300049592 Bacteria 4211
263 Ga0501076_0039288 3300049592 Bacteria 3716
264 Ga0501076_0145545 3300049592 Bacteria 1927
265 Ga0501079_0105815 3300049741 Bacteria 2183
266 Ga0501079_0230406 3300049741 Bacteria 1447
267 Ga0501079_0235984 3300049741 Bacteria 1429
268 Ga0501080_0047129 3300049742 Bacteria 4012
269 Ga0501081_0059150 3300049743 Bacteria 2653
270 nmdc:mga0yw44_65403_c1 3300050492 Bacteria 2241
271 nmdc:mga05p37_12451_c1 3300050507 Bacteria 10159
272 nmdc:mga05p37_145019_c1 3300050507 Bacteria 2908
273 nmdc:mga05p37_173774_c1 3300050507 Bacteria 2626
274 nmdc:mga05p37_17769_c1 3300050507 Bacteria 8582
275 nmdc:mga05p37_54872_c1 3300050507 Bacteria 4901
276 nmdc:mga09592_126969_c1 3300050508 Unclassified 2193
277 nmdc:mga09592_1527_c1 3300050508 Bacteria 18657
278 nmdc:mga09592_210532_c1 3300050508 Bacteria 1684
279 nmdc:mga09592_263853_c1 3300050508 Unclassified 1494
280 nmdc:mga09592_39545_c1 3300050508 Bacteria 3962
281 nmdc:mga09592_43113_c1 3300050508 Bacteria 3796
282 nmdc:mga0qj67_30964_c1 3300050509 Bacteria 4166
283 nmdc:mga0qj67_5865_c1 3300050509 Bacteria 8994
284 nmdc:mga06r32_151600_c1 3300050510 Bacteria 2297
285 nmdc:mga06r32_28354_c1 3300050510 Bacteria 5238
286 nmdc:mga06r32_58252_c1 3300050510 Bacteria 3713
287 nmdc:mga06r32_9918_c1 3300050510 Bacteria 8595
288 nmdc:mga08y16_166962_c1 3300050511 Bacteria 2286
289 nmdc:mga08y16_17148_c1 3300050511 Bacteria 7624
290 nmdc:mga08y16_29537_c1 3300050511 Bacteria 5775
291 nmdc:mga08y16_6943_c1 3300050511 Bacteria 11869
292 nmdc:mga08y16_7357_c1 3300050511 Bacteria 11549
293 nmdc:mga08y16_98611_c1 3300050511 Bacteria 3043
294 nmdc:mga0n895_15272_c1 3300050512 Bacteria 6997
295 nmdc:mga0n895_2440_c1 3300050512 Bacteria 14517
296 nmdc:mga0n895_290374_c1 3300050512 Unclassified 1658
297 nmdc:mga0n895_66355_c1 3300050512 Bacteria 3573
298 nmdc:mga0rr50_30920_c1 3300050513 Bacteria 3796
299 nmdc:mga0rr50_55367_c1 3300050513 Bacteria 2959
300 nmdc:mga0rr50_62235_c1 3300050513 Unclassified 2814
301 nmdc:mga0rr50_65577_c1 3300050513 Bacteria 2751
302 nmdc:mga0a205_293_c2 3300050515 Bacteria 34916
303 nmdc:mga0a205_43954_c1 3300050515 Bacteria 4306
304 nmdc:mga0a205_46749_c1 3300050515 Bacteria 4174
305 Ga0495595_0024295 3300053084 Bacteria 2677
306 Ga0590075_000106 3300059424 Bacteria 21524
307 Ga0590077_000712 3300059426 Bacteria 8805
308 Ga0501082_0038045 3300060353 Bacteria 4150
309 Ga0501082_0046977 3300060353 Bacteria 3721
310 Ga0501082_0194837 3300060353 Bacteria 1763
311 Ga0530510_0006258 3300061734 Bacteria 8280
312 Ga0495586_0149685
313 JGI25406J46586_10002715
314 Ga0065714_10072380
315 Ga0065704_10096130
316 Ga0065712_10000389
317 Ga0065712_10007552
318 Ga0065715_10000231
319 Ga0065715_10014649
320 Ga0065715_10021957
321 Ga0065715_10094727
322 Ga0065715_10127180
323 Ga0065707_10099185
324 Ga0065707_10114083
325 Ga0070676_10039732
326 Ga0070690_100004670
327 Ga0070690_100020604
328 Ga0070670_100009318
329 Ga0070670_100019345
330 Ga0070677_10004038
331 Ga0070677_10034226
332 Ga0068869_100002584
333 Ga0068869_100012538
334 Ga0070666_10021137
335 Ga0068868_100156813
336 Ga0070689_100080762
337 Ga0070692_10153374
338 Ga0070668_100096749
339 Ga0070668_100187593
340 Ga0070669_100008280
341 Ga0070669_100030883
342 Ga0070675_100006842
343 Ga0070675_100022234
344 Ga0070675_100104409
345 Ga0070674_100217631
346 Ga0070673_100014833
347 Ga0070673_100030310
348 Ga0070688_100000591
349 Ga0070688_100036628
350 Ga0070667_100059362
351 Ga0070667_100083305
352 Ga0070713_100011224
353 Ga0070701_10037364
354 Ga0070701_10062983
355 Ga0070705_100008651
356 Ga0070705_100039847
357 Ga0070700_100003724
358 Ga0070700_100005576
359 Ga0070694_100018219
360 Ga0070708_100085719
361 Ga0070678_100097176
362 Ga0070678_100140988
363 Ga0070662_100021062
364 Ga0070662_100123409
365 Ga0070707_100165699
366 Ga0070698_100018061
367 Ga0070698_100024919
368 Ga0070698_100136090
369 Ga0070699_100019695
370 Ga0070699_100039049
371 Ga0070699_100058147
372 Ga0070672_100000166
373 Ga0070686_100051625
374 Ga0070686_100087479
375 Ga0070695_100000064
376 Ga0070695_100229052
377 Ga0070696_100016047
378 Ga0070696_100025154
379 Ga0070693_100022660
380 Ga0070704_100155805
381 Ga0070664_100094899
382 Ga0070702_100010112
383 Ga0068852_100094132
384 Ga0068859_100012409
385 Ga0068861_100039224
386 Ga0068863_100033019
387 Ga0068858_100016453
388 Ga0068858_100108684
389 Ga0068862_100022428
390 Ga0081539_10000122
391 Ga0075365_10063606
392 Ga0075428_100005221
393 Ga0075428_100008399
394 Ga0075428_100020645
395 Ga0075428_100059523
396 Ga0075428_100076139
397 Ga0075428_100113150
398 Ga0075428_100117586
399 Ga0075430_100005040
400 Ga0075430_100037752
401 Ga0075431_100092733
402 Ga0075431_100145445
403 Ga0075433_10000236
404 Ga0075433_10003922
405 Ga0075433_10102405
406 Ga0075434_100003430
407 Ga0075434_100005302
408 Ga0075434_100029205
409 Ga0075434_100057960
410 Ga0075434_100100930
411 Ga0075434_100137489
412 Ga0075429_100016079
413 Ga0075429_100045031
414 Ga0075429_100049578
415 Ga0075429_100133618
416 Ga0075429_100193919
417 Ga0068865_100039853
418 Ga0097620_100012412
419 Ga0075435_100014147
420 Ga0075435_100068022
421 Ga0075435_100087733
422 Ga0075435_100100000
423 Ga0111539_10002317
424 Ga0111539_10008236
425 Ga0111539_10008858
426 Ga0111539_10011387
427 Ga0111539_10077626
428 Ga0111539_10083691
429 Ga0111539_10134425
430 Ga0111539_10173326
431 Ga0105245_10091242
432 Ga0114129_10005112
433 Ga0114129_10023573
434 Ga0114129_10087951
435 Ga0114129_10121792
436 Ga0114129_10166778
437 Ga0114129_10192053
438 Ga0114129_10480070
439 Ga0105243_10135587
440 Ga0105242_10038854
441 Ga0105242_10053738
442 Ga0105242_10076899
443 Ga0105242_10081891
444 Ga0105248_10048766
445 Ga0105248_10111020
446 Ga0105248_10119851
447 Ga0105248_10147177
448 Ga0105248_10185055
449 Ga0105248_10433039
450 Ga0105238_10038025
451 Ga0105249_10035406
452 Ga0105249_10039059
453 Ga0105239_10439753
454 Ga0105246_10149061
455 Ga0163162_10069026
456 Ga0157375_10021167
457 Ga0157375_10092931
458 Ga0163163_10024812
459 Ga0163163_10109350
460 Ga0157380_10055156
461 Ga0157377_10040916
462 Ga0157376_10119278
463 Ga0207697_10043480
464 Ga0207682_10006650
465 Ga0207682_10020241
466 Ga0207688_10015094
467 Ga0207688_10036083
468 Ga0207680_10009600
469 Ga0207645_10050073
470 Ga0207660_10152695
471 Ga0207662_10077120
472 Ga0207681_10007304
473 Ga0207650_10007091
474 Ga0207650_10014247
475 Ga0207659_10000585
476 Ga0207659_10037025
477 Ga0207644_10121871
478 Ga0207706_10020644
479 Ga0207686_10059809
480 Ga0207686_10095905
481 Ga0207709_10089350
482 Ga0207670_10010486
483 Ga0207670_10048122
484 Ga0207669_10007218
485 Ga0207669_10091821
486 Ga0207691_10000888
487 Ga0207711_10065513
488 Ga0207711_10091408
489 Ga0207711_10097411
490 Ga0207689_10005502
491 Ga0207679_10134542
492 Ga0207651_10075604
493 Ga0207712_10023261
494 Ga0207712_10050189
495 Ga0207668_10019404
496 Ga0207668_10060557
497 Ga0207640_10148824
498 Ga0207658_10038262
499 Ga0207708_10022350
500 Ga0207708_10030313
501 Ga0207641_10012980
502 Ga0207675_100079360
503 Ga0207683_10168160
504 Ga0207428_10001048
505 Ga0207428_10005616
506 Ga0207428_10009116
507 Ga0207428_10029704
508 Ga0207428_10039196
509 Ga0268266_10005560
510 Ga0268265_10013981
511 Ga0307408_100097136
512 Ga0307408_100136323
513 Ga0307410_10045114
514 Ga0307410_10080267
515 Ga0307410_10192703
516 Ga0307406_10040820
517 Ga0307409_100253895
518 Ga0307416_100021642
519 Ga0307416_100068232
520 Ga0307416_100086451
521 Ga0307416_100407377
522 Ga0307411_10032554
523 Ga0307411_10055417
524 Ga0307411_10099327
525 Ga0373932_0011268
526 Ga0373936_0016206
527 Ga0373962_0014537
528 Ga0373935_0066373
529 Ga0373937_0008019
530 Ga0373925_0143377
531 Ga0439434_0010609
532 Ga0439434_0023508
533 Ga0439464_0050586
534 Ga0439460_0027556
535 Ga0451577_0005412
536 Ga0451576_0006845
537 Ga0451576_0100788
538 Ga0451576_0158260
539 Ga0495603_0074440
540 Ga0495584_0023961
541 Ga0495608_0194746
542 Ga0495598_0008975
543 Ga0495621_0009505
544 Ga0495659_0011671
545 Ga0495659_0068625
546 Ga0495669_0061067
547 Ga0495613_0142353
548 Ga0495600_0208234
549 Ga0495674_0152694
550 Ga0496101_0034166
551 Ga0496101_0086491
552 Ga0496104_0029634
553 Ga0496104_0100747
554 Ga0496105_0076959
555 Ga0496106_0192959
556 Ga0496109_0004351
557 Ga0496112_0006706
558 Ga0496114_0003715
559 Ga0501031_0036322
560 Ga0501034_0057291
561 Ga0501036_0056324
562 Ga0501039_0055543
563 Ga0501039_0120612
564 Ga0501040_0021619
565 Ga0501046_0027727
566 Ga0501047_0209378
567 Ga0501071_0105523
568 Ga0501072_0088088
569 Ga0501072_0099433
570 Ga0501075_0144168
571 Ga0501075_0252249
572 Ga0501076_0025118
573 Ga0501076_0030338
574 Ga0501076_0039288
575 Ga0501076_0145545
576 Ga0501079_0105815
577 Ga0501079_0230406
578 Ga0501079_0235984
579 Ga0501080_0047129
580 Ga0501081_0059150
581 nmdc:mga0yw44_65403_c1
582 nmdc:mga05p37_12451_c1
583 nmdc:mga05p37_145019_c1
584 nmdc:mga05p37_173774_c1
585 nmdc:mga05p37_17769_c1
586 nmdc:mga05p37_54872_c1
587 nmdc:mga09592_126969_c1
588 nmdc:mga09592_1527_c1
589 nmdc:mga09592_210532_c1
590 nmdc:mga09592_263853_c1
591 nmdc:mga09592_39545_c1
592 nmdc:mga09592_43113_c1
593 nmdc:mga0qj67_30964_c1
594 nmdc:mga0qj67_5865_c1
595 nmdc:mga06r32_151600_c1
596 nmdc:mga06r32_28354_c1
597 nmdc:mga06r32_58252_c1
598 nmdc:mga06r32_9918_c1
599 nmdc:mga08y16_166962_c1
600 nmdc:mga08y16_17148_c1
601 nmdc:mga08y16_29537_c1
602 nmdc:mga08y16_6943_c1
603 nmdc:mga08y16_7357_c1
604 nmdc:mga08y16_98611_c1
605 nmdc:mga0n895_15272_c1
606 nmdc:mga0n895_2440_c1
607 nmdc:mga0n895_290374_c1
608 nmdc:mga0n895_66355_c1
609 nmdc:mga0rr50_30920_c1
610 nmdc:mga0rr50_55367_c1
611 nmdc:mga0rr50_62235_c1
612 nmdc:mga0rr50_65577_c1
613 nmdc:mga0a205_293_c2
614 nmdc:mga0a205_43954_c1
615 nmdc:mga0a205_46749_c1
616 Ga0495595_0024295
617 Ga0590075_000106
618 Ga0590077_000712
619 Ga0501082_0038045
620 Ga0501082_0046977
621 Ga0501082_0194837
622 Ga0530510_0006258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_F cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.9075 23 393
6f0k-assembly1.cif.gz_F alternative complex iii 0.8981 23 389
6btm-assembly1.cif.gz_F structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.8645 20 390
6f0k-assembly1.cif.gz_F alternative complex iii 0.8622 23 389
6loe-assembly1.cif.gz_F cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.8565 23 393
ID Description Score Start End Superfamily
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6749 38 341 1.20.1630.10
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6496 38 341 1.20.1630.10
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5773 44 333 1.20.1630.10
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5572 44 333 1.20.1630.10
af_A0A1D6K380_240_374_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.4718 60 206 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A7V9Q7P3-F1-model_v4 Quinol:cytochrome C oxidoreductase 0.9689 38 209 GO:0016020
AF-A0A350PIB0-F1-model_v4 Quinol:cytochrome C oxidoreductase 0.9617 30 253 GO:0016020
AF-A0A3L7T897-F1-model_v4 Quinol:cytochrome C oxidoreductase 0.9606 28 256
AF-A0A359E5L4-F1-model_v4 Acyl-CoA desaturase 0.9602 105 213 GO:0016020
AF-A0A2V8GQ93-F1-model_v4 Quinol:cytochrome C oxidoreductase 0.9572 28 196 GO:0016020

Map