F401249

General Info

Members Datasets Scaffolds Average Seq Length
311 206 622 158

Family's Representative Sequence

Representative Sequence 3300025949|Ga0207667_11222288|Ga0207667_112222881
Length 180
Sequence MKNGSWSITTQNPESREAKGAHMSTIHLHQTTTLTPEQYTAGLTDFGPGRAKLFGNSADEYLKVHSRGPSQADVTEGSGGIWERLHYDWSDPNHVVLTTTDSNAWGGASGHTYTFTRQPDGTTDIDLVVVRDGKNLKGRLLGFVLGTIGKSVLEKAFQNSVKAIEVRNSATRQAGASSAG

Samples

Sample ID Description Type Environment
1 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
201 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
202 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
203 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
204 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
205 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
206 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.11
Metatranscriptomes 0.64
Isolates 2.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.32
Rhizoplane 3.86
Rhizosphere 91.64
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207667_11222288 3300025949 Bacteria 730
2 rootL2_10134909 3300003322 Bacteria 3394
3 Ga0065712_10188708 3300005290 Bacteria 1129
4 Ga0070690_100420689 3300005330 Bacteria 985
5 Ga0070690_101131785 3300005330 Bacteria 622
6 Ga0070670_100006940 3300005331 Bacteria 9601
7 Ga0068869_100094787 3300005334 Bacteria 2251
8 Ga0070666_10000945 3300005335 Bacteria 17686
9 Ga0070680_100195473 3300005336 Bacteria 1705
10 Ga0068868_100012989 3300005338 Bacteria 6094
11 Ga0070660_100322269 3300005339 Bacteria 1270
12 Ga0070661_100008052 3300005344 Bacteria 7276
13 Ga0070675_100684612 3300005354 Bacteria 933
14 Ga0070671_100217203 3300005355 Bacteria 1622
15 Ga0070674_100947191 3300005356 Bacteria 753
16 Ga0070659_101075351 3300005366 Bacteria 708
17 Ga0070667_100015801 3300005367 Bacteria 6245
18 Ga0070667_100253411 3300005367 Bacteria 1574
19 Ga0070703_10345214 3300005406 Bacteria 634
20 Ga0070709_10002832 3300005434 Bacteria 9372
21 Ga0070709_10063984 3300005434 Bacteria 2351
22 Ga0070713_100000509 3300005436 Bacteria 24860
23 Ga0070713_100082185 3300005436 Bacteria 2750
24 Ga0070713_100343196 3300005436 Bacteria 1384
25 Ga0070713_100638244 3300005436 Bacteria 1013
26 Ga0070710_10174642 3300005437 Bacteria 1341
27 Ga0070710_10427729 3300005437 Bacteria 893
28 Ga0070710_10875043 3300005437 Bacteria 647
29 Ga0070711_100025411 3300005439 Bacteria 3875
30 Ga0070711_100144621 3300005439 Bacteria 1787
31 Ga0070711_100783253 3300005439 Bacteria 808
32 Ga0070663_101307083 3300005455 Bacteria 640
33 Ga0070681_10503566 3300005458 Bacteria 1124
34 Ga0068867_100044256 3300005459 Bacteria 3261
35 Ga0070707_101131560 3300005468 Bacteria 749
36 Ga0070698_100006473 3300005471 Bacteria 12705
37 Ga0070699_100004309 3300005518 Bacteria 12581
38 Ga0070684_100027695 3300005535 Bacteria 4786
39 Ga0070697_100212965 3300005536 Bacteria 1645
40 Ga0070697_100494001 3300005536 Bacteria 1069
41 Ga0070697_100794814 3300005536 Bacteria 837
42 Ga0068853_100430775 3300005539 Bacteria 1238
43 Ga0070672_100221463 3300005543 Bacteria 1587
44 Ga0070696_100122763 3300005546 Bacteria 1881
45 Ga0070696_101338606 3300005546 Bacteria 609
46 Ga0070693_100327530 3300005547 Bacteria 1041
47 Ga0070665_100091373 3300005548 Bacteria 3049
48 Ga0068855_100024348 3300005563 Bacteria 7245
49 Ga0070664_100004541 3300005564 Bacteria 11138
50 Ga0068857_100164603 3300005577 Bacteria 2014
51 Ga0068854_100217376 3300005578 Bacteria 1510
52 Ga0068854_100486233 3300005578 Bacteria 1037
53 Ga0068856_100006689 3300005614 Bacteria 11300
54 Ga0068856_100169676 3300005614 Unclassified 2194
55 Ga0070702_100973240 3300005615 Bacteria 670
56 Ga0068852_100018843 3300005616 Bacteria 5447
57 Ga0068859_100018448 3300005617 Bacteria 7013
58 Ga0068864_100014410 3300005618 Bacteria 6566
59 Ga0068866_10123752 3300005718 Bacteria 1461
60 Ga0068863_100060974 3300005841 Bacteria 3567
61 Ga0068858_100009195 3300005842 Bacteria 9443
62 Ga0068858_100013587 3300005842 Bacteria 7684
63 Ga0068860_100011708 3300005843 Bacteria 8645
64 Ga0068860_100820646 3300005843 Unclassified 944
65 Ga0081540_1018571 3300005983 Bacteria 4259
66 Ga0070717_10752413 3300006028 Bacteria 886
67 Ga0070715_10034017 3300006163 Bacteria 2086
68 Ga0070716_100011462 3300006173 Bacteria 4465
69 Ga0070716_100065969 3300006173 Bacteria 2110
70 Ga0070716_100471515 3300006173 Bacteria 920
71 Ga0070712_100000134 3300006175 Bacteria 38860
72 Ga0070712_100075778 3300006175 Bacteria 2420
73 Ga0070712_100200377 3300006175 Bacteria 1568
74 Ga0070712_100385129 3300006175 Bacteria 1155
75 Ga0097621_100002285 3300006237 Bacteria 13129
76 Ga0097621_100296449 3300006237 Bacteria 1427
77 Ga0097621_100391242 3300006237 Bacteria 1243
78 Ga0097621_100910672 3300006237 Unclassified 819
79 Ga0068871_100006514 3300006358 Bacteria 8270
80 Ga0068871_101986653 3300006358 Unclassified 553
81 Ga0068865_100111117 3300006881 Bacteria 2022
82 Ga0097620_100018449 3300006931 Bacteria 7013
83 Ga0105240_10012223 3300009093 Bacteria 11867
84 Ga0111539_10063217 3300009094 Bacteria 4380
85 Ga0105245_10006821 3300009098 Bacteria 10021
86 Ga0105247_10241495 3300009101 Bacteria 1231
87 Ga0105241_10021626 3300009174 Bacteria 4758
88 Ga0105241_10156732 3300009174 Unclassified 1868
89 Ga0105242_10016170 3300009176 Bacteria 5795
90 Ga0105242_10049555 3300009176 Bacteria 3418
91 Ga0105248_10003181 3300009177 Bacteria 18199
92 Ga0105237_10000628 3300009545 Bacteria 49290
93 Ga0105237_10256366 3300009545 Bacteria 1751
94 Ga0105238_10014753 3300009551 Bacteria 7902
95 Ga0105249_10028967 3300009553 Bacteria 4999
96 Ga0105249_10291995 3300009553 Bacteria 1632
97 Ga0105239_10000288 3300010375 Bacteria 74273
98 Ga0105239_10585755 3300010375 Bacteria 1272
99 Ga0105239_10707711 3300010375 Bacteria 1152
100 Ga0105246_10401719 3300011119 Bacteria 1138
101 Ga0157373_10069478 3300013100 Bacteria 2490
102 Ga0157371_10007036 3300013102 Bacteria 9153
103 Ga0157369_10012755 3300013105 Bacteria 9530
104 Ga0157369_10212614 3300013105 Bacteria 2026
105 Ga0157374_10000787 3300013296 Bacteria 27777
106 Ga0157374_10083933 3300013296 Bacteria 3027
107 Ga0157374_10180974 3300013296 Bacteria 2059
108 Ga0157378_10000311 3300013297 Bacteria 47572
109 Ga0157378_10001217 3300013297 Bacteria 23322
110 Ga0163162_10009587 3300013306 Bacteria 9419
111 Ga0157372_10000966 3300013307 Bacteria 31334
112 Ga0157372_10004035 3300013307 Bacteria 15745
113 Ga0157372_10343412 3300013307 Bacteria 1739
114 Ga0157375_10015844 3300013308 Bacteria 6755
115 Ga0157375_10329939 3300013308 Bacteria 1690
116 Ga0157375_11469563 3300013308 Bacteria 804
117 Ga0163163_10041007 3300014325 Bacteria 4525
118 Ga0163163_10199813 3300014325 Bacteria 2047
119 Ga0163163_10264166 3300014325 Unclassified 1772
120 Ga0163163_10507817 3300014325 Bacteria 1267
121 Ga0163163_11415103 3300014325 Bacteria 757
122 Ga0157380_10379136 3300014326 Bacteria 1334
123 Ga0157377_10278505 3300014745 Bacteria 1095
124 Ga0157379_10038636 3300014968 Bacteria 4257
125 Ga0157379_10900128 3300014968 Unclassified 839
126 Ga0157376_10051448 3300014969 Bacteria 3422
127 Ga0157376_10133977 3300014969 Bacteria 2215
128 Ga0157376_10230627 3300014969 Bacteria 1720
129 Ga0157376_10566343 3300014969 Bacteria 1126
130 Ga0163161_10070279 3300017792 Bacteria 2560
131 Ga0213872_10236465 3300021361 Bacteria 773
132 Ga0213876_10000169 3300021384 Bacteria 68458
133 Ga0213876_10032123 3300021384 Bacteria 2769
134 Ga0207692_10159785 3300025898 Bacteria 1298
135 Ga0207692_10365356 3300025898 Bacteria 893
136 Ga0207692_10519245 3300025898 Bacteria 758
137 Ga0207642_10032945 3300025899 Bacteria 2187
138 Ga0207642_10097212 3300025899 Bacteria 1469
139 Ga0207680_10007312 3300025903 Bacteria 5376
140 Ga0207647_10036494 3300025904 Bacteria 3123
141 Ga0207647_10037487 3300025904 Bacteria 3074
142 Ga0207685_10014875 3300025905 Bacteria 2448
143 Ga0207699_10001452 3300025906 Bacteria 11252
144 Ga0207699_10301081 3300025906 Bacteria 1120
145 Ga0207705_10368134 3300025909 Bacteria 1109
146 Ga0207654_10003967 3300025911 Bacteria 7452
147 Ga0207654_10112787 3300025911 Bacteria 1694
148 Ga0207707_10057292 3300025912 Bacteria 3391
149 Ga0207695_10277030 3300025913 Bacteria 1572
150 Ga0207671_10007548 3300025914 Bacteria 9416
151 Ga0207671_10484604 3300025914 Bacteria 986
152 Ga0207693_10000051 3300025915 Bacteria 99220
153 Ga0207693_10020645 3300025915 Bacteria 5238
154 Ga0207693_10077496 3300025915 Bacteria 2603
155 Ga0207693_10298598 3300025915 Bacteria 1262
156 Ga0207693_10715920 3300025915 Unclassified 775
157 Ga0207663_10006556 3300025916 Bacteria 5971
158 Ga0207663_10108457 3300025916 Bacteria 1880
159 Ga0207663_10324010 3300025916 Bacteria 1159
160 Ga0207663_10327488 3300025916 Bacteria 1153
161 Ga0207663_10553817 3300025916 Bacteria 899
162 Ga0207660_10093755 3300025917 Bacteria 2231
163 Ga0207662_10302589 3300025918 Bacteria 1063
164 Ga0207657_10312544 3300025919 Bacteria 1243
165 Ga0207649_10034856 3300025920 Bacteria 3019
166 Ga0207652_10825801 3300025921 Bacteria 822
167 Ga0207646_10080186 3300025922 Bacteria 2919
168 Ga0207694_10010824 3300025924 Bacteria 6886
169 Ga0207694_10981227 3300025924 Bacteria 715
170 Ga0207650_10043377 3300025925 Bacteria 3301
171 Ga0207659_10593275 3300025926 Bacteria 944
172 Ga0207687_10001558 3300025927 Bacteria 15752
173 Ga0207687_10304131 3300025927 Bacteria 1285
174 Ga0207700_10027842 3300025928 Bacteria 3964
175 Ga0207700_10543378 3300025928 Bacteria 1031
176 Ga0207700_10581890 3300025928 Bacteria 995
177 Ga0207686_10005110 3300025934 Bacteria 7056
178 Ga0207686_10253497 3300025934 Bacteria 1287
179 Ga0207709_10000513 3300025935 Bacteria 34041
180 Ga0207704_10529380 3300025938 Bacteria 954
181 Ga0207665_10006288 3300025939 Bacteria 7877
182 Ga0207665_10088361 3300025939 Bacteria 2144
183 Ga0207665_10175432 3300025939 Bacteria 1550
184 Ga0207711_10003495 3300025941 Bacteria 13600
185 Ga0207689_10111021 3300025942 Bacteria 2253
186 Ga0207689_10312347 3300025942 Bacteria 1304
187 Ga0207661_10107461 3300025944 Bacteria 2354
188 Ga0207679_10459672 3300025945 Bacteria 1130
189 Ga0207667_10927482 3300025949 Bacteria 861
190 Ga0207712_10017500 3300025961 Bacteria 4655
191 Ga0207712_10187093 3300025961 Bacteria 1631
192 Ga0207640_10016568 3300025981 Bacteria 4290
193 Ga0207658_10028997 3300025986 Bacteria 3903
194 Ga0207677_10001100 3300026023 Bacteria 14736
195 Ga0207677_10151350 3300026023 Bacteria 1790
196 Ga0207703_10027341 3300026035 Bacteria 4492
197 Ga0207703_10027909 3300026035 Bacteria 4445
198 Ga0207703_11564028 3300026035 Bacteria 634
199 Ga0207639_10217290 3300026041 Unclassified 1649
200 Ga0207639_10563667 3300026041 Bacteria 1047
201 Ga0207702_10011258 3300026078 Bacteria 7457
202 Ga0207702_10145873 3300026078 Unclassified 2147
203 Ga0207702_11197427 3300026078 Bacteria 754
204 Ga0207641_10021798 3300026088 Bacteria 5267
205 Ga0207641_10168834 3300026088 Bacteria 1995
206 Ga0207648_10035060 3300026089 Bacteria 4423
207 Ga0207676_10251674 3300026095 Bacteria 1590
208 Ga0207676_10851754 3300026095 Bacteria 892
209 Ga0207674_10002659 3300026116 Bacteria 22308
210 Ga0207698_10012938 3300026142 Bacteria 5485
211 Ga0207428_10167359 3300027907 Bacteria 1666
212 Ga0268264_10004215 3300028381 Bacteria 12271
213 Ga0268264_10115521 3300028381 Bacteria 2358
214 Ga0265319_1089377 3300028563 Bacteria 973
215 Ga0265338_10011363 3300028800 Bacteria 10293
216 Ga0265760_10308803 3300031090 Bacteria 561
217 Ga0265325_10000931 3300031241 Bacteria 21133
218 Ga0373954_0444049 3300035118 Bacteria 642
219 Ga0373927_0017455 3300035695 Bacteria 4722
220 Ga0373927_0250868 3300035695 Bacteria 1163
221 Ga0373927_0684182 3300035695 Bacteria 678
222 Ga0373937_0000877 3300036401 Bacteria 25821
223 Ga0373925_0360830 3300037068 Bacteria 1181
224 Ga0395901_1857978 3300038443 Bacteria 551
225 Ga0436365_0331476 3300039437 Bacteria 5308
226 Ga0436365_1207177 3300039437 Bacteria 90363
227 Ga0436361_0331474 3300039447 Bacteria 831
228 Ga0436361_0457182 3300039447 Bacteria 623
229 Ga0436361_1027328 3300039447 Bacteria 715
230 Ga0436363_0973396 3300039450 Bacteria 887
231 Ga0436363_1074989 3300039450 Bacteria 1491
232 Ga0466964_0381695 3300044706 Unclassified 732
233 Ga0466957_0164703 3300044842 Bacteria 1442
234 Ga0495629_0004302 3300046459 Bacteria 10672
235 Ga0495641_0324534 3300046461 Bacteria 695
236 Ga0495651_0005653 3300046462 Bacteria 9530
237 Ga0495653_0424848 3300046463 Bacteria 840
238 Ga0495580_0011150 3300046472 Bacteria 6962
239 Ga0495580_0014250 3300046472 Bacteria 6036
240 Ga0495580_0037194 3300046472 Bacteria 3494
241 Ga0495580_0143364 3300046472 Bacteria 1656
242 Ga0495580_0402189 3300046472 Bacteria 923
243 Ga0495582_0017475 3300046473 Bacteria 3924
244 Ga0495582_0824896 3300046473 Bacteria 536
245 Ga0495662_0000473 3300046476 Bacteria 18250
246 Ga0495664_0006200 3300046477 Bacteria 6601
247 Ga0495664_0223848 3300046477 Bacteria 1139
248 Ga0495594_0000318 3300046499 Bacteria 23849
249 Ga0495594_0002528 3300046499 Bacteria 9524
250 Ga0495618_0259918 3300046514 Bacteria 1087
251 Ga0495628_0010303 3300046516 Bacteria 7946
252 Ga0495628_0943815 3300046516 Bacteria 596
253 Ga0495630_0058959 3300046517 Bacteria 2879
254 Ga0495666_0000393 3300046526 Bacteria 19201
255 Ga0495652_0009446 3300046529 Bacteria 8860
256 Ga0495665_0004228 3300046531 Bacteria 7750
257 Ga0495640_0008237 3300046533 Bacteria 8180
258 Ga0495586_0015187 3300046535 Bacteria 4097
259 Ga0495645_0001999 3300046543 Bacteria 13873
260 Ga0495622_0015018 3300046557 Bacteria 3600
261 Ga0495667_0000823 3300046559 Bacteria 20015
262 Ga0495656_0617514 3300046615 Bacteria 581
263 Ga0495634_0017302 3300046642 Bacteria 5147
264 Ga0495625_0201587 3300046660 Bacteria 1313
265 Ga0495635_0016778 3300046663 Bacteria 5115
266 Ga0495635_0103540 3300046663 Bacteria 1945
267 Ga0495599_0003382 3300046678 Bacteria 9328
268 Ga0495623_0124917 3300046679 Bacteria 1545
269 Ga0495646_0005211 3300046680 Bacteria 8197
270 Ga0495658_0587611 3300046683 Bacteria 713
271 Ga0495613_0006368 3300046689 Bacteria 8825
272 Ga0495613_0012198 3300046689 Bacteria 6386
273 Ga0495624_0002496 3300046690 Bacteria 13948
274 Ga0495600_0002884 3300046809 Bacteria 10019
275 Ga0495600_0211779 3300046809 Bacteria 1242
276 Ga0495581_0001655 3300047315 Bacteria 12423
277 Ga0495581_0681713 3300047315 Bacteria 593
278 Ga0495604_0025750 3300047317 Bacteria 4685
279 Ga0495604_0041303 3300047317 Bacteria 3618
280 Ga0495674_0009897 3300047319 Bacteria 9046
281 Ga0495676_0007624 3300047321 Bacteria 9926
282 Ga0495680_0027259 3300047322 Bacteria 4696
283 Ga0495675_0003911 3300047444 Bacteria 9019
284 Ga0495684_0093121 3300047471 Bacteria 2282
285 Ga0495602_0385886 3300048088 Bacteria 1002
286 Ga0495614_0024601 3300048089 Bacteria 2599
287 Ga0495614_0058466 3300048089 Bacteria 1655
288 Ga0496101_0620625 3300048904 Bacteria 855
289 Ga0496103_0200929 3300048906 Bacteria 1282
290 Ga0496104_0833503 3300048907 Bacteria 828
291 Ga0496105_0801001 3300048908 Bacteria 716
292 Ga0496106_0004203 3300048909 Bacteria 10731
293 Ga0496108_0085196 3300048911 Bacteria 2682
294 Ga0496109_0156034 3300048912 Bacteria 2138
295 Ga0496112_0028518 3300048915 Bacteria 5389
296 Ga0496112_0151216 3300048915 Bacteria 2288
297 Ga0496113_0038223 3300048916 Bacteria 3528
298 Ga0496115_0503215 3300048918 Bacteria 973
299 Ga0496115_1171726 3300048918 Bacteria 579
300 nmdc:mga06r32_16745_c1 3300050510 Bacteria 6681
301 nmdc:mga08y16_58716_c1 3300050511 Bacteria 4020
302 nmdc:mga0rr50_741819_c1 3300050513 Bacteria 838
303 nmdc:mga08x19_3585_c1 3300050514 Bacteria 9235
304 Ga0587079_025821 3300059647 Bacteria 1094
305 2824619847 2824617872 Bacteria 8814715
306 2824629455 2824626560 Bacteria 8813858
307 2824637097 2824635225 Bacteria 8785348
308 2824646604 2824644064 Bacteria 8743947
309 2824716338 2824714736 Bacteria 8717648
310 2824726112 2824723954 Bacteria 8758240
311 2935966331 2935959822 Bacteria 7869783
312 Ga0207667_11222288
313 rootL2_10134909
314 Ga0065712_10188708
315 Ga0070690_100420689
316 Ga0070690_101131785
317 Ga0070670_100006940
318 Ga0068869_100094787
319 Ga0070666_10000945
320 Ga0070680_100195473
321 Ga0068868_100012989
322 Ga0070660_100322269
323 Ga0070661_100008052
324 Ga0070675_100684612
325 Ga0070671_100217203
326 Ga0070674_100947191
327 Ga0070659_101075351
328 Ga0070667_100015801
329 Ga0070667_100253411
330 Ga0070703_10345214
331 Ga0070709_10002832
332 Ga0070709_10063984
333 Ga0070713_100000509
334 Ga0070713_100082185
335 Ga0070713_100343196
336 Ga0070713_100638244
337 Ga0070710_10174642
338 Ga0070710_10427729
339 Ga0070710_10875043
340 Ga0070711_100025411
341 Ga0070711_100144621
342 Ga0070711_100783253
343 Ga0070663_101307083
344 Ga0070681_10503566
345 Ga0068867_100044256
346 Ga0070707_101131560
347 Ga0070698_100006473
348 Ga0070699_100004309
349 Ga0070684_100027695
350 Ga0070697_100212965
351 Ga0070697_100494001
352 Ga0070697_100794814
353 Ga0068853_100430775
354 Ga0070672_100221463
355 Ga0070696_100122763
356 Ga0070696_101338606
357 Ga0070693_100327530
358 Ga0070665_100091373
359 Ga0068855_100024348
360 Ga0070664_100004541
361 Ga0068857_100164603
362 Ga0068854_100217376
363 Ga0068854_100486233
364 Ga0068856_100006689
365 Ga0068856_100169676
366 Ga0070702_100973240
367 Ga0068852_100018843
368 Ga0068859_100018448
369 Ga0068864_100014410
370 Ga0068866_10123752
371 Ga0068863_100060974
372 Ga0068858_100009195
373 Ga0068858_100013587
374 Ga0068860_100011708
375 Ga0068860_100820646
376 Ga0081540_1018571
377 Ga0070717_10752413
378 Ga0070715_10034017
379 Ga0070716_100011462
380 Ga0070716_100065969
381 Ga0070716_100471515
382 Ga0070712_100000134
383 Ga0070712_100075778
384 Ga0070712_100200377
385 Ga0070712_100385129
386 Ga0097621_100002285
387 Ga0097621_100296449
388 Ga0097621_100391242
389 Ga0097621_100910672
390 Ga0068871_100006514
391 Ga0068871_101986653
392 Ga0068865_100111117
393 Ga0097620_100018449
394 Ga0105240_10012223
395 Ga0111539_10063217
396 Ga0105245_10006821
397 Ga0105247_10241495
398 Ga0105241_10021626
399 Ga0105241_10156732
400 Ga0105242_10016170
401 Ga0105242_10049555
402 Ga0105248_10003181
403 Ga0105237_10000628
404 Ga0105237_10256366
405 Ga0105238_10014753
406 Ga0105249_10028967
407 Ga0105249_10291995
408 Ga0105239_10000288
409 Ga0105239_10585755
410 Ga0105239_10707711
411 Ga0105246_10401719
412 Ga0157373_10069478
413 Ga0157371_10007036
414 Ga0157369_10012755
415 Ga0157369_10212614
416 Ga0157374_10000787
417 Ga0157374_10083933
418 Ga0157374_10180974
419 Ga0157378_10000311
420 Ga0157378_10001217
421 Ga0163162_10009587
422 Ga0157372_10000966
423 Ga0157372_10004035
424 Ga0157372_10343412
425 Ga0157375_10015844
426 Ga0157375_10329939
427 Ga0157375_11469563
428 Ga0163163_10041007
429 Ga0163163_10199813
430 Ga0163163_10264166
431 Ga0163163_10507817
432 Ga0163163_11415103
433 Ga0157380_10379136
434 Ga0157377_10278505
435 Ga0157379_10038636
436 Ga0157379_10900128
437 Ga0157376_10051448
438 Ga0157376_10133977
439 Ga0157376_10230627
440 Ga0157376_10566343
441 Ga0163161_10070279
442 Ga0213872_10236465
443 Ga0213876_10000169
444 Ga0213876_10032123
445 Ga0207692_10159785
446 Ga0207692_10365356
447 Ga0207692_10519245
448 Ga0207642_10032945
449 Ga0207642_10097212
450 Ga0207680_10007312
451 Ga0207647_10036494
452 Ga0207647_10037487
453 Ga0207685_10014875
454 Ga0207699_10001452
455 Ga0207699_10301081
456 Ga0207705_10368134
457 Ga0207654_10003967
458 Ga0207654_10112787
459 Ga0207707_10057292
460 Ga0207695_10277030
461 Ga0207671_10007548
462 Ga0207671_10484604
463 Ga0207693_10000051
464 Ga0207693_10020645
465 Ga0207693_10077496
466 Ga0207693_10298598
467 Ga0207693_10715920
468 Ga0207663_10006556
469 Ga0207663_10108457
470 Ga0207663_10324010
471 Ga0207663_10327488
472 Ga0207663_10553817
473 Ga0207660_10093755
474 Ga0207662_10302589
475 Ga0207657_10312544
476 Ga0207649_10034856
477 Ga0207652_10825801
478 Ga0207646_10080186
479 Ga0207694_10010824
480 Ga0207694_10981227
481 Ga0207650_10043377
482 Ga0207659_10593275
483 Ga0207687_10001558
484 Ga0207687_10304131
485 Ga0207700_10027842
486 Ga0207700_10543378
487 Ga0207700_10581890
488 Ga0207686_10005110
489 Ga0207686_10253497
490 Ga0207709_10000513
491 Ga0207704_10529380
492 Ga0207665_10006288
493 Ga0207665_10088361
494 Ga0207665_10175432
495 Ga0207711_10003495
496 Ga0207689_10111021
497 Ga0207689_10312347
498 Ga0207661_10107461
499 Ga0207679_10459672
500 Ga0207667_10927482
501 Ga0207712_10017500
502 Ga0207712_10187093
503 Ga0207640_10016568
504 Ga0207658_10028997
505 Ga0207677_10001100
506 Ga0207677_10151350
507 Ga0207703_10027341
508 Ga0207703_10027909
509 Ga0207703_11564028
510 Ga0207639_10217290
511 Ga0207639_10563667
512 Ga0207702_10011258
513 Ga0207702_10145873
514 Ga0207702_11197427
515 Ga0207641_10021798
516 Ga0207641_10168834
517 Ga0207648_10035060
518 Ga0207676_10251674
519 Ga0207676_10851754
520 Ga0207674_10002659
521 Ga0207698_10012938
522 Ga0207428_10167359
523 Ga0268264_10004215
524 Ga0268264_10115521
525 Ga0265319_1089377
526 Ga0265338_10011363
527 Ga0265760_10308803
528 Ga0265325_10000931
529 Ga0373954_0444049
530 Ga0373927_0017455
531 Ga0373927_0250868
532 Ga0373927_0684182
533 Ga0373937_0000877
534 Ga0373925_0360830
535 Ga0395901_1857978
536 Ga0436365_0331476
537 Ga0436365_1207177
538 Ga0436361_0331474
539 Ga0436361_0457182
540 Ga0436361_1027328
541 Ga0436363_0973396
542 Ga0436363_1074989
543 Ga0466964_0381695
544 Ga0466957_0164703
545 Ga0495629_0004302
546 Ga0495641_0324534
547 Ga0495651_0005653
548 Ga0495653_0424848
549 Ga0495580_0011150
550 Ga0495580_0014250
551 Ga0495580_0037194
552 Ga0495580_0143364
553 Ga0495580_0402189
554 Ga0495582_0017475
555 Ga0495582_0824896
556 Ga0495662_0000473
557 Ga0495664_0006200
558 Ga0495664_0223848
559 Ga0495594_0000318
560 Ga0495594_0002528
561 Ga0495618_0259918
562 Ga0495628_0010303
563 Ga0495628_0943815
564 Ga0495630_0058959
565 Ga0495666_0000393
566 Ga0495652_0009446
567 Ga0495665_0004228
568 Ga0495640_0008237
569 Ga0495586_0015187
570 Ga0495645_0001999
571 Ga0495622_0015018
572 Ga0495667_0000823
573 Ga0495656_0617514
574 Ga0495634_0017302
575 Ga0495625_0201587
576 Ga0495635_0016778
577 Ga0495635_0103540
578 Ga0495599_0003382
579 Ga0495623_0124917
580 Ga0495646_0005211
581 Ga0495658_0587611
582 Ga0495613_0006368
583 Ga0495613_0012198
584 Ga0495624_0002496
585 Ga0495600_0002884
586 Ga0495600_0211779
587 Ga0495581_0001655
588 Ga0495581_0681713
589 Ga0495604_0025750
590 Ga0495604_0041303
591 Ga0495674_0009897
592 Ga0495676_0007624
593 Ga0495680_0027259
594 Ga0495675_0003911
595 Ga0495684_0093121
596 Ga0495602_0385886
597 Ga0495614_0024601
598 Ga0495614_0058466
599 Ga0496101_0620625
600 Ga0496103_0200929
601 Ga0496104_0833503
602 Ga0496105_0801001
603 Ga0496106_0004203
604 Ga0496108_0085196
605 Ga0496109_0156034
606 Ga0496112_0028518
607 Ga0496112_0151216
608 Ga0496113_0038223
609 Ga0496115_0503215
610 Ga0496115_1171726
611 nmdc:mga06r32_16745_c1
612 nmdc:mga08y16_58716_c1
613 nmdc:mga0rr50_741819_c1
614 nmdc:mga08x19_3585_c1
615 Ga0587079_025821
616 2824619847
617 2824629455
618 2824637097
619 2824646604
620 2824716338
621 2824726112
622 2935966331

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.775 3 142
7tmu-assembly4.cif.gz_D crystal structure of the protein of unknown function ypo0625 from yersinia pestis 0.7458 2 144
3tvr-assembly1.cif.gz_A crystal structure of streptomyces coelicolor polyketide aromatase/cyclase whie-orfvi 0.7444 1 154
3ijt-assembly1.cif.gz_A structural characterization of smu.440, a hypothetical protein from streptococcus mutans 0.7432 3 143
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.7428 1 143
ID Description Score Start End Superfamily
af_Q8MLL3_83_228_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8009 3 146 3.30.530.20
af_Q8MLL3_83_228_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7864 3 146 3.30.530.20
3tfzE00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7614 3 149 3.30.530.20
af_P0AGL5_15_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7599 3 144 3.30.530.20
af_I6X9Y7_1_146_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7585 3 147 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A1M5ST18-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 1.001 1 154
AF-A0A1M7ATN6-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 1.001 1 147
AF-A0A1M7DZH4-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 1.001 1 153
AF-A0A3N1JWJ5-F1-model_v4 deleted 0.9978 1 155
AF-A0A2A3HDU7-F1-model_v4 deleted 0.9978 2 149

Map