F401239

General Info

Members Datasets Scaffolds Average Seq Length
311 219 311 163

Family's Representative Sequence

Representative Sequence 3300025924|Ga0207694_10154835|Ga0207694_101548351
Length 168
Sequence MGQNLRDSGAGSLSEQRAPVLAGRAPPRVKPSNYPPMFAERMAGRTKRPLGDLFELANFGVNLTTLAPGAASALQHRHSKQDEFVYVVSGELTLVSGPDTYPMGAGMCVGFLASGASHHLENRSSNDASYIEIGDRVAGDEVSYPADDLVAERDGDAWRFTHKNGEPY

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
147 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
203 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
204 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
211 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
212 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.25
Nodule 0
Rhizoplane 0.96
Rhizosphere 92.6
Stem 0
Stem Tuber 0
Unclassified 4.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10110369 3300003320 Bacteria 1318
2 Ga0068869_100516210 3300005334 Bacteria 999
3 Ga0070666_10046808 3300005335 Bacteria 2903
4 Ga0070666_10099712 3300005335 Bacteria 2000
5 Ga0068868_100251246 3300005338 Bacteria 1488
6 Ga0068868_101330386 3300005338 Bacteria 668
7 Ga0070689_100574004 3300005340 Bacteria 974
8 Ga0070689_100676452 3300005340 Bacteria 899
9 Ga0070689_101046872 3300005340 Bacteria 728
10 Ga0070692_10275735 3300005345 Bacteria 1017
11 Ga0070668_100025630 3300005347 Bacteria 4472
12 Ga0070669_100267831 3300005353 Bacteria 1365
13 Ga0070669_100584126 3300005353 Bacteria 934
14 Ga0070671_100041572 3300005355 Bacteria 3821
15 Ga0070673_100247802 3300005364 Bacteria 1551
16 Ga0070688_100015062 3300005365 Bacteria 4390
17 Ga0070667_101093380 3300005367 Unclassified 745
18 Ga0070714_100100515 3300005435 Bacteria 2547
19 Ga0070713_100067060 3300005436 Bacteria 3020
20 Ga0070711_100015811 3300005439 Bacteria 4779
21 Ga0070711_100860564 3300005439 Bacteria 772
22 Ga0070705_100198057 3300005440 Unclassified 1375
23 Ga0070705_100614184 3300005440 Bacteria 843
24 Ga0070700_100297084 3300005441 Bacteria 1177
25 Ga0070694_100145637 3300005444 Bacteria 1725
26 Ga0070694_101095932 3300005444 Bacteria 664
27 Ga0070708_100191052 3300005445 Bacteria 1915
28 Ga0070663_100159731 3300005455 Bacteria 1734
29 Ga0070663_100629456 3300005455 Bacteria 905
30 Ga0070678_100164776 3300005456 Unclassified 1800
31 Ga0070662_101191091 3300005457 Bacteria 655
32 Ga0070681_10055594 3300005458 Bacteria 3940
33 Ga0068867_100030439 3300005459 Bacteria 3894
34 Ga0070685_10527451 3300005466 Bacteria 840
35 Ga0070706_100616199 3300005467 Bacteria 1008
36 Ga0070679_100048986 3300005530 Bacteria 4208
37 Ga0068853_100905117 3300005539 Bacteria 847
38 Ga0070672_100726571 3300005543 Unclassified 870
39 Ga0070695_100032675 3300005545 Bacteria 3253
40 Ga0070695_100891713 3300005545 Bacteria 718
41 Ga0070696_100175040 3300005546 Bacteria 1589
42 Ga0070693_100099594 3300005547 Bacteria 1768
43 Ga0070693_100761978 3300005547 Bacteria 714
44 Ga0070665_100648722 3300005548 Bacteria 1069
45 Ga0070665_100786860 3300005548 Bacteria 964
46 Ga0070704_100031248 3300005549 Bacteria 3580
47 Ga0068854_100700147 3300005578 Bacteria 874
48 Ga0070702_100541636 3300005615 Unclassified 862
49 Ga0068852_100667618 3300005616 Bacteria 1048
50 Ga0068859_100549187 3300005617 Bacteria 1250
51 Ga0068859_100657137 3300005617 Bacteria 1140
52 Ga0068859_101020812 3300005617 Bacteria 909
53 Ga0068864_100425054 3300005618 Bacteria 1266
54 Ga0068864_100586070 3300005618 Bacteria 1081
55 Ga0068864_101145815 3300005618 Unclassified 775
56 Ga0068861_100053387 3300005719 Bacteria 3074
57 Ga0068851_10273085 3300005834 Bacteria 965
58 Ga0068863_100310141 3300005841 Bacteria 1531
59 Ga0068858_100083764 3300005842 Bacteria 2966
60 Ga0068858_100251622 3300005842 Bacteria 1678
61 Ga0068860_100025559 3300005843 Bacteria 5696
62 Ga0068860_100703832 3300005843 Bacteria 1020
63 Ga0068862_100314207 3300005844 Bacteria 1444
64 Ga0068862_100574930 3300005844 Bacteria 1079
65 Ga0070717_10093428 3300006028 Bacteria 2543
66 Ga0075368_10010249 3300006042 Bacteria 3385
67 Ga0075363_100006529 3300006048 Bacteria 5306
68 Ga0070716_100582161 3300006173 Bacteria 839
69 Ga0070712_100009481 3300006175 Bacteria 6136
70 Ga0070712_100150433 3300006175 Bacteria 1787
71 Ga0070712_100330937 3300006175 Unclassified 1241
72 Ga0070712_100553500 3300006175 Bacteria 969
73 Ga0075362_10004321 3300006177 Bacteria 5086
74 Ga0075369_10004642 3300006186 Bacteria 5094
75 Ga0097621_100137893 3300006237 Unclassified 2082
76 Ga0097621_100204944 3300006237 Bacteria 1713
77 Ga0075370_10011046 3300006353 Bacteria 4735
78 Ga0068871_100168276 3300006358 Bacteria 1877
79 Ga0068871_100199793 3300006358 Bacteria 1725
80 Ga0068871_100457841 3300006358 Unclassified 1144
81 Ga0075428_100312263 3300006844 Bacteria 1690
82 Ga0075428_100387451 3300006844 Bacteria 1498
83 Ga0075430_100239540 3300006846 Unclassified 1504
84 Ga0075433_10826714 3300006852 Bacteria 809
85 Ga0075433_11351095 3300006852 Bacteria 617
86 Ga0075434_100005363 3300006871 Bacteria 11665
87 Ga0075434_100386577 3300006871 Bacteria 1420
88 Ga0068865_100307449 3300006881 Bacteria 1271
89 Ga0068865_100896026 3300006881 Unclassified 771
90 Ga0097620_100549198 3300006931 Bacteria 1250
91 Ga0097620_100657104 3300006931 Bacteria 1140
92 Ga0097620_101020736 3300006931 Bacteria 909
93 Ga0075435_100464729 3300007076 Bacteria 1092
94 Ga0075435_100479525 3300007076 Bacteria 1074
95 Ga0099794_10000917 3300007265 Bacteria 9940
96 Ga0105240_10089961 3300009093 Bacteria 3753
97 Ga0105245_10124276 3300009098 Bacteria 2413
98 Ga0105243_10276158 3300009148 Bacteria 1511
99 Ga0105243_10699436 3300009148 Bacteria 988
100 Ga0105241_10138940 3300009174 Bacteria 1976
101 Ga0105242_10024127 3300009176 Bacteria 4801
102 Ga0105242_10201204 3300009176 Unclassified 1769
103 Ga0105242_10312089 3300009176 Unclassified 1439
104 Ga0105248_10197983 3300009177 Bacteria 2264
105 Ga0105237_10034099 3300009545 Bacteria 5156
106 Ga0105237_10062204 3300009545 Bacteria 3732
107 Ga0105238_10041449 3300009551 Bacteria 4663
108 Ga0105249_10155824 3300009553 Bacteria 2203
109 Ga0105239_10504626 3300010375 Unclassified 1375
110 Ga0157374_10010716 3300013296 Bacteria 7897
111 Ga0163162_10035812 3300013306 Bacteria 4944
112 Ga0163162_10147241 3300013306 Bacteria 2471
113 Ga0163162_12169387 3300013306 Bacteria 638
114 Ga0157375_10070543 3300013308 Bacteria 3504
115 Ga0157375_10275811 3300013308 Bacteria 1844
116 Ga0157375_10393464 3300013308 Unclassified 1553
117 Ga0163163_10107716 3300014325 Bacteria 2813
118 Ga0163163_10120658 3300014325 Bacteria 2656
119 Ga0163163_10178505 3300014325 Bacteria 2170
120 Ga0157380_10090040 3300014326 Bacteria 2530
121 Ga0157380_10444790 3300014326 Bacteria 1243
122 Ga0182008_10092382 3300014497 Bacteria 1493
123 Ga0157379_10066004 3300014968 Bacteria 3235
124 Ga0157379_10130299 3300014968 Bacteria 2263
125 Ga0157379_10228535 3300014968 Bacteria 1686
126 Ga0157376_10355663 3300014969 Bacteria 1403
127 Ga0157376_11196986 3300014969 Unclassified 788
128 Ga0163161_10005277 3300017792 Bacteria 8994
129 Ga0163161_10463017 3300017792 Unclassified 1027
130 Ga0163161_11221413 3300017792 Bacteria 651
131 Ga0213874_10072111 3300021377 Bacteria 1104
132 Ga0207666_1021469 3300025271 Bacteria 952
133 Ga0207697_10008315 3300025315 Bacteria 4550
134 Ga0207656_10008978 3300025321 Bacteria 3704
135 Ga0207692_10094321 3300025898 Unclassified 1629
136 Ga0207688_10045807 3300025901 Bacteria 2440
137 Ga0207680_11023342 3300025903 Bacteria 591
138 Ga0207645_10022036 3300025907 Bacteria 4149
139 Ga0207643_10180954 3300025908 Bacteria 1276
140 Ga0207654_10058768 3300025911 Bacteria 2240
141 Ga0207654_10283770 3300025911 Bacteria 1121
142 Ga0207695_10022253 3300025913 Bacteria 7206
143 Ga0207671_10025610 3300025914 Bacteria 4430
144 Ga0207693_10035961 3300025915 Bacteria 3903
145 Ga0207663_10108203 3300025916 Bacteria 1882
146 Ga0207663_10130230 3300025916 Bacteria 1737
147 Ga0207662_10114240 3300025918 Bacteria 1687
148 Ga0207652_10158380 3300025921 Unclassified 2029
149 Ga0207646_10081948 3300025922 Bacteria 2885
150 Ga0207681_10004535 3300025923 Bacteria 8551
151 Ga0207694_10154835 3300025924 Bacteria 1848
152 Ga0207650_10732726 3300025925 Bacteria 836
153 Ga0207659_10005287 3300025926 Bacteria 7823
154 Ga0207687_11022855 3300025927 Bacteria 709
155 Ga0207644_10136147 3300025931 Bacteria 1886
156 Ga0207644_10137127 3300025931 Bacteria 1880
157 Ga0207644_10882353 3300025931 Bacteria 749
158 Ga0207644_11032868 3300025931 Bacteria 690
159 Ga0207706_10142266 3300025933 Bacteria 2110
160 Ga0207686_10017557 3300025934 Bacteria 4035
161 Ga0207686_10479486 3300025934 Bacteria 962
162 Ga0207709_10075848 3300025935 Bacteria 2150
163 Ga0207704_10144298 3300025938 Bacteria 1670
164 Ga0207704_10179014 3300025938 Bacteria 1530
165 Ga0207665_10011858 3300025939 Bacteria 5724
166 Ga0207665_10567440 3300025939 Bacteria 883
167 Ga0207711_11184557 3300025941 Bacteria 705
168 Ga0207689_10517412 3300025942 Bacteria 1001
169 Ga0207668_10022413 3300025972 Bacteria 4043
170 Ga0207640_10488118 3300025981 Bacteria 1023
171 Ga0207658_10011879 3300025986 Bacteria 5935
172 Ga0207658_10606490 3300025986 Bacteria 984
173 Ga0207677_10243135 3300026023 Bacteria 1457
174 Ga0207703_10003763 3300026035 Bacteria 12613
175 Ga0207703_10044285 3300026035 Bacteria 3576
176 Ga0207639_10515066 3300026041 Bacteria 1095
177 Ga0207678_10433728 3300026067 Unclassified 1141
178 Ga0207708_10086695 3300026075 Bacteria 2409
179 Ga0207708_11006220 3300026075 Bacteria 724
180 Ga0207702_10116637 3300026078 Bacteria 2383
181 Ga0207702_11410759 3300026078 Bacteria 690
182 Ga0207641_10409959 3300026088 Bacteria 1303
183 Ga0207648_10050279 3300026089 Bacteria 3645
184 Ga0207676_10265530 3300026095 Bacteria 1552
185 Ga0207676_10385260 3300026095 Bacteria 1306
186 Ga0207676_11222049 3300026095 Bacteria 745
187 Ga0207675_100044645 3300026118 Bacteria 4142
188 Ga0207683_10569870 3300026121 Unclassified 1047
189 Ga0207698_10559041 3300026142 Bacteria 1123
190 Ga0209588_1003174 3300027671 Unclassified 4533
191 Ga0209813_10192365 3300027866 Bacteria 752
192 Ga0268266_10165617 3300028379 Bacteria 2002
193 Ga0268265_10481609 3300028380 Bacteria 1165
194 Ga0268265_10646810 3300028380 Bacteria 1016
195 Ga0268264_10016136 3300028381 Bacteria 6118
196 Ga0268264_11175068 3300028381 Bacteria 776
197 Ga0268264_11228786 3300028381 Unclassified 759
198 Ga0265334_10056617 3300028573 Bacteria 1488
199 Ga0265328_10222824 3300031239 Unclassified 718
200 Ga0265316_10183272 3300031344 Bacteria 1558
201 Ga0307408_100051100 3300031548 Bacteria 2976
202 Ga0316578_10125856 3300031728 Bacteria 1541
203 Ga0307516_10238370 3300031730 Bacteria 1518
204 Ga0307405_10153989 3300031731 Bacteria 1620
205 Ga0316577_10316868 3300031733 Bacteria 884
206 Ga0307413_10132955 3300031824 Bacteria 1706
207 Ga0307413_10392318 3300031824 Bacteria 1085
208 Ga0307406_10187095 3300031901 Bacteria 1513
209 Ga0307409_100218414 3300031995 Bacteria 1719
210 Ga0307409_100321387 3300031995 Bacteria 1449
211 Ga0307416_100179759 3300032002 Bacteria 1981
212 Ga0307411_10964829 3300032005 Bacteria 761
213 Ga0316583_10019161 3300032133 Bacteria 2457
214 Ga0316580_10262054 3300032139 Unclassified 535
215 Ga0373941_0301879 3300035115 Bacteria 639
216 Ga0373954_0007678 3300035118 Bacteria 4724
217 Ga0373954_0324242 3300035118 Unclassified 760
218 Ga0373956_0170595 3300035119 Unclassified 1027
219 Ga0373943_0038013 3300035170 Bacteria 2312
220 Ga0373955_0003788 3300035172 Bacteria 6660
221 Ga0373955_0035493 3300035172 Bacteria 2641
222 Ga0373942_0250550 3300035207 Unclassified 602
223 Ga0316574_0136143 3300035398 Unclassified 1582
224 Ga0373924_0352459 3300035410 Bacteria 656
225 Ga0373935_0003548 3300035692 Bacteria 9084
226 Ga0373933_0054231 3300035724 Unclassified 2402
227 Ga0373937_0045836 3300036401 Bacteria 3996
228 Ga0373937_0073724 3300036401 Bacteria 3149
229 Ga0373937_0101606 3300036401 Bacteria 2669
230 Ga0316582_0017707 3300036647 Bacteria 4129
231 Ga0316582_0024693 3300036647 Bacteria 3600
232 Ga0316582_0428590 3300036647 Unclassified 911
233 Ga0373925_0003856 3300037068 Bacteria 11481
234 Ga0373925_0150127 3300037068 Bacteria 1829
235 Ga0373925_0900351 3300037068 Unclassified 729
236 Ga0395899_0070420 3300037312 Bacteria 2560
237 Ga0395899_0504951 3300037312 Bacteria 784
238 Ga0395900_0013412 3300037418 Bacteria 8373
239 Ga0395900_0700529 3300037418 Bacteria 946
240 Ga0395898_0026725 3300037466 Bacteria 5802
241 Ga0395898_0153504 3300037466 Bacteria 2203
242 Ga0395898_0622172 3300037466 Bacteria 1022
243 Ga0395905_0001683 3300037471 Bacteria 26070
244 Ga0395905_0044288 3300037471 Bacteria 4176
245 Ga0436364_0949597 3300037853 Bacteria 1029
246 Ga0436364_1079563 3300037853 Bacteria 2471
247 Ga0395901_0019078 3300038443 Bacteria 7012
248 Ga0400486_08276 3300038742 Bacteria 1710
249 Ga0436360_0510281 3300039438 Bacteria 4151
250 Ga0436360_0631876 3300039438 Bacteria 998
251 Ga0436360_0931903 3300039438 Bacteria 840
252 Ga0436363_0114062 3300039450 Bacteria 3201
253 Ga0436363_1429214 3300039450 Bacteria 1585
254 Ga0436362_0264323 3300039453 Bacteria 990
255 Ga0436362_1110717 3300039453 Bacteria 1258
256 Ga0451577_0161985 3300042876 Bacteria 2015
257 Ga0453683_0044952 3300044673 Bacteria 2769
258 Ga0466963_0365530 3300044694 Bacteria 1016
259 Ga0466964_0025426 3300044706 Bacteria 2312
260 Ga0453684_0000679 3300044712 Bacteria 121950
261 Ga0466971_0528756 3300044719 Bacteria 584
262 Ga0466960_0316987 3300044901 Bacteria 882
263 Ga0451576_0206881 3300045051 Bacteria 2049
264 Ga0451576_0834450 3300045051 Bacteria 967
265 Ga0451576_0856006 3300045051 Bacteria 954
266 Ga0451576_1056388 3300045051 Bacteria 850
267 Ga0466958_0194339 3300045836 Bacteria 1290
268 Ga0466967_0057781 3300045976 Bacteria 3426
269 Ga0466967_0274252 3300045976 Bacteria 1617
270 Ga0495629_0068947 3300046459 Bacteria 2468
271 Ga0495653_0084356 3300046463 Bacteria 2340
272 Ga0495580_0297949 3300046472 Unclassified 1098
273 Ga0495582_0039169 3300046473 Bacteria 2609
274 Ga0495639_0412481 3300046475 Bacteria 683
275 Ga0495630_0088647 3300046517 Bacteria 2337
276 Ga0495667_0758502 3300046559 Bacteria 600
277 Ga0495656_0099969 3300046615 Bacteria 1340
278 Ga0495634_0227691 3300046642 Unclassified 1148
279 Ga0495659_0134334 3300046664 Unclassified 983
280 Ga0495600_0022941 3300046809 Bacteria 4012
281 Ga0495581_0000884 3300047315 Bacteria 16023
282 Ga0495684_0005794 3300047471 Bacteria 9606
283 Ga0496106_0091256 3300048909 Bacteria 2352
284 Ga0496109_0415686 3300048912 Bacteria 1271
285 Ga0496114_0014011 3300048917 Bacteria 6428
286 Ga0496118_0125150 3300048921 Bacteria 1666
287 Ga0496120_0182024 3300048923 Bacteria 1031
288 Ga0496121_0105895 3300048924 Bacteria 2157
289 Ga0496125_0002747 3300048928 Bacteria 22260
290 Ga0496126_0165671 3300048929 Bacteria 1886
291 Ga0501292_015900 3300049515 Bacteria 1179
292 Ga0501298_011245 3300049521 Bacteria 1551
293 Ga0501300_001658 3300049523 Bacteria 3336
294 Ga0501038_0232610 3300049574 Bacteria 1466
295 Ga0501067_0175556 3300049583 Bacteria 1193
296 Ga0501070_0207617 3300049586 Unclassified 1608
297 Ga0501072_1043057 3300049588 Bacteria 637
298 Ga0501077_0898289 3300049593 Bacteria 570
299 Ga0501216_102392 3300049660 Bacteria 633
300 Ga0501280_000989 3300049776 Bacteria 5889
301 Ga0501282_006501 3300049778 Bacteria 1249
302 nmdc:mga0qj67_452489_c1 3300050509 Unclassified 1034
303 nmdc:mga0qj67_462873_c1 3300050509 Bacteria 1021
304 nmdc:mga0n895_1563_c1 3300050512 Bacteria 17209
305 nmdc:mga0n895_369631_c1 3300050512 Bacteria 1452
306 nmdc:mga0n895_994350_c1 3300050512 Bacteria 820
307 nmdc:mga0rr50_493637_c1 3300050513 Bacteria 1040
308 nmdc:mga0a205_179990_c1 3300050515 Bacteria 2008
309 Ga0495595_0149024 3300053084 Unclassified 1151
310 Ga0500555_014438 3300053103 Bacteria 2278
311 Ga0501084_0022905 3300054114 Bacteria 5213

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035118 Ga0373954_0007678 Ga0373954_0007678_3461_3886 140
2 3300035172 Ga0373955_0003788 Ga0373955_0003788_4328_4753 140
3 3300035410 Ga0373924_0352459 Ga0373924_0352459_161_586 140
4 3300035724 Ga0373933_0054231 Ga0373933_0054231_820_1245 140
5 3300036401 Ga0373937_0045836 Ga0373937_0045836_1387_1812 140
6 3300006846 Ga0075430_100239540 Ga0075430_1002395403 152
7 3300050509 nmdc:mga0qj67_452489_c1 nmdc:mga0qj67_452489_c1_93_569 152
8 3300032133 Ga0316583_10019161 Ga0316583_100191614 154
9 3300035398 Ga0316574_0136143 Ga0316574_0136143_966_1436 154
10 3300036647 Ga0316582_0017707 Ga0316582_0017707_983_1453 154
11 3300038742 Ga0400486_08276 Ga0400486_08276_423_896 154
12 3300026078 Ga0207702_10116637 Ga0207702_101166373 155
13 3300045051 Ga0451576_1056388 Ga0451576_1056388_110_580 155
14 3300053103 Ga0500555_014438 Ga0500555_014438_825_1301 155
15 3300005340 Ga0070689_100574004 Ga0070689_1005740042 156
16 3300005440 Ga0070705_100614184 Ga0070705_1006141842 156
17 3300005444 Ga0070694_100145637 Ga0070694_1001456373 156
18 3300005545 Ga0070695_100032675 Ga0070695_1000326753 156
19 3300005546 Ga0070696_100175040 Ga0070696_1001750401 156
20 3300005549 Ga0070704_100031248 Ga0070704_1000312485 156
21 3300006042 Ga0075368_10010249 Ga0075368_100102494 156
22 3300006048 Ga0075363_100006529 Ga0075363_1000065292 156
23 3300006177 Ga0075362_10004321 Ga0075362_100043215 156
24 3300006186 Ga0075369_10004642 Ga0075369_100046428 156
25 3300006353 Ga0075370_10011046 Ga0075370_100110463 156
26 3300007076 Ga0075435_100479525 Ga0075435_1004795252 156
27 3300009098 Ga0105245_10124276 Ga0105245_101242763 156
28 3300009148 Ga0105243_10699436 Ga0105243_106994362 156
29 3300009176 Ga0105242_10312089 Ga0105242_103120892 156
30 3300025921 Ga0207652_10158380 Ga0207652_101583803 156
31 3300025924 Ga0207694_10154835 Ga0207694_101548351 156
32 3300025934 Ga0207686_10479486 Ga0207686_104794861 156
33 3300027866 Ga0209813_10192365 Ga0209813_101923651 156
34 3300037068 Ga0373925_0900351 Ga0373925_0900351_65_538 156
35 3300042876 Ga0451577_0161985 Ga0451577_0161985_65_538 156
36 3300044706 Ga0466964_0025426 Ga0466964_0025426_1325_1795 156
37 3300044719 Ga0466971_0528756 Ga0466971_0528756_38_511 156
38 3300045836 Ga0466958_0194339 Ga0466958_0194339_792_1262 156
39 3300045976 Ga0466967_0057781 Ga0466967_0057781_933_1403 156
40 3300046472 Ga0495580_0297949 Ga0495580_0297949_240_713 156
41 3300005445 Ga0070708_100191052 Ga0070708_1001910521 157
42 3300005618 Ga0068864_101145815 Ga0068864_1011458152 158
43 3300005841 Ga0068863_100310141 Ga0068863_1003101412 158
44 3300006175 Ga0070712_100330937 Ga0070712_1003309372 158
45 3300009093 Ga0105240_10089961 Ga0105240_100899613 158
46 3300009174 Ga0105241_10138940 Ga0105241_101389401 158
47 3300009545 Ga0105237_10034099 Ga0105237_100340992 158
48 3300009545 Ga0105237_10062204 Ga0105237_100622044 158
49 3300009551 Ga0105238_10041449 Ga0105238_100414496 158
50 3300010375 Ga0105239_10504626 Ga0105239_105046261 158
51 3300014325 Ga0163163_10107716 Ga0163163_101077162 158
52 3300014968 Ga0157379_10066004 Ga0157379_100660044 158
53 3300025911 Ga0207654_10058768 Ga0207654_100587682 158
54 3300025911 Ga0207654_10283770 Ga0207654_102837701 158
55 3300025913 Ga0207695_10022253 Ga0207695_100222531 158
56 3300025914 Ga0207671_10025610 Ga0207671_100256105 158
57 3300026067 Ga0207678_10433728 Ga0207678_104337283 158
58 3300026078 Ga0207702_11410759 Ga0207702_114107591 158
59 3300026088 Ga0207641_10409959 Ga0207641_104099592 158
60 3300026095 Ga0207676_11222049 Ga0207676_112220491 158
61 3300031824 Ga0307413_10392318 Ga0307413_103923182 158
62 3300031995 Ga0307409_100321387 Ga0307409_1003213872 158
63 3300032005 Ga0307411_10964829 Ga0307411_109648292 158
64 3300035207 Ga0373942_0250550 Ga0373942_0250550_49_528 158
65 3300037312 Ga0395899_0070420 Ga0395899_0070420_10_486 158
66 3300037312 Ga0395899_0504951 Ga0395899_0504951_246_734 158
67 3300037418 Ga0395900_0013412 Ga0395900_0013412_6956_7432 158
68 3300037418 Ga0395900_0700529 Ga0395900_0700529_139_615 158
69 3300037466 Ga0395898_0026725 Ga0395898_0026725_2920_3396 158
70 3300037466 Ga0395898_0153504 Ga0395898_0153504_579_1067 158
71 3300037466 Ga0395898_0622172 Ga0395898_0622172_351_827 158
72 3300037471 Ga0395905_0001683 Ga0395905_0001683_9852_10328 158
73 3300037471 Ga0395905_0044288 Ga0395905_0044288_3568_4044 158
74 3300038443 Ga0395901_0019078 Ga0395901_0019078_134_610 158
75 3300046615 Ga0495656_0099969 Ga0495656_0099969_138_617 158
76 3300048921 Ga0496118_0125150 Ga0496118_0125150_834_1313 158
77 3300048923 Ga0496120_0182024 Ga0496120_0182024_213_692 158
78 3300048924 Ga0496121_0105895 Ga0496121_0105895_384_863 158
79 3300048928 Ga0496125_0002747 Ga0496125_0002747_14533_15012 158
80 3300048929 Ga0496126_0165671 Ga0496126_0165671_629_1108 158
81 3300049574 Ga0501038_0232610 Ga0501038_0232610_307_786 158
82 3300049588 Ga0501072_1043057 Ga0501072_1043057_143_622 158
83 3300003320 rootH2_10110369 rootH2_101103692 159
84 3300005334 Ga0068869_100516210 Ga0068869_1005162101 159
85 3300005335 Ga0070666_10046808 Ga0070666_100468083 159
86 3300005335 Ga0070666_10099712 Ga0070666_100997124 159
87 3300005338 Ga0068868_100251246 Ga0068868_1002512462 159
88 3300005338 Ga0068868_101330386 Ga0068868_1013303862 159
89 3300005340 Ga0070689_100676452 Ga0070689_1006764521 159
90 3300005340 Ga0070689_101046872 Ga0070689_1010468721 159
91 3300005345 Ga0070692_10275735 Ga0070692_102757352 159
92 3300005347 Ga0070668_100025630 Ga0070668_1000256304 159
93 3300005353 Ga0070669_100267831 Ga0070669_1002678312 159
94 3300005353 Ga0070669_100584126 Ga0070669_1005841261 159
95 3300005355 Ga0070671_100041572 Ga0070671_1000415724 159
96 3300005364 Ga0070673_100247802 Ga0070673_1002478023 159
97 3300005365 Ga0070688_100015062 Ga0070688_1000150628 159
98 3300005367 Ga0070667_101093380 Ga0070667_1010933801 159
99 3300005435 Ga0070714_100100515 Ga0070714_1001005152 159
100 3300005436 Ga0070713_100067060 Ga0070713_1000670602 159
101 3300005439 Ga0070711_100015811 Ga0070711_1000158115 159
102 3300005439 Ga0070711_100860564 Ga0070711_1008605641 159
103 3300005440 Ga0070705_100198057 Ga0070705_1001980572 159
104 3300005441 Ga0070700_100297084 Ga0070700_1002970842 159
105 3300005444 Ga0070694_101095932 Ga0070694_1010959321 159
106 3300005455 Ga0070663_100159731 Ga0070663_1001597312 159
107 3300005455 Ga0070663_100629456 Ga0070663_1006294561 159
108 3300005456 Ga0070678_100164776 Ga0070678_1001647761 159
109 3300005457 Ga0070662_101191091 Ga0070662_1011910911 159
110 3300005458 Ga0070681_10055594 Ga0070681_100555949 159
111 3300005459 Ga0068867_100030439 Ga0068867_1000304392 159
112 3300005466 Ga0070685_10527451 Ga0070685_105274512 159
113 3300005467 Ga0070706_100616199 Ga0070706_1006161992 159
114 3300005530 Ga0070679_100048986 Ga0070679_1000489864 159
115 3300005539 Ga0068853_100905117 Ga0068853_1009051171 159
116 3300005543 Ga0070672_100726571 Ga0070672_1007265712 159
117 3300005545 Ga0070695_100891713 Ga0070695_1008917131 159
118 3300005547 Ga0070693_100099594 Ga0070693_1000995942 159
119 3300005547 Ga0070693_100761978 Ga0070693_1007619781 159
120 3300005548 Ga0070665_100648722 Ga0070665_1006487222 159
121 3300005548 Ga0070665_100786860 Ga0070665_1007868602 159
122 3300005578 Ga0068854_100700147 Ga0068854_1007001472 159
123 3300005615 Ga0070702_100541636 Ga0070702_1005416362 159
124 3300005616 Ga0068852_100667618 Ga0068852_1006676182 159
125 3300005617 Ga0068859_100549187 Ga0068859_1005491872 159
126 3300005617 Ga0068859_100657137 Ga0068859_1006571372 159
127 3300005617 Ga0068859_101020812 Ga0068859_1010208121 159
128 3300005618 Ga0068864_100425054 Ga0068864_1004250541 159
129 3300005618 Ga0068864_100586070 Ga0068864_1005860702 159
130 3300005719 Ga0068861_100053387 Ga0068861_1000533873 159
131 3300005834 Ga0068851_10273085 Ga0068851_102730852 159
132 3300005842 Ga0068858_100083764 Ga0068858_1000837641 159
133 3300005842 Ga0068858_100251622 Ga0068858_1002516223 159
134 3300005843 Ga0068860_100025559 Ga0068860_10002555911 159
135 3300005843 Ga0068860_100703832 Ga0068860_1007038321 159
136 3300005844 Ga0068862_100314207 Ga0068862_1003142073 159
137 3300005844 Ga0068862_100574930 Ga0068862_1005749302 159
138 3300006028 Ga0070717_10093428 Ga0070717_100934283 159
139 3300006173 Ga0070716_100582161 Ga0070716_1005821612 159
140 3300006175 Ga0070712_100009481 Ga0070712_1000094816 159
141 3300006175 Ga0070712_100150433 Ga0070712_1001504333 159
142 3300006175 Ga0070712_100553500 Ga0070712_1005535001 159
143 3300006237 Ga0097621_100137893 Ga0097621_1001378932 159
144 3300006237 Ga0097621_100204944 Ga0097621_1002049441 159
145 3300006358 Ga0068871_100168276 Ga0068871_1001682761 159
146 3300006358 Ga0068871_100199793 Ga0068871_1001997932 159
147 3300006358 Ga0068871_100457841 Ga0068871_1004578412 159
148 3300006844 Ga0075428_100312263 Ga0075428_1003122632 159
149 3300006844 Ga0075428_100387451 Ga0075428_1003874513 159
150 3300006852 Ga0075433_10826714 Ga0075433_108267142 159
151 3300006852 Ga0075433_11351095 Ga0075433_113510952 159
152 3300006871 Ga0075434_100005363 Ga0075434_1000053639 159
153 3300006871 Ga0075434_100386577 Ga0075434_1003865773 159
154 3300006881 Ga0068865_100307449 Ga0068865_1003074491 159
155 3300006881 Ga0068865_100896026 Ga0068865_1008960261 159
156 3300006931 Ga0097620_100549198 Ga0097620_1005491982 159
157 3300006931 Ga0097620_100657104 Ga0097620_1006571042 159
158 3300006931 Ga0097620_101020736 Ga0097620_1010207361 159
159 3300007076 Ga0075435_100464729 Ga0075435_1004647291 159
160 3300007265 Ga0099794_10000917 Ga0099794_100009179 159
161 3300009148 Ga0105243_10276158 Ga0105243_102761582 159
162 3300009176 Ga0105242_10024127 Ga0105242_100241274 159
163 3300009176 Ga0105242_10201204 Ga0105242_102012043 159
164 3300009177 Ga0105248_10197983 Ga0105248_101979832 159
165 3300009553 Ga0105249_10155824 Ga0105249_101558242 159
166 3300013296 Ga0157374_10010716 Ga0157374_1001071613 159
167 3300013306 Ga0163162_10035812 Ga0163162_100358124 159
168 3300013306 Ga0163162_10147241 Ga0163162_101472414 159
169 3300013306 Ga0163162_12169387 Ga0163162_121693871 159
170 3300013308 Ga0157375_10070543 Ga0157375_100705434 159
171 3300013308 Ga0157375_10275811 Ga0157375_102758112 159
172 3300013308 Ga0157375_10393464 Ga0157375_103934642 159
173 3300014325 Ga0163163_10120658 Ga0163163_101206582 159
174 3300014325 Ga0163163_10178505 Ga0163163_101785052 159
175 3300014326 Ga0157380_10090040 Ga0157380_100900402 159
176 3300014326 Ga0157380_10444790 Ga0157380_104447902 159
177 3300014497 Ga0182008_10092382 Ga0182008_100923822 159
178 3300014968 Ga0157379_10130299 Ga0157379_101302993 159
179 3300014968 Ga0157379_10228535 Ga0157379_102285351 159
180 3300014969 Ga0157376_10355663 Ga0157376_103556632 159
181 3300014969 Ga0157376_11196986 Ga0157376_111969861 159
182 3300017792 Ga0163161_10005277 Ga0163161_100052774 159
183 3300017792 Ga0163161_10463017 Ga0163161_104630171 159
184 3300017792 Ga0163161_11221413 Ga0163161_112214131 159
185 3300021377 Ga0213874_10072111 Ga0213874_100721112 159
186 3300025271 Ga0207666_1021469 Ga0207666_10214691 159
187 3300025315 Ga0207697_10008315 Ga0207697_100083158 159
188 3300025321 Ga0207656_10008978 Ga0207656_100089785 159
189 3300025898 Ga0207692_10094321 Ga0207692_100943212 159
190 3300025901 Ga0207688_10045807 Ga0207688_100458073 159
191 3300025903 Ga0207680_11023342 Ga0207680_110233421 159
192 3300025907 Ga0207645_10022036 Ga0207645_100220368 159
193 3300025908 Ga0207643_10180954 Ga0207643_101809542 159
194 3300025915 Ga0207693_10035961 Ga0207693_100359613 159
195 3300025916 Ga0207663_10108203 Ga0207663_101082032 159
196 3300025916 Ga0207663_10130230 Ga0207663_101302302 159
197 3300025918 Ga0207662_10114240 Ga0207662_101142403 159
198 3300025922 Ga0207646_10081948 Ga0207646_100819483 159
199 3300025923 Ga0207681_10004535 Ga0207681_1000453513 159
200 3300025925 Ga0207650_10732726 Ga0207650_107327262 159
201 3300025926 Ga0207659_10005287 Ga0207659_1000528713 159
202 3300025927 Ga0207687_11022855 Ga0207687_110228552 159
203 3300025931 Ga0207644_10136147 Ga0207644_101361472 159
204 3300025931 Ga0207644_10137127 Ga0207644_101371273 159
205 3300025931 Ga0207644_10882353 Ga0207644_108823532 159
206 3300025931 Ga0207644_11032868 Ga0207644_110328681 159
207 3300025933 Ga0207706_10142266 Ga0207706_101422662 159
208 3300025934 Ga0207686_10017557 Ga0207686_100175574 159
209 3300025935 Ga0207709_10075848 Ga0207709_100758482 159
210 3300025938 Ga0207704_10144298 Ga0207704_101442982 159
211 3300025938 Ga0207704_10179014 Ga0207704_101790141 159
212 3300025939 Ga0207665_10011858 Ga0207665_100118583 159
213 3300025939 Ga0207665_10567440 Ga0207665_105674401 159
214 3300025941 Ga0207711_11184557 Ga0207711_111845571 159
215 3300025942 Ga0207689_10517412 Ga0207689_105174122 159
216 3300025972 Ga0207668_10022413 Ga0207668_100224136 159
217 3300025981 Ga0207640_10488118 Ga0207640_104881183 159
218 3300025986 Ga0207658_10011879 Ga0207658_100118796 159
219 3300025986 Ga0207658_10606490 Ga0207658_106064901 159
220 3300026023 Ga0207677_10243135 Ga0207677_102431352 159
221 3300026035 Ga0207703_10003763 Ga0207703_100037631 159
222 3300026035 Ga0207703_10044285 Ga0207703_100442853 159
223 3300026041 Ga0207639_10515066 Ga0207639_105150662 159
224 3300026075 Ga0207708_10086695 Ga0207708_100866952 159
225 3300026075 Ga0207708_11006220 Ga0207708_110062202 159
226 3300026089 Ga0207648_10050279 Ga0207648_100502792 159
227 3300026095 Ga0207676_10265530 Ga0207676_102655303 159
228 3300026095 Ga0207676_10385260 Ga0207676_103852602 159
229 3300026118 Ga0207675_100044645 Ga0207675_1000446454 159
230 3300026121 Ga0207683_10569870 Ga0207683_105698702 159
231 3300026142 Ga0207698_10559041 Ga0207698_105590412 159
232 3300027671 Ga0209588_1003174 Ga0209588_10031742 159
233 3300028379 Ga0268266_10165617 Ga0268266_101656174 159
234 3300028380 Ga0268265_10481609 Ga0268265_104816092 159
235 3300028380 Ga0268265_10646810 Ga0268265_106468102 159
236 3300028381 Ga0268264_10016136 Ga0268264_100161362 159
237 3300028381 Ga0268264_11175068 Ga0268264_111750681 159
238 3300028381 Ga0268264_11228786 Ga0268264_112287861 159
239 3300028573 Ga0265334_10056617 Ga0265334_100566172 159
240 3300031239 Ga0265328_10222824 Ga0265328_102228241 159
241 3300031344 Ga0265316_10183272 Ga0265316_101832723 159
242 3300031548 Ga0307408_100051100 Ga0307408_1000511003 159
243 3300031728 Ga0316578_10125856 Ga0316578_101258562 159
244 3300031730 Ga0307516_10238370 Ga0307516_102383702 159
245 3300031731 Ga0307405_10153989 Ga0307405_101539892 159
246 3300031733 Ga0316577_10316868 Ga0316577_103168682 159
247 3300031824 Ga0307413_10132955 Ga0307413_101329552 159
248 3300031901 Ga0307406_10187095 Ga0307406_101870952 159
249 3300031995 Ga0307409_100218414 Ga0307409_1002184143 159
250 3300032002 Ga0307416_100179759 Ga0307416_1001797593 159
251 3300032139 Ga0316580_10262054 Ga0316580_102620541 159
252 3300035115 Ga0373941_0301879 Ga0373941_0301879_45_533 159
253 3300035118 Ga0373954_0324242 Ga0373954_0324242_270_749 159
254 3300035119 Ga0373956_0170595 Ga0373956_0170595_189_668 159
255 3300035170 Ga0373943_0038013 Ga0373943_0038013_30_509 159
256 3300035172 Ga0373955_0035493 Ga0373955_0035493_93_572 159
257 3300035692 Ga0373935_0003548 Ga0373935_0003548_33_512 159
258 3300036401 Ga0373937_0073724 Ga0373937_0073724_2600_3079 159
259 3300036401 Ga0373937_0101606 Ga0373937_0101606_1087_1575 159
260 3300036647 Ga0316582_0024693 Ga0316582_0024693_1175_1654 159
261 3300036647 Ga0316582_0428590 Ga0316582_0428590_267_746 159
262 3300037068 Ga0373925_0003856 Ga0373925_0003856_8811_9290 159
263 3300037068 Ga0373925_0150127 Ga0373925_0150127_1134_1721 159
264 3300037853 Ga0436364_0949597 Ga0436364_0949597_120_602 159
265 3300037853 Ga0436364_1079563 Ga0436364_1079563_1259_1738 159
266 3300039438 Ga0436360_0510281 Ga0436360_0510281_3294_3776 159
267 3300039438 Ga0436360_0631876 Ga0436360_0631876_416_898 159
268 3300039438 Ga0436360_0931903 Ga0436360_0931903_35_517 159
269 3300039450 Ga0436363_0114062 Ga0436363_0114062_1585_2067 159
270 3300039450 Ga0436363_1429214 Ga0436363_1429214_751_1233 159
271 3300039453 Ga0436362_0264323 Ga0436362_0264323_165_647 159
272 3300039453 Ga0436362_1110717 Ga0436362_1110717_169_651 159
273 3300044673 Ga0453683_0044952 Ga0453683_0044952_1818_2297 159
274 3300044694 Ga0466963_0365530 Ga0466963_0365530_353_835 159
275 3300044712 Ga0453684_0000679 Ga0453684_0000679_71734_72228 159
276 3300044901 Ga0466960_0316987 Ga0466960_0316987_210_689 159
277 3300045051 Ga0451576_0206881 Ga0451576_0206881_763_1257 159
278 3300045051 Ga0451576_0834450 Ga0451576_0834450_31_540 159
279 3300045051 Ga0451576_0856006 Ga0451576_0856006_282_770 159
280 3300045976 Ga0466967_0274252 Ga0466967_0274252_1032_1514 159
281 3300046459 Ga0495629_0068947 Ga0495629_0068947_1917_2396 159
282 3300046463 Ga0495653_0084356 Ga0495653_0084356_590_1069 159
283 3300046473 Ga0495582_0039169 Ga0495582_0039169_694_1173 159
284 3300046475 Ga0495639_0412481 Ga0495639_0412481_172_654 159
285 3300046517 Ga0495630_0088647 Ga0495630_0088647_642_1121 159
286 3300046559 Ga0495667_0758502 Ga0495667_0758502_86_574 159
287 3300046642 Ga0495634_0227691 Ga0495634_0227691_548_1027 159
288 3300046664 Ga0495659_0134334 Ga0495659_0134334_320_832 159
289 3300046809 Ga0495600_0022941 Ga0495600_0022941_759_1238 159
290 3300047315 Ga0495581_0000884 Ga0495581_0000884_11612_12091 159
291 3300047471 Ga0495684_0005794 Ga0495684_0005794_4861_5340 159
292 3300048909 Ga0496106_0091256 Ga0496106_0091256_1459_1938 159
293 3300048912 Ga0496109_0415686 Ga0496109_0415686_717_1208 159
294 3300048917 Ga0496114_0014011 Ga0496114_0014011_2689_3168 159
295 3300049515 Ga0501292_015900 Ga0501292_015900_304_783 159
296 3300049521 Ga0501298_011245 Ga0501298_011245_1057_1536 159
297 3300049523 Ga0501300_001658 Ga0501300_001658_1345_1824 159
298 3300049583 Ga0501067_0175556 Ga0501067_0175556_228_731 159
299 3300049586 Ga0501070_0207617 Ga0501070_0207617_515_1000 159
300 3300049593 Ga0501077_0898289 Ga0501077_0898289_10_501 159
301 3300049660 Ga0501216_102392 Ga0501216_102392_17_502 159
302 3300049776 Ga0501280_000989 Ga0501280_000989_728_1207 159
303 3300049778 Ga0501282_006501 Ga0501282_006501_739_1218 159
304 3300050509 nmdc:mga0qj67_462873_c1 nmdc:mga0qj67_462873_c1_383_865 159
305 3300050512 nmdc:mga0n895_1563_c1 nmdc:mga0n895_1563_c1_4538_5026 159
306 3300050512 nmdc:mga0n895_369631_c1 nmdc:mga0n895_369631_c1_210_710 159
307 3300050512 nmdc:mga0n895_994350_c1 nmdc:mga0n895_994350_c1_93_575 159
308 3300050513 nmdc:mga0rr50_493637_c1 nmdc:mga0rr50_493637_c1_46_534 159
309 3300050515 nmdc:mga0a205_179990_c1 nmdc:mga0a205_179990_c1_835_1323 159
310 3300053084 Ga0495595_0149024 Ga0495595_0149024_264_743 159
311 3300054114 Ga0501084_0022905 Ga0501084_0022905_1087_1566 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

62

134

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.9546 9 159
5wsf-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.9215 8 127
5wse-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.9116 8 127
3l2h-assembly1.cif.gz_D crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution 0.9091 35 159
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.9078 9 159
ID Description Score Start End Superfamily
3l2hD01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9309 35 152 2.60.120.10
3i7dB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9249 9 159 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9227 48 126 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9133 49 128 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8929 47 125 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1K2HRM8-F1-model_v4 Cupin domain-containing protein 0.9971 35 138 GO:0046872
AF-A0A5C7MV12-F1-model_v4 Cupin domain-containing protein 0.9946 28 159 GO:0046872
AF-A0A0P6V9N3-F1-model_v4 Cupin 0.9914 9 130 GO:0046872
AF-A0A534TJ25-F1-model_v4 Cupin domain-containing protein 0.9914 62 159
AF-A3Z1N5-F1-model_v4 Cupin type-2 domain-containing protein 0.99 4 159 GO:0046872

Feature Viewer

pLDDT pTM Quality
95.1 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map