F401239
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 311 | 219 | 311 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300025924|Ga0207694_10154835|Ga0207694_101548351 |
| Length | 168 |
| Sequence | MGQNLRDSGAGSLSEQRAPVLAGRAPPRVKPSNYPPMFAERMAGRTKRPLGDLFELANFGVNLTTLAPGAASALQHRHSKQDEFVYVVSGELTLVSGPDTYPMGAGMCVGFLASGASHHLENRSSNDASYIEIGDRVAGDEVSYPADDLVAERDGDAWRFTHKNGEPY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 48 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 84 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 135 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 136 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 137 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 138 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 139 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 140 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 141 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 142 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 143 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 144 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 145 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 146 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 147 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 148 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 149 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 150 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 152 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 153 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 155 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 157 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 160 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 162 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 163 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 164 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 165 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 166 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 167 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 168 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 169 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 170 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 171 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 172 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 173 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 174 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 175 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 176 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 177 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 178 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 179 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 180 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 181 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 195 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 197 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 198 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 199 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 200 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 201 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 202 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 203 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 204 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 205 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 211 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 212 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 213 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 219 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.25 |
| Nodule | 0 |
| Rhizoplane | 0.96 |
| Rhizosphere | 92.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10110369 | 3300003320 | Bacteria | 1318 |
| 2 | Ga0068869_100516210 | 3300005334 | Bacteria | 999 |
| 3 | Ga0070666_10046808 | 3300005335 | Bacteria | 2903 |
| 4 | Ga0070666_10099712 | 3300005335 | Bacteria | 2000 |
| 5 | Ga0068868_100251246 | 3300005338 | Bacteria | 1488 |
| 6 | Ga0068868_101330386 | 3300005338 | Bacteria | 668 |
| 7 | Ga0070689_100574004 | 3300005340 | Bacteria | 974 |
| 8 | Ga0070689_100676452 | 3300005340 | Bacteria | 899 |
| 9 | Ga0070689_101046872 | 3300005340 | Bacteria | 728 |
| 10 | Ga0070692_10275735 | 3300005345 | Bacteria | 1017 |
| 11 | Ga0070668_100025630 | 3300005347 | Bacteria | 4472 |
| 12 | Ga0070669_100267831 | 3300005353 | Bacteria | 1365 |
| 13 | Ga0070669_100584126 | 3300005353 | Bacteria | 934 |
| 14 | Ga0070671_100041572 | 3300005355 | Bacteria | 3821 |
| 15 | Ga0070673_100247802 | 3300005364 | Bacteria | 1551 |
| 16 | Ga0070688_100015062 | 3300005365 | Bacteria | 4390 |
| 17 | Ga0070667_101093380 | 3300005367 | Unclassified | 745 |
| 18 | Ga0070714_100100515 | 3300005435 | Bacteria | 2547 |
| 19 | Ga0070713_100067060 | 3300005436 | Bacteria | 3020 |
| 20 | Ga0070711_100015811 | 3300005439 | Bacteria | 4779 |
| 21 | Ga0070711_100860564 | 3300005439 | Bacteria | 772 |
| 22 | Ga0070705_100198057 | 3300005440 | Unclassified | 1375 |
| 23 | Ga0070705_100614184 | 3300005440 | Bacteria | 843 |
| 24 | Ga0070700_100297084 | 3300005441 | Bacteria | 1177 |
| 25 | Ga0070694_100145637 | 3300005444 | Bacteria | 1725 |
| 26 | Ga0070694_101095932 | 3300005444 | Bacteria | 664 |
| 27 | Ga0070708_100191052 | 3300005445 | Bacteria | 1915 |
| 28 | Ga0070663_100159731 | 3300005455 | Bacteria | 1734 |
| 29 | Ga0070663_100629456 | 3300005455 | Bacteria | 905 |
| 30 | Ga0070678_100164776 | 3300005456 | Unclassified | 1800 |
| 31 | Ga0070662_101191091 | 3300005457 | Bacteria | 655 |
| 32 | Ga0070681_10055594 | 3300005458 | Bacteria | 3940 |
| 33 | Ga0068867_100030439 | 3300005459 | Bacteria | 3894 |
| 34 | Ga0070685_10527451 | 3300005466 | Bacteria | 840 |
| 35 | Ga0070706_100616199 | 3300005467 | Bacteria | 1008 |
| 36 | Ga0070679_100048986 | 3300005530 | Bacteria | 4208 |
| 37 | Ga0068853_100905117 | 3300005539 | Bacteria | 847 |
| 38 | Ga0070672_100726571 | 3300005543 | Unclassified | 870 |
| 39 | Ga0070695_100032675 | 3300005545 | Bacteria | 3253 |
| 40 | Ga0070695_100891713 | 3300005545 | Bacteria | 718 |
| 41 | Ga0070696_100175040 | 3300005546 | Bacteria | 1589 |
| 42 | Ga0070693_100099594 | 3300005547 | Bacteria | 1768 |
| 43 | Ga0070693_100761978 | 3300005547 | Bacteria | 714 |
| 44 | Ga0070665_100648722 | 3300005548 | Bacteria | 1069 |
| 45 | Ga0070665_100786860 | 3300005548 | Bacteria | 964 |
| 46 | Ga0070704_100031248 | 3300005549 | Bacteria | 3580 |
| 47 | Ga0068854_100700147 | 3300005578 | Bacteria | 874 |
| 48 | Ga0070702_100541636 | 3300005615 | Unclassified | 862 |
| 49 | Ga0068852_100667618 | 3300005616 | Bacteria | 1048 |
| 50 | Ga0068859_100549187 | 3300005617 | Bacteria | 1250 |
| 51 | Ga0068859_100657137 | 3300005617 | Bacteria | 1140 |
| 52 | Ga0068859_101020812 | 3300005617 | Bacteria | 909 |
| 53 | Ga0068864_100425054 | 3300005618 | Bacteria | 1266 |
| 54 | Ga0068864_100586070 | 3300005618 | Bacteria | 1081 |
| 55 | Ga0068864_101145815 | 3300005618 | Unclassified | 775 |
| 56 | Ga0068861_100053387 | 3300005719 | Bacteria | 3074 |
| 57 | Ga0068851_10273085 | 3300005834 | Bacteria | 965 |
| 58 | Ga0068863_100310141 | 3300005841 | Bacteria | 1531 |
| 59 | Ga0068858_100083764 | 3300005842 | Bacteria | 2966 |
| 60 | Ga0068858_100251622 | 3300005842 | Bacteria | 1678 |
| 61 | Ga0068860_100025559 | 3300005843 | Bacteria | 5696 |
| 62 | Ga0068860_100703832 | 3300005843 | Bacteria | 1020 |
| 63 | Ga0068862_100314207 | 3300005844 | Bacteria | 1444 |
| 64 | Ga0068862_100574930 | 3300005844 | Bacteria | 1079 |
| 65 | Ga0070717_10093428 | 3300006028 | Bacteria | 2543 |
| 66 | Ga0075368_10010249 | 3300006042 | Bacteria | 3385 |
| 67 | Ga0075363_100006529 | 3300006048 | Bacteria | 5306 |
| 68 | Ga0070716_100582161 | 3300006173 | Bacteria | 839 |
| 69 | Ga0070712_100009481 | 3300006175 | Bacteria | 6136 |
| 70 | Ga0070712_100150433 | 3300006175 | Bacteria | 1787 |
| 71 | Ga0070712_100330937 | 3300006175 | Unclassified | 1241 |
| 72 | Ga0070712_100553500 | 3300006175 | Bacteria | 969 |
| 73 | Ga0075362_10004321 | 3300006177 | Bacteria | 5086 |
| 74 | Ga0075369_10004642 | 3300006186 | Bacteria | 5094 |
| 75 | Ga0097621_100137893 | 3300006237 | Unclassified | 2082 |
| 76 | Ga0097621_100204944 | 3300006237 | Bacteria | 1713 |
| 77 | Ga0075370_10011046 | 3300006353 | Bacteria | 4735 |
| 78 | Ga0068871_100168276 | 3300006358 | Bacteria | 1877 |
| 79 | Ga0068871_100199793 | 3300006358 | Bacteria | 1725 |
| 80 | Ga0068871_100457841 | 3300006358 | Unclassified | 1144 |
| 81 | Ga0075428_100312263 | 3300006844 | Bacteria | 1690 |
| 82 | Ga0075428_100387451 | 3300006844 | Bacteria | 1498 |
| 83 | Ga0075430_100239540 | 3300006846 | Unclassified | 1504 |
| 84 | Ga0075433_10826714 | 3300006852 | Bacteria | 809 |
| 85 | Ga0075433_11351095 | 3300006852 | Bacteria | 617 |
| 86 | Ga0075434_100005363 | 3300006871 | Bacteria | 11665 |
| 87 | Ga0075434_100386577 | 3300006871 | Bacteria | 1420 |
| 88 | Ga0068865_100307449 | 3300006881 | Bacteria | 1271 |
| 89 | Ga0068865_100896026 | 3300006881 | Unclassified | 771 |
| 90 | Ga0097620_100549198 | 3300006931 | Bacteria | 1250 |
| 91 | Ga0097620_100657104 | 3300006931 | Bacteria | 1140 |
| 92 | Ga0097620_101020736 | 3300006931 | Bacteria | 909 |
| 93 | Ga0075435_100464729 | 3300007076 | Bacteria | 1092 |
| 94 | Ga0075435_100479525 | 3300007076 | Bacteria | 1074 |
| 95 | Ga0099794_10000917 | 3300007265 | Bacteria | 9940 |
| 96 | Ga0105240_10089961 | 3300009093 | Bacteria | 3753 |
| 97 | Ga0105245_10124276 | 3300009098 | Bacteria | 2413 |
| 98 | Ga0105243_10276158 | 3300009148 | Bacteria | 1511 |
| 99 | Ga0105243_10699436 | 3300009148 | Bacteria | 988 |
| 100 | Ga0105241_10138940 | 3300009174 | Bacteria | 1976 |
| 101 | Ga0105242_10024127 | 3300009176 | Bacteria | 4801 |
| 102 | Ga0105242_10201204 | 3300009176 | Unclassified | 1769 |
| 103 | Ga0105242_10312089 | 3300009176 | Unclassified | 1439 |
| 104 | Ga0105248_10197983 | 3300009177 | Bacteria | 2264 |
| 105 | Ga0105237_10034099 | 3300009545 | Bacteria | 5156 |
| 106 | Ga0105237_10062204 | 3300009545 | Bacteria | 3732 |
| 107 | Ga0105238_10041449 | 3300009551 | Bacteria | 4663 |
| 108 | Ga0105249_10155824 | 3300009553 | Bacteria | 2203 |
| 109 | Ga0105239_10504626 | 3300010375 | Unclassified | 1375 |
| 110 | Ga0157374_10010716 | 3300013296 | Bacteria | 7897 |
| 111 | Ga0163162_10035812 | 3300013306 | Bacteria | 4944 |
| 112 | Ga0163162_10147241 | 3300013306 | Bacteria | 2471 |
| 113 | Ga0163162_12169387 | 3300013306 | Bacteria | 638 |
| 114 | Ga0157375_10070543 | 3300013308 | Bacteria | 3504 |
| 115 | Ga0157375_10275811 | 3300013308 | Bacteria | 1844 |
| 116 | Ga0157375_10393464 | 3300013308 | Unclassified | 1553 |
| 117 | Ga0163163_10107716 | 3300014325 | Bacteria | 2813 |
| 118 | Ga0163163_10120658 | 3300014325 | Bacteria | 2656 |
| 119 | Ga0163163_10178505 | 3300014325 | Bacteria | 2170 |
| 120 | Ga0157380_10090040 | 3300014326 | Bacteria | 2530 |
| 121 | Ga0157380_10444790 | 3300014326 | Bacteria | 1243 |
| 122 | Ga0182008_10092382 | 3300014497 | Bacteria | 1493 |
| 123 | Ga0157379_10066004 | 3300014968 | Bacteria | 3235 |
| 124 | Ga0157379_10130299 | 3300014968 | Bacteria | 2263 |
| 125 | Ga0157379_10228535 | 3300014968 | Bacteria | 1686 |
| 126 | Ga0157376_10355663 | 3300014969 | Bacteria | 1403 |
| 127 | Ga0157376_11196986 | 3300014969 | Unclassified | 788 |
| 128 | Ga0163161_10005277 | 3300017792 | Bacteria | 8994 |
| 129 | Ga0163161_10463017 | 3300017792 | Unclassified | 1027 |
| 130 | Ga0163161_11221413 | 3300017792 | Bacteria | 651 |
| 131 | Ga0213874_10072111 | 3300021377 | Bacteria | 1104 |
| 132 | Ga0207666_1021469 | 3300025271 | Bacteria | 952 |
| 133 | Ga0207697_10008315 | 3300025315 | Bacteria | 4550 |
| 134 | Ga0207656_10008978 | 3300025321 | Bacteria | 3704 |
| 135 | Ga0207692_10094321 | 3300025898 | Unclassified | 1629 |
| 136 | Ga0207688_10045807 | 3300025901 | Bacteria | 2440 |
| 137 | Ga0207680_11023342 | 3300025903 | Bacteria | 591 |
| 138 | Ga0207645_10022036 | 3300025907 | Bacteria | 4149 |
| 139 | Ga0207643_10180954 | 3300025908 | Bacteria | 1276 |
| 140 | Ga0207654_10058768 | 3300025911 | Bacteria | 2240 |
| 141 | Ga0207654_10283770 | 3300025911 | Bacteria | 1121 |
| 142 | Ga0207695_10022253 | 3300025913 | Bacteria | 7206 |
| 143 | Ga0207671_10025610 | 3300025914 | Bacteria | 4430 |
| 144 | Ga0207693_10035961 | 3300025915 | Bacteria | 3903 |
| 145 | Ga0207663_10108203 | 3300025916 | Bacteria | 1882 |
| 146 | Ga0207663_10130230 | 3300025916 | Bacteria | 1737 |
| 147 | Ga0207662_10114240 | 3300025918 | Bacteria | 1687 |
| 148 | Ga0207652_10158380 | 3300025921 | Unclassified | 2029 |
| 149 | Ga0207646_10081948 | 3300025922 | Bacteria | 2885 |
| 150 | Ga0207681_10004535 | 3300025923 | Bacteria | 8551 |
| 151 | Ga0207694_10154835 | 3300025924 | Bacteria | 1848 |
| 152 | Ga0207650_10732726 | 3300025925 | Bacteria | 836 |
| 153 | Ga0207659_10005287 | 3300025926 | Bacteria | 7823 |
| 154 | Ga0207687_11022855 | 3300025927 | Bacteria | 709 |
| 155 | Ga0207644_10136147 | 3300025931 | Bacteria | 1886 |
| 156 | Ga0207644_10137127 | 3300025931 | Bacteria | 1880 |
| 157 | Ga0207644_10882353 | 3300025931 | Bacteria | 749 |
| 158 | Ga0207644_11032868 | 3300025931 | Bacteria | 690 |
| 159 | Ga0207706_10142266 | 3300025933 | Bacteria | 2110 |
| 160 | Ga0207686_10017557 | 3300025934 | Bacteria | 4035 |
| 161 | Ga0207686_10479486 | 3300025934 | Bacteria | 962 |
| 162 | Ga0207709_10075848 | 3300025935 | Bacteria | 2150 |
| 163 | Ga0207704_10144298 | 3300025938 | Bacteria | 1670 |
| 164 | Ga0207704_10179014 | 3300025938 | Bacteria | 1530 |
| 165 | Ga0207665_10011858 | 3300025939 | Bacteria | 5724 |
| 166 | Ga0207665_10567440 | 3300025939 | Bacteria | 883 |
| 167 | Ga0207711_11184557 | 3300025941 | Bacteria | 705 |
| 168 | Ga0207689_10517412 | 3300025942 | Bacteria | 1001 |
| 169 | Ga0207668_10022413 | 3300025972 | Bacteria | 4043 |
| 170 | Ga0207640_10488118 | 3300025981 | Bacteria | 1023 |
| 171 | Ga0207658_10011879 | 3300025986 | Bacteria | 5935 |
| 172 | Ga0207658_10606490 | 3300025986 | Bacteria | 984 |
| 173 | Ga0207677_10243135 | 3300026023 | Bacteria | 1457 |
| 174 | Ga0207703_10003763 | 3300026035 | Bacteria | 12613 |
| 175 | Ga0207703_10044285 | 3300026035 | Bacteria | 3576 |
| 176 | Ga0207639_10515066 | 3300026041 | Bacteria | 1095 |
| 177 | Ga0207678_10433728 | 3300026067 | Unclassified | 1141 |
| 178 | Ga0207708_10086695 | 3300026075 | Bacteria | 2409 |
| 179 | Ga0207708_11006220 | 3300026075 | Bacteria | 724 |
| 180 | Ga0207702_10116637 | 3300026078 | Bacteria | 2383 |
| 181 | Ga0207702_11410759 | 3300026078 | Bacteria | 690 |
| 182 | Ga0207641_10409959 | 3300026088 | Bacteria | 1303 |
| 183 | Ga0207648_10050279 | 3300026089 | Bacteria | 3645 |
| 184 | Ga0207676_10265530 | 3300026095 | Bacteria | 1552 |
| 185 | Ga0207676_10385260 | 3300026095 | Bacteria | 1306 |
| 186 | Ga0207676_11222049 | 3300026095 | Bacteria | 745 |
| 187 | Ga0207675_100044645 | 3300026118 | Bacteria | 4142 |
| 188 | Ga0207683_10569870 | 3300026121 | Unclassified | 1047 |
| 189 | Ga0207698_10559041 | 3300026142 | Bacteria | 1123 |
| 190 | Ga0209588_1003174 | 3300027671 | Unclassified | 4533 |
| 191 | Ga0209813_10192365 | 3300027866 | Bacteria | 752 |
| 192 | Ga0268266_10165617 | 3300028379 | Bacteria | 2002 |
| 193 | Ga0268265_10481609 | 3300028380 | Bacteria | 1165 |
| 194 | Ga0268265_10646810 | 3300028380 | Bacteria | 1016 |
| 195 | Ga0268264_10016136 | 3300028381 | Bacteria | 6118 |
| 196 | Ga0268264_11175068 | 3300028381 | Bacteria | 776 |
| 197 | Ga0268264_11228786 | 3300028381 | Unclassified | 759 |
| 198 | Ga0265334_10056617 | 3300028573 | Bacteria | 1488 |
| 199 | Ga0265328_10222824 | 3300031239 | Unclassified | 718 |
| 200 | Ga0265316_10183272 | 3300031344 | Bacteria | 1558 |
| 201 | Ga0307408_100051100 | 3300031548 | Bacteria | 2976 |
| 202 | Ga0316578_10125856 | 3300031728 | Bacteria | 1541 |
| 203 | Ga0307516_10238370 | 3300031730 | Bacteria | 1518 |
| 204 | Ga0307405_10153989 | 3300031731 | Bacteria | 1620 |
| 205 | Ga0316577_10316868 | 3300031733 | Bacteria | 884 |
| 206 | Ga0307413_10132955 | 3300031824 | Bacteria | 1706 |
| 207 | Ga0307413_10392318 | 3300031824 | Bacteria | 1085 |
| 208 | Ga0307406_10187095 | 3300031901 | Bacteria | 1513 |
| 209 | Ga0307409_100218414 | 3300031995 | Bacteria | 1719 |
| 210 | Ga0307409_100321387 | 3300031995 | Bacteria | 1449 |
| 211 | Ga0307416_100179759 | 3300032002 | Bacteria | 1981 |
| 212 | Ga0307411_10964829 | 3300032005 | Bacteria | 761 |
| 213 | Ga0316583_10019161 | 3300032133 | Bacteria | 2457 |
| 214 | Ga0316580_10262054 | 3300032139 | Unclassified | 535 |
| 215 | Ga0373941_0301879 | 3300035115 | Bacteria | 639 |
| 216 | Ga0373954_0007678 | 3300035118 | Bacteria | 4724 |
| 217 | Ga0373954_0324242 | 3300035118 | Unclassified | 760 |
| 218 | Ga0373956_0170595 | 3300035119 | Unclassified | 1027 |
| 219 | Ga0373943_0038013 | 3300035170 | Bacteria | 2312 |
| 220 | Ga0373955_0003788 | 3300035172 | Bacteria | 6660 |
| 221 | Ga0373955_0035493 | 3300035172 | Bacteria | 2641 |
| 222 | Ga0373942_0250550 | 3300035207 | Unclassified | 602 |
| 223 | Ga0316574_0136143 | 3300035398 | Unclassified | 1582 |
| 224 | Ga0373924_0352459 | 3300035410 | Bacteria | 656 |
| 225 | Ga0373935_0003548 | 3300035692 | Bacteria | 9084 |
| 226 | Ga0373933_0054231 | 3300035724 | Unclassified | 2402 |
| 227 | Ga0373937_0045836 | 3300036401 | Bacteria | 3996 |
| 228 | Ga0373937_0073724 | 3300036401 | Bacteria | 3149 |
| 229 | Ga0373937_0101606 | 3300036401 | Bacteria | 2669 |
| 230 | Ga0316582_0017707 | 3300036647 | Bacteria | 4129 |
| 231 | Ga0316582_0024693 | 3300036647 | Bacteria | 3600 |
| 232 | Ga0316582_0428590 | 3300036647 | Unclassified | 911 |
| 233 | Ga0373925_0003856 | 3300037068 | Bacteria | 11481 |
| 234 | Ga0373925_0150127 | 3300037068 | Bacteria | 1829 |
| 235 | Ga0373925_0900351 | 3300037068 | Unclassified | 729 |
| 236 | Ga0395899_0070420 | 3300037312 | Bacteria | 2560 |
| 237 | Ga0395899_0504951 | 3300037312 | Bacteria | 784 |
| 238 | Ga0395900_0013412 | 3300037418 | Bacteria | 8373 |
| 239 | Ga0395900_0700529 | 3300037418 | Bacteria | 946 |
| 240 | Ga0395898_0026725 | 3300037466 | Bacteria | 5802 |
| 241 | Ga0395898_0153504 | 3300037466 | Bacteria | 2203 |
| 242 | Ga0395898_0622172 | 3300037466 | Bacteria | 1022 |
| 243 | Ga0395905_0001683 | 3300037471 | Bacteria | 26070 |
| 244 | Ga0395905_0044288 | 3300037471 | Bacteria | 4176 |
| 245 | Ga0436364_0949597 | 3300037853 | Bacteria | 1029 |
| 246 | Ga0436364_1079563 | 3300037853 | Bacteria | 2471 |
| 247 | Ga0395901_0019078 | 3300038443 | Bacteria | 7012 |
| 248 | Ga0400486_08276 | 3300038742 | Bacteria | 1710 |
| 249 | Ga0436360_0510281 | 3300039438 | Bacteria | 4151 |
| 250 | Ga0436360_0631876 | 3300039438 | Bacteria | 998 |
| 251 | Ga0436360_0931903 | 3300039438 | Bacteria | 840 |
| 252 | Ga0436363_0114062 | 3300039450 | Bacteria | 3201 |
| 253 | Ga0436363_1429214 | 3300039450 | Bacteria | 1585 |
| 254 | Ga0436362_0264323 | 3300039453 | Bacteria | 990 |
| 255 | Ga0436362_1110717 | 3300039453 | Bacteria | 1258 |
| 256 | Ga0451577_0161985 | 3300042876 | Bacteria | 2015 |
| 257 | Ga0453683_0044952 | 3300044673 | Bacteria | 2769 |
| 258 | Ga0466963_0365530 | 3300044694 | Bacteria | 1016 |
| 259 | Ga0466964_0025426 | 3300044706 | Bacteria | 2312 |
| 260 | Ga0453684_0000679 | 3300044712 | Bacteria | 121950 |
| 261 | Ga0466971_0528756 | 3300044719 | Bacteria | 584 |
| 262 | Ga0466960_0316987 | 3300044901 | Bacteria | 882 |
| 263 | Ga0451576_0206881 | 3300045051 | Bacteria | 2049 |
| 264 | Ga0451576_0834450 | 3300045051 | Bacteria | 967 |
| 265 | Ga0451576_0856006 | 3300045051 | Bacteria | 954 |
| 266 | Ga0451576_1056388 | 3300045051 | Bacteria | 850 |
| 267 | Ga0466958_0194339 | 3300045836 | Bacteria | 1290 |
| 268 | Ga0466967_0057781 | 3300045976 | Bacteria | 3426 |
| 269 | Ga0466967_0274252 | 3300045976 | Bacteria | 1617 |
| 270 | Ga0495629_0068947 | 3300046459 | Bacteria | 2468 |
| 271 | Ga0495653_0084356 | 3300046463 | Bacteria | 2340 |
| 272 | Ga0495580_0297949 | 3300046472 | Unclassified | 1098 |
| 273 | Ga0495582_0039169 | 3300046473 | Bacteria | 2609 |
| 274 | Ga0495639_0412481 | 3300046475 | Bacteria | 683 |
| 275 | Ga0495630_0088647 | 3300046517 | Bacteria | 2337 |
| 276 | Ga0495667_0758502 | 3300046559 | Bacteria | 600 |
| 277 | Ga0495656_0099969 | 3300046615 | Bacteria | 1340 |
| 278 | Ga0495634_0227691 | 3300046642 | Unclassified | 1148 |
| 279 | Ga0495659_0134334 | 3300046664 | Unclassified | 983 |
| 280 | Ga0495600_0022941 | 3300046809 | Bacteria | 4012 |
| 281 | Ga0495581_0000884 | 3300047315 | Bacteria | 16023 |
| 282 | Ga0495684_0005794 | 3300047471 | Bacteria | 9606 |
| 283 | Ga0496106_0091256 | 3300048909 | Bacteria | 2352 |
| 284 | Ga0496109_0415686 | 3300048912 | Bacteria | 1271 |
| 285 | Ga0496114_0014011 | 3300048917 | Bacteria | 6428 |
| 286 | Ga0496118_0125150 | 3300048921 | Bacteria | 1666 |
| 287 | Ga0496120_0182024 | 3300048923 | Bacteria | 1031 |
| 288 | Ga0496121_0105895 | 3300048924 | Bacteria | 2157 |
| 289 | Ga0496125_0002747 | 3300048928 | Bacteria | 22260 |
| 290 | Ga0496126_0165671 | 3300048929 | Bacteria | 1886 |
| 291 | Ga0501292_015900 | 3300049515 | Bacteria | 1179 |
| 292 | Ga0501298_011245 | 3300049521 | Bacteria | 1551 |
| 293 | Ga0501300_001658 | 3300049523 | Bacteria | 3336 |
| 294 | Ga0501038_0232610 | 3300049574 | Bacteria | 1466 |
| 295 | Ga0501067_0175556 | 3300049583 | Bacteria | 1193 |
| 296 | Ga0501070_0207617 | 3300049586 | Unclassified | 1608 |
| 297 | Ga0501072_1043057 | 3300049588 | Bacteria | 637 |
| 298 | Ga0501077_0898289 | 3300049593 | Bacteria | 570 |
| 299 | Ga0501216_102392 | 3300049660 | Bacteria | 633 |
| 300 | Ga0501280_000989 | 3300049776 | Bacteria | 5889 |
| 301 | Ga0501282_006501 | 3300049778 | Bacteria | 1249 |
| 302 | nmdc:mga0qj67_452489_c1 | 3300050509 | Unclassified | 1034 |
| 303 | nmdc:mga0qj67_462873_c1 | 3300050509 | Bacteria | 1021 |
| 304 | nmdc:mga0n895_1563_c1 | 3300050512 | Bacteria | 17209 |
| 305 | nmdc:mga0n895_369631_c1 | 3300050512 | Bacteria | 1452 |
| 306 | nmdc:mga0n895_994350_c1 | 3300050512 | Bacteria | 820 |
| 307 | nmdc:mga0rr50_493637_c1 | 3300050513 | Bacteria | 1040 |
| 308 | nmdc:mga0a205_179990_c1 | 3300050515 | Bacteria | 2008 |
| 309 | Ga0495595_0149024 | 3300053084 | Unclassified | 1151 |
| 310 | Ga0500555_014438 | 3300053103 | Bacteria | 2278 |
| 311 | Ga0501084_0022905 | 3300054114 | Bacteria | 5213 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035118 | Ga0373954_0007678 | Ga0373954_0007678_3461_3886 | 140 |
| 2 | 3300035172 | Ga0373955_0003788 | Ga0373955_0003788_4328_4753 | 140 |
| 3 | 3300035410 | Ga0373924_0352459 | Ga0373924_0352459_161_586 | 140 |
| 4 | 3300035724 | Ga0373933_0054231 | Ga0373933_0054231_820_1245 | 140 |
| 5 | 3300036401 | Ga0373937_0045836 | Ga0373937_0045836_1387_1812 | 140 |
| 6 | 3300006846 | Ga0075430_100239540 | Ga0075430_1002395403 | 152 |
| 7 | 3300050509 | nmdc:mga0qj67_452489_c1 | nmdc:mga0qj67_452489_c1_93_569 | 152 |
| 8 | 3300032133 | Ga0316583_10019161 | Ga0316583_100191614 | 154 |
| 9 | 3300035398 | Ga0316574_0136143 | Ga0316574_0136143_966_1436 | 154 |
| 10 | 3300036647 | Ga0316582_0017707 | Ga0316582_0017707_983_1453 | 154 |
| 11 | 3300038742 | Ga0400486_08276 | Ga0400486_08276_423_896 | 154 |
| 12 | 3300026078 | Ga0207702_10116637 | Ga0207702_101166373 | 155 |
| 13 | 3300045051 | Ga0451576_1056388 | Ga0451576_1056388_110_580 | 155 |
| 14 | 3300053103 | Ga0500555_014438 | Ga0500555_014438_825_1301 | 155 |
| 15 | 3300005340 | Ga0070689_100574004 | Ga0070689_1005740042 | 156 |
| 16 | 3300005440 | Ga0070705_100614184 | Ga0070705_1006141842 | 156 |
| 17 | 3300005444 | Ga0070694_100145637 | Ga0070694_1001456373 | 156 |
| 18 | 3300005545 | Ga0070695_100032675 | Ga0070695_1000326753 | 156 |
| 19 | 3300005546 | Ga0070696_100175040 | Ga0070696_1001750401 | 156 |
| 20 | 3300005549 | Ga0070704_100031248 | Ga0070704_1000312485 | 156 |
| 21 | 3300006042 | Ga0075368_10010249 | Ga0075368_100102494 | 156 |
| 22 | 3300006048 | Ga0075363_100006529 | Ga0075363_1000065292 | 156 |
| 23 | 3300006177 | Ga0075362_10004321 | Ga0075362_100043215 | 156 |
| 24 | 3300006186 | Ga0075369_10004642 | Ga0075369_100046428 | 156 |
| 25 | 3300006353 | Ga0075370_10011046 | Ga0075370_100110463 | 156 |
| 26 | 3300007076 | Ga0075435_100479525 | Ga0075435_1004795252 | 156 |
| 27 | 3300009098 | Ga0105245_10124276 | Ga0105245_101242763 | 156 |
| 28 | 3300009148 | Ga0105243_10699436 | Ga0105243_106994362 | 156 |
| 29 | 3300009176 | Ga0105242_10312089 | Ga0105242_103120892 | 156 |
| 30 | 3300025921 | Ga0207652_10158380 | Ga0207652_101583803 | 156 |
| 31 | 3300025924 | Ga0207694_10154835 | Ga0207694_101548351 | 156 |
| 32 | 3300025934 | Ga0207686_10479486 | Ga0207686_104794861 | 156 |
| 33 | 3300027866 | Ga0209813_10192365 | Ga0209813_101923651 | 156 |
| 34 | 3300037068 | Ga0373925_0900351 | Ga0373925_0900351_65_538 | 156 |
| 35 | 3300042876 | Ga0451577_0161985 | Ga0451577_0161985_65_538 | 156 |
| 36 | 3300044706 | Ga0466964_0025426 | Ga0466964_0025426_1325_1795 | 156 |
| 37 | 3300044719 | Ga0466971_0528756 | Ga0466971_0528756_38_511 | 156 |
| 38 | 3300045836 | Ga0466958_0194339 | Ga0466958_0194339_792_1262 | 156 |
| 39 | 3300045976 | Ga0466967_0057781 | Ga0466967_0057781_933_1403 | 156 |
| 40 | 3300046472 | Ga0495580_0297949 | Ga0495580_0297949_240_713 | 156 |
| 41 | 3300005445 | Ga0070708_100191052 | Ga0070708_1001910521 | 157 |
| 42 | 3300005618 | Ga0068864_101145815 | Ga0068864_1011458152 | 158 |
| 43 | 3300005841 | Ga0068863_100310141 | Ga0068863_1003101412 | 158 |
| 44 | 3300006175 | Ga0070712_100330937 | Ga0070712_1003309372 | 158 |
| 45 | 3300009093 | Ga0105240_10089961 | Ga0105240_100899613 | 158 |
| 46 | 3300009174 | Ga0105241_10138940 | Ga0105241_101389401 | 158 |
| 47 | 3300009545 | Ga0105237_10034099 | Ga0105237_100340992 | 158 |
| 48 | 3300009545 | Ga0105237_10062204 | Ga0105237_100622044 | 158 |
| 49 | 3300009551 | Ga0105238_10041449 | Ga0105238_100414496 | 158 |
| 50 | 3300010375 | Ga0105239_10504626 | Ga0105239_105046261 | 158 |
| 51 | 3300014325 | Ga0163163_10107716 | Ga0163163_101077162 | 158 |
| 52 | 3300014968 | Ga0157379_10066004 | Ga0157379_100660044 | 158 |
| 53 | 3300025911 | Ga0207654_10058768 | Ga0207654_100587682 | 158 |
| 54 | 3300025911 | Ga0207654_10283770 | Ga0207654_102837701 | 158 |
| 55 | 3300025913 | Ga0207695_10022253 | Ga0207695_100222531 | 158 |
| 56 | 3300025914 | Ga0207671_10025610 | Ga0207671_100256105 | 158 |
| 57 | 3300026067 | Ga0207678_10433728 | Ga0207678_104337283 | 158 |
| 58 | 3300026078 | Ga0207702_11410759 | Ga0207702_114107591 | 158 |
| 59 | 3300026088 | Ga0207641_10409959 | Ga0207641_104099592 | 158 |
| 60 | 3300026095 | Ga0207676_11222049 | Ga0207676_112220491 | 158 |
| 61 | 3300031824 | Ga0307413_10392318 | Ga0307413_103923182 | 158 |
| 62 | 3300031995 | Ga0307409_100321387 | Ga0307409_1003213872 | 158 |
| 63 | 3300032005 | Ga0307411_10964829 | Ga0307411_109648292 | 158 |
| 64 | 3300035207 | Ga0373942_0250550 | Ga0373942_0250550_49_528 | 158 |
| 65 | 3300037312 | Ga0395899_0070420 | Ga0395899_0070420_10_486 | 158 |
| 66 | 3300037312 | Ga0395899_0504951 | Ga0395899_0504951_246_734 | 158 |
| 67 | 3300037418 | Ga0395900_0013412 | Ga0395900_0013412_6956_7432 | 158 |
| 68 | 3300037418 | Ga0395900_0700529 | Ga0395900_0700529_139_615 | 158 |
| 69 | 3300037466 | Ga0395898_0026725 | Ga0395898_0026725_2920_3396 | 158 |
| 70 | 3300037466 | Ga0395898_0153504 | Ga0395898_0153504_579_1067 | 158 |
| 71 | 3300037466 | Ga0395898_0622172 | Ga0395898_0622172_351_827 | 158 |
| 72 | 3300037471 | Ga0395905_0001683 | Ga0395905_0001683_9852_10328 | 158 |
| 73 | 3300037471 | Ga0395905_0044288 | Ga0395905_0044288_3568_4044 | 158 |
| 74 | 3300038443 | Ga0395901_0019078 | Ga0395901_0019078_134_610 | 158 |
| 75 | 3300046615 | Ga0495656_0099969 | Ga0495656_0099969_138_617 | 158 |
| 76 | 3300048921 | Ga0496118_0125150 | Ga0496118_0125150_834_1313 | 158 |
| 77 | 3300048923 | Ga0496120_0182024 | Ga0496120_0182024_213_692 | 158 |
| 78 | 3300048924 | Ga0496121_0105895 | Ga0496121_0105895_384_863 | 158 |
| 79 | 3300048928 | Ga0496125_0002747 | Ga0496125_0002747_14533_15012 | 158 |
| 80 | 3300048929 | Ga0496126_0165671 | Ga0496126_0165671_629_1108 | 158 |
| 81 | 3300049574 | Ga0501038_0232610 | Ga0501038_0232610_307_786 | 158 |
| 82 | 3300049588 | Ga0501072_1043057 | Ga0501072_1043057_143_622 | 158 |
| 83 | 3300003320 | rootH2_10110369 | rootH2_101103692 | 159 |
| 84 | 3300005334 | Ga0068869_100516210 | Ga0068869_1005162101 | 159 |
| 85 | 3300005335 | Ga0070666_10046808 | Ga0070666_100468083 | 159 |
| 86 | 3300005335 | Ga0070666_10099712 | Ga0070666_100997124 | 159 |
| 87 | 3300005338 | Ga0068868_100251246 | Ga0068868_1002512462 | 159 |
| 88 | 3300005338 | Ga0068868_101330386 | Ga0068868_1013303862 | 159 |
| 89 | 3300005340 | Ga0070689_100676452 | Ga0070689_1006764521 | 159 |
| 90 | 3300005340 | Ga0070689_101046872 | Ga0070689_1010468721 | 159 |
| 91 | 3300005345 | Ga0070692_10275735 | Ga0070692_102757352 | 159 |
| 92 | 3300005347 | Ga0070668_100025630 | Ga0070668_1000256304 | 159 |
| 93 | 3300005353 | Ga0070669_100267831 | Ga0070669_1002678312 | 159 |
| 94 | 3300005353 | Ga0070669_100584126 | Ga0070669_1005841261 | 159 |
| 95 | 3300005355 | Ga0070671_100041572 | Ga0070671_1000415724 | 159 |
| 96 | 3300005364 | Ga0070673_100247802 | Ga0070673_1002478023 | 159 |
| 97 | 3300005365 | Ga0070688_100015062 | Ga0070688_1000150628 | 159 |
| 98 | 3300005367 | Ga0070667_101093380 | Ga0070667_1010933801 | 159 |
| 99 | 3300005435 | Ga0070714_100100515 | Ga0070714_1001005152 | 159 |
| 100 | 3300005436 | Ga0070713_100067060 | Ga0070713_1000670602 | 159 |
| 101 | 3300005439 | Ga0070711_100015811 | Ga0070711_1000158115 | 159 |
| 102 | 3300005439 | Ga0070711_100860564 | Ga0070711_1008605641 | 159 |
| 103 | 3300005440 | Ga0070705_100198057 | Ga0070705_1001980572 | 159 |
| 104 | 3300005441 | Ga0070700_100297084 | Ga0070700_1002970842 | 159 |
| 105 | 3300005444 | Ga0070694_101095932 | Ga0070694_1010959321 | 159 |
| 106 | 3300005455 | Ga0070663_100159731 | Ga0070663_1001597312 | 159 |
| 107 | 3300005455 | Ga0070663_100629456 | Ga0070663_1006294561 | 159 |
| 108 | 3300005456 | Ga0070678_100164776 | Ga0070678_1001647761 | 159 |
| 109 | 3300005457 | Ga0070662_101191091 | Ga0070662_1011910911 | 159 |
| 110 | 3300005458 | Ga0070681_10055594 | Ga0070681_100555949 | 159 |
| 111 | 3300005459 | Ga0068867_100030439 | Ga0068867_1000304392 | 159 |
| 112 | 3300005466 | Ga0070685_10527451 | Ga0070685_105274512 | 159 |
| 113 | 3300005467 | Ga0070706_100616199 | Ga0070706_1006161992 | 159 |
| 114 | 3300005530 | Ga0070679_100048986 | Ga0070679_1000489864 | 159 |
| 115 | 3300005539 | Ga0068853_100905117 | Ga0068853_1009051171 | 159 |
| 116 | 3300005543 | Ga0070672_100726571 | Ga0070672_1007265712 | 159 |
| 117 | 3300005545 | Ga0070695_100891713 | Ga0070695_1008917131 | 159 |
| 118 | 3300005547 | Ga0070693_100099594 | Ga0070693_1000995942 | 159 |
| 119 | 3300005547 | Ga0070693_100761978 | Ga0070693_1007619781 | 159 |
| 120 | 3300005548 | Ga0070665_100648722 | Ga0070665_1006487222 | 159 |
| 121 | 3300005548 | Ga0070665_100786860 | Ga0070665_1007868602 | 159 |
| 122 | 3300005578 | Ga0068854_100700147 | Ga0068854_1007001472 | 159 |
| 123 | 3300005615 | Ga0070702_100541636 | Ga0070702_1005416362 | 159 |
| 124 | 3300005616 | Ga0068852_100667618 | Ga0068852_1006676182 | 159 |
| 125 | 3300005617 | Ga0068859_100549187 | Ga0068859_1005491872 | 159 |
| 126 | 3300005617 | Ga0068859_100657137 | Ga0068859_1006571372 | 159 |
| 127 | 3300005617 | Ga0068859_101020812 | Ga0068859_1010208121 | 159 |
| 128 | 3300005618 | Ga0068864_100425054 | Ga0068864_1004250541 | 159 |
| 129 | 3300005618 | Ga0068864_100586070 | Ga0068864_1005860702 | 159 |
| 130 | 3300005719 | Ga0068861_100053387 | Ga0068861_1000533873 | 159 |
| 131 | 3300005834 | Ga0068851_10273085 | Ga0068851_102730852 | 159 |
| 132 | 3300005842 | Ga0068858_100083764 | Ga0068858_1000837641 | 159 |
| 133 | 3300005842 | Ga0068858_100251622 | Ga0068858_1002516223 | 159 |
| 134 | 3300005843 | Ga0068860_100025559 | Ga0068860_10002555911 | 159 |
| 135 | 3300005843 | Ga0068860_100703832 | Ga0068860_1007038321 | 159 |
| 136 | 3300005844 | Ga0068862_100314207 | Ga0068862_1003142073 | 159 |
| 137 | 3300005844 | Ga0068862_100574930 | Ga0068862_1005749302 | 159 |
| 138 | 3300006028 | Ga0070717_10093428 | Ga0070717_100934283 | 159 |
| 139 | 3300006173 | Ga0070716_100582161 | Ga0070716_1005821612 | 159 |
| 140 | 3300006175 | Ga0070712_100009481 | Ga0070712_1000094816 | 159 |
| 141 | 3300006175 | Ga0070712_100150433 | Ga0070712_1001504333 | 159 |
| 142 | 3300006175 | Ga0070712_100553500 | Ga0070712_1005535001 | 159 |
| 143 | 3300006237 | Ga0097621_100137893 | Ga0097621_1001378932 | 159 |
| 144 | 3300006237 | Ga0097621_100204944 | Ga0097621_1002049441 | 159 |
| 145 | 3300006358 | Ga0068871_100168276 | Ga0068871_1001682761 | 159 |
| 146 | 3300006358 | Ga0068871_100199793 | Ga0068871_1001997932 | 159 |
| 147 | 3300006358 | Ga0068871_100457841 | Ga0068871_1004578412 | 159 |
| 148 | 3300006844 | Ga0075428_100312263 | Ga0075428_1003122632 | 159 |
| 149 | 3300006844 | Ga0075428_100387451 | Ga0075428_1003874513 | 159 |
| 150 | 3300006852 | Ga0075433_10826714 | Ga0075433_108267142 | 159 |
| 151 | 3300006852 | Ga0075433_11351095 | Ga0075433_113510952 | 159 |
| 152 | 3300006871 | Ga0075434_100005363 | Ga0075434_1000053639 | 159 |
| 153 | 3300006871 | Ga0075434_100386577 | Ga0075434_1003865773 | 159 |
| 154 | 3300006881 | Ga0068865_100307449 | Ga0068865_1003074491 | 159 |
| 155 | 3300006881 | Ga0068865_100896026 | Ga0068865_1008960261 | 159 |
| 156 | 3300006931 | Ga0097620_100549198 | Ga0097620_1005491982 | 159 |
| 157 | 3300006931 | Ga0097620_100657104 | Ga0097620_1006571042 | 159 |
| 158 | 3300006931 | Ga0097620_101020736 | Ga0097620_1010207361 | 159 |
| 159 | 3300007076 | Ga0075435_100464729 | Ga0075435_1004647291 | 159 |
| 160 | 3300007265 | Ga0099794_10000917 | Ga0099794_100009179 | 159 |
| 161 | 3300009148 | Ga0105243_10276158 | Ga0105243_102761582 | 159 |
| 162 | 3300009176 | Ga0105242_10024127 | Ga0105242_100241274 | 159 |
| 163 | 3300009176 | Ga0105242_10201204 | Ga0105242_102012043 | 159 |
| 164 | 3300009177 | Ga0105248_10197983 | Ga0105248_101979832 | 159 |
| 165 | 3300009553 | Ga0105249_10155824 | Ga0105249_101558242 | 159 |
| 166 | 3300013296 | Ga0157374_10010716 | Ga0157374_1001071613 | 159 |
| 167 | 3300013306 | Ga0163162_10035812 | Ga0163162_100358124 | 159 |
| 168 | 3300013306 | Ga0163162_10147241 | Ga0163162_101472414 | 159 |
| 169 | 3300013306 | Ga0163162_12169387 | Ga0163162_121693871 | 159 |
| 170 | 3300013308 | Ga0157375_10070543 | Ga0157375_100705434 | 159 |
| 171 | 3300013308 | Ga0157375_10275811 | Ga0157375_102758112 | 159 |
| 172 | 3300013308 | Ga0157375_10393464 | Ga0157375_103934642 | 159 |
| 173 | 3300014325 | Ga0163163_10120658 | Ga0163163_101206582 | 159 |
| 174 | 3300014325 | Ga0163163_10178505 | Ga0163163_101785052 | 159 |
| 175 | 3300014326 | Ga0157380_10090040 | Ga0157380_100900402 | 159 |
| 176 | 3300014326 | Ga0157380_10444790 | Ga0157380_104447902 | 159 |
| 177 | 3300014497 | Ga0182008_10092382 | Ga0182008_100923822 | 159 |
| 178 | 3300014968 | Ga0157379_10130299 | Ga0157379_101302993 | 159 |
| 179 | 3300014968 | Ga0157379_10228535 | Ga0157379_102285351 | 159 |
| 180 | 3300014969 | Ga0157376_10355663 | Ga0157376_103556632 | 159 |
| 181 | 3300014969 | Ga0157376_11196986 | Ga0157376_111969861 | 159 |
| 182 | 3300017792 | Ga0163161_10005277 | Ga0163161_100052774 | 159 |
| 183 | 3300017792 | Ga0163161_10463017 | Ga0163161_104630171 | 159 |
| 184 | 3300017792 | Ga0163161_11221413 | Ga0163161_112214131 | 159 |
| 185 | 3300021377 | Ga0213874_10072111 | Ga0213874_100721112 | 159 |
| 186 | 3300025271 | Ga0207666_1021469 | Ga0207666_10214691 | 159 |
| 187 | 3300025315 | Ga0207697_10008315 | Ga0207697_100083158 | 159 |
| 188 | 3300025321 | Ga0207656_10008978 | Ga0207656_100089785 | 159 |
| 189 | 3300025898 | Ga0207692_10094321 | Ga0207692_100943212 | 159 |
| 190 | 3300025901 | Ga0207688_10045807 | Ga0207688_100458073 | 159 |
| 191 | 3300025903 | Ga0207680_11023342 | Ga0207680_110233421 | 159 |
| 192 | 3300025907 | Ga0207645_10022036 | Ga0207645_100220368 | 159 |
| 193 | 3300025908 | Ga0207643_10180954 | Ga0207643_101809542 | 159 |
| 194 | 3300025915 | Ga0207693_10035961 | Ga0207693_100359613 | 159 |
| 195 | 3300025916 | Ga0207663_10108203 | Ga0207663_101082032 | 159 |
| 196 | 3300025916 | Ga0207663_10130230 | Ga0207663_101302302 | 159 |
| 197 | 3300025918 | Ga0207662_10114240 | Ga0207662_101142403 | 159 |
| 198 | 3300025922 | Ga0207646_10081948 | Ga0207646_100819483 | 159 |
| 199 | 3300025923 | Ga0207681_10004535 | Ga0207681_1000453513 | 159 |
| 200 | 3300025925 | Ga0207650_10732726 | Ga0207650_107327262 | 159 |
| 201 | 3300025926 | Ga0207659_10005287 | Ga0207659_1000528713 | 159 |
| 202 | 3300025927 | Ga0207687_11022855 | Ga0207687_110228552 | 159 |
| 203 | 3300025931 | Ga0207644_10136147 | Ga0207644_101361472 | 159 |
| 204 | 3300025931 | Ga0207644_10137127 | Ga0207644_101371273 | 159 |
| 205 | 3300025931 | Ga0207644_10882353 | Ga0207644_108823532 | 159 |
| 206 | 3300025931 | Ga0207644_11032868 | Ga0207644_110328681 | 159 |
| 207 | 3300025933 | Ga0207706_10142266 | Ga0207706_101422662 | 159 |
| 208 | 3300025934 | Ga0207686_10017557 | Ga0207686_100175574 | 159 |
| 209 | 3300025935 | Ga0207709_10075848 | Ga0207709_100758482 | 159 |
| 210 | 3300025938 | Ga0207704_10144298 | Ga0207704_101442982 | 159 |
| 211 | 3300025938 | Ga0207704_10179014 | Ga0207704_101790141 | 159 |
| 212 | 3300025939 | Ga0207665_10011858 | Ga0207665_100118583 | 159 |
| 213 | 3300025939 | Ga0207665_10567440 | Ga0207665_105674401 | 159 |
| 214 | 3300025941 | Ga0207711_11184557 | Ga0207711_111845571 | 159 |
| 215 | 3300025942 | Ga0207689_10517412 | Ga0207689_105174122 | 159 |
| 216 | 3300025972 | Ga0207668_10022413 | Ga0207668_100224136 | 159 |
| 217 | 3300025981 | Ga0207640_10488118 | Ga0207640_104881183 | 159 |
| 218 | 3300025986 | Ga0207658_10011879 | Ga0207658_100118796 | 159 |
| 219 | 3300025986 | Ga0207658_10606490 | Ga0207658_106064901 | 159 |
| 220 | 3300026023 | Ga0207677_10243135 | Ga0207677_102431352 | 159 |
| 221 | 3300026035 | Ga0207703_10003763 | Ga0207703_100037631 | 159 |
| 222 | 3300026035 | Ga0207703_10044285 | Ga0207703_100442853 | 159 |
| 223 | 3300026041 | Ga0207639_10515066 | Ga0207639_105150662 | 159 |
| 224 | 3300026075 | Ga0207708_10086695 | Ga0207708_100866952 | 159 |
| 225 | 3300026075 | Ga0207708_11006220 | Ga0207708_110062202 | 159 |
| 226 | 3300026089 | Ga0207648_10050279 | Ga0207648_100502792 | 159 |
| 227 | 3300026095 | Ga0207676_10265530 | Ga0207676_102655303 | 159 |
| 228 | 3300026095 | Ga0207676_10385260 | Ga0207676_103852602 | 159 |
| 229 | 3300026118 | Ga0207675_100044645 | Ga0207675_1000446454 | 159 |
| 230 | 3300026121 | Ga0207683_10569870 | Ga0207683_105698702 | 159 |
| 231 | 3300026142 | Ga0207698_10559041 | Ga0207698_105590412 | 159 |
| 232 | 3300027671 | Ga0209588_1003174 | Ga0209588_10031742 | 159 |
| 233 | 3300028379 | Ga0268266_10165617 | Ga0268266_101656174 | 159 |
| 234 | 3300028380 | Ga0268265_10481609 | Ga0268265_104816092 | 159 |
| 235 | 3300028380 | Ga0268265_10646810 | Ga0268265_106468102 | 159 |
| 236 | 3300028381 | Ga0268264_10016136 | Ga0268264_100161362 | 159 |
| 237 | 3300028381 | Ga0268264_11175068 | Ga0268264_111750681 | 159 |
| 238 | 3300028381 | Ga0268264_11228786 | Ga0268264_112287861 | 159 |
| 239 | 3300028573 | Ga0265334_10056617 | Ga0265334_100566172 | 159 |
| 240 | 3300031239 | Ga0265328_10222824 | Ga0265328_102228241 | 159 |
| 241 | 3300031344 | Ga0265316_10183272 | Ga0265316_101832723 | 159 |
| 242 | 3300031548 | Ga0307408_100051100 | Ga0307408_1000511003 | 159 |
| 243 | 3300031728 | Ga0316578_10125856 | Ga0316578_101258562 | 159 |
| 244 | 3300031730 | Ga0307516_10238370 | Ga0307516_102383702 | 159 |
| 245 | 3300031731 | Ga0307405_10153989 | Ga0307405_101539892 | 159 |
| 246 | 3300031733 | Ga0316577_10316868 | Ga0316577_103168682 | 159 |
| 247 | 3300031824 | Ga0307413_10132955 | Ga0307413_101329552 | 159 |
| 248 | 3300031901 | Ga0307406_10187095 | Ga0307406_101870952 | 159 |
| 249 | 3300031995 | Ga0307409_100218414 | Ga0307409_1002184143 | 159 |
| 250 | 3300032002 | Ga0307416_100179759 | Ga0307416_1001797593 | 159 |
| 251 | 3300032139 | Ga0316580_10262054 | Ga0316580_102620541 | 159 |
| 252 | 3300035115 | Ga0373941_0301879 | Ga0373941_0301879_45_533 | 159 |
| 253 | 3300035118 | Ga0373954_0324242 | Ga0373954_0324242_270_749 | 159 |
| 254 | 3300035119 | Ga0373956_0170595 | Ga0373956_0170595_189_668 | 159 |
| 255 | 3300035170 | Ga0373943_0038013 | Ga0373943_0038013_30_509 | 159 |
| 256 | 3300035172 | Ga0373955_0035493 | Ga0373955_0035493_93_572 | 159 |
| 257 | 3300035692 | Ga0373935_0003548 | Ga0373935_0003548_33_512 | 159 |
| 258 | 3300036401 | Ga0373937_0073724 | Ga0373937_0073724_2600_3079 | 159 |
| 259 | 3300036401 | Ga0373937_0101606 | Ga0373937_0101606_1087_1575 | 159 |
| 260 | 3300036647 | Ga0316582_0024693 | Ga0316582_0024693_1175_1654 | 159 |
| 261 | 3300036647 | Ga0316582_0428590 | Ga0316582_0428590_267_746 | 159 |
| 262 | 3300037068 | Ga0373925_0003856 | Ga0373925_0003856_8811_9290 | 159 |
| 263 | 3300037068 | Ga0373925_0150127 | Ga0373925_0150127_1134_1721 | 159 |
| 264 | 3300037853 | Ga0436364_0949597 | Ga0436364_0949597_120_602 | 159 |
| 265 | 3300037853 | Ga0436364_1079563 | Ga0436364_1079563_1259_1738 | 159 |
| 266 | 3300039438 | Ga0436360_0510281 | Ga0436360_0510281_3294_3776 | 159 |
| 267 | 3300039438 | Ga0436360_0631876 | Ga0436360_0631876_416_898 | 159 |
| 268 | 3300039438 | Ga0436360_0931903 | Ga0436360_0931903_35_517 | 159 |
| 269 | 3300039450 | Ga0436363_0114062 | Ga0436363_0114062_1585_2067 | 159 |
| 270 | 3300039450 | Ga0436363_1429214 | Ga0436363_1429214_751_1233 | 159 |
| 271 | 3300039453 | Ga0436362_0264323 | Ga0436362_0264323_165_647 | 159 |
| 272 | 3300039453 | Ga0436362_1110717 | Ga0436362_1110717_169_651 | 159 |
| 273 | 3300044673 | Ga0453683_0044952 | Ga0453683_0044952_1818_2297 | 159 |
| 274 | 3300044694 | Ga0466963_0365530 | Ga0466963_0365530_353_835 | 159 |
| 275 | 3300044712 | Ga0453684_0000679 | Ga0453684_0000679_71734_72228 | 159 |
| 276 | 3300044901 | Ga0466960_0316987 | Ga0466960_0316987_210_689 | 159 |
| 277 | 3300045051 | Ga0451576_0206881 | Ga0451576_0206881_763_1257 | 159 |
| 278 | 3300045051 | Ga0451576_0834450 | Ga0451576_0834450_31_540 | 159 |
| 279 | 3300045051 | Ga0451576_0856006 | Ga0451576_0856006_282_770 | 159 |
| 280 | 3300045976 | Ga0466967_0274252 | Ga0466967_0274252_1032_1514 | 159 |
| 281 | 3300046459 | Ga0495629_0068947 | Ga0495629_0068947_1917_2396 | 159 |
| 282 | 3300046463 | Ga0495653_0084356 | Ga0495653_0084356_590_1069 | 159 |
| 283 | 3300046473 | Ga0495582_0039169 | Ga0495582_0039169_694_1173 | 159 |
| 284 | 3300046475 | Ga0495639_0412481 | Ga0495639_0412481_172_654 | 159 |
| 285 | 3300046517 | Ga0495630_0088647 | Ga0495630_0088647_642_1121 | 159 |
| 286 | 3300046559 | Ga0495667_0758502 | Ga0495667_0758502_86_574 | 159 |
| 287 | 3300046642 | Ga0495634_0227691 | Ga0495634_0227691_548_1027 | 159 |
| 288 | 3300046664 | Ga0495659_0134334 | Ga0495659_0134334_320_832 | 159 |
| 289 | 3300046809 | Ga0495600_0022941 | Ga0495600_0022941_759_1238 | 159 |
| 290 | 3300047315 | Ga0495581_0000884 | Ga0495581_0000884_11612_12091 | 159 |
| 291 | 3300047471 | Ga0495684_0005794 | Ga0495684_0005794_4861_5340 | 159 |
| 292 | 3300048909 | Ga0496106_0091256 | Ga0496106_0091256_1459_1938 | 159 |
| 293 | 3300048912 | Ga0496109_0415686 | Ga0496109_0415686_717_1208 | 159 |
| 294 | 3300048917 | Ga0496114_0014011 | Ga0496114_0014011_2689_3168 | 159 |
| 295 | 3300049515 | Ga0501292_015900 | Ga0501292_015900_304_783 | 159 |
| 296 | 3300049521 | Ga0501298_011245 | Ga0501298_011245_1057_1536 | 159 |
| 297 | 3300049523 | Ga0501300_001658 | Ga0501300_001658_1345_1824 | 159 |
| 298 | 3300049583 | Ga0501067_0175556 | Ga0501067_0175556_228_731 | 159 |
| 299 | 3300049586 | Ga0501070_0207617 | Ga0501070_0207617_515_1000 | 159 |
| 300 | 3300049593 | Ga0501077_0898289 | Ga0501077_0898289_10_501 | 159 |
| 301 | 3300049660 | Ga0501216_102392 | Ga0501216_102392_17_502 | 159 |
| 302 | 3300049776 | Ga0501280_000989 | Ga0501280_000989_728_1207 | 159 |
| 303 | 3300049778 | Ga0501282_006501 | Ga0501282_006501_739_1218 | 159 |
| 304 | 3300050509 | nmdc:mga0qj67_462873_c1 | nmdc:mga0qj67_462873_c1_383_865 | 159 |
| 305 | 3300050512 | nmdc:mga0n895_1563_c1 | nmdc:mga0n895_1563_c1_4538_5026 | 159 |
| 306 | 3300050512 | nmdc:mga0n895_369631_c1 | nmdc:mga0n895_369631_c1_210_710 | 159 |
| 307 | 3300050512 | nmdc:mga0n895_994350_c1 | nmdc:mga0n895_994350_c1_93_575 | 159 |
| 308 | 3300050513 | nmdc:mga0rr50_493637_c1 | nmdc:mga0rr50_493637_c1_46_534 | 159 |
| 309 | 3300050515 | nmdc:mga0a205_179990_c1 | nmdc:mga0a205_179990_c1_835_1323 | 159 |
| 310 | 3300053084 | Ga0495595_0149024 | Ga0495595_0149024_264_743 | 159 |
| 311 | 3300054114 | Ga0501084_0022905 | Ga0501084_0022905_1087_1566 | 159 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3i7d-assembly1.cif.gz_A | crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution | 0.9546 | 9 | 159 |
| 5wsf-assembly1.cif.gz_D | crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii | 0.9215 | 8 | 127 |
| 5wse-assembly1.cif.gz_D | crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i | 0.9116 | 8 | 127 |
| 3l2h-assembly1.cif.gz_D | crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution | 0.9091 | 35 | 159 |
| 3i7d-assembly1.cif.gz_A | crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution | 0.9078 | 9 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3l2hD01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9309 | 35 | 152 | 2.60.120.10 |
| 3i7dB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9249 | 9 | 159 | 2.60.120.10 |
| af_P24174_373_472_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9227 | 48 | 126 | 2.60.120.10 |
| af_A0A1D8PPZ7_421_512_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9133 | 49 | 128 | 2.60.120.10 |
| af_P17410_9_96_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8929 | 47 | 125 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1K2HRM8-F1-model_v4 | Cupin domain-containing protein | 0.9971 | 35 | 138 |
GO:0046872
|
| AF-A0A5C7MV12-F1-model_v4 | Cupin domain-containing protein | 0.9946 | 28 | 159 |
GO:0046872
|
| AF-A0A0P6V9N3-F1-model_v4 | Cupin | 0.9914 | 9 | 130 |
GO:0046872
|
| AF-A0A534TJ25-F1-model_v4 | Cupin domain-containing protein | 0.9914 | 62 | 159 |
|
| AF-A3Z1N5-F1-model_v4 | Cupin type-2 domain-containing protein | 0.99 | 4 | 159 |
GO:0046872
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar