F401077

General Info

Members Datasets Scaffolds Average Seq Length
311 163 622 145

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100303771|Ga0070674_1003037712
Length 167
Sequence MRATIRRSPSSLAGWWQPPGSVRAMSEPRPVNLSGTGPPETVLDPEPADAVQALTAALGDRDAISSVVARWPRFLDGWARLGQAARDDVEAYAAFRAGYHRGLDRLRANGWRGSGYVRWAHPENRGFLRALDGLRSAAAAIGERDEEERCAQFLHQLDPSWPPADLD

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
61 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
62 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
63 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
64 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
65 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
66 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
67 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
68 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
69 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
73 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
74 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
75 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
76 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
77 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
78 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
95 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
149 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
157 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
158 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
159 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.11
Nodule 0
Rhizoplane 7.72
Rhizosphere 75.56
Stem 0
Stem Tuber 0
Unclassified 13.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100303771 3300005356 Bacteria 1273
2 Ga0070683_100233966 3300005329 Bacteria 1747
3 Ga0068869_100538050 3300005334 Unclassified 980
4 Ga0068868_100253392 3300005338 Unclassified 1482
5 Ga0068868_102392757 3300005338 Bacteria 504
6 Ga0070661_100207075 3300005344 Bacteria 1500
7 Ga0070669_100471199 3300005353 Archaea 1038
8 Ga0070675_100281224 3300005354 Unclassified 1462
9 Ga0070671_100082836 3300005355 Unclassified 2683
10 Ga0070673_100903220 3300005364 Unclassified 819
11 Ga0070688_100220857 3300005365 Bacteria 1335
12 Ga0070667_100169466 3300005367 Unclassified 1927
13 Ga0070700_100212507 3300005441 Bacteria 1366
14 Ga0070698_101061383 3300005471 Bacteria 758
15 Ga0070665_100958548 3300005548 Bacteria 868
16 Ga0070665_102261213 3300005548 Bacteria 547
17 Ga0070702_100341733 3300005615 Bacteria 1051
18 Ga0068859_100200015 3300005617 Bacteria 2083
19 Ga0068859_100333065 3300005617 Bacteria 1612
20 Ga0068861_100050107 3300005719 Bacteria 3165
21 Ga0068860_100151759 3300005843 Unclassified 2231
22 Ga0068860_100359434 3300005843 Bacteria 1434
23 Ga0068862_100740685 3300005844 Bacteria 955
24 Ga0068862_101864262 3300005844 Bacteria 611
25 Ga0075365_10005266 3300006038 Bacteria 6960
26 Ga0075365_10086728 3300006038 Unclassified 2127
27 Ga0075365_10138409 3300006038 Unclassified 1689
28 Ga0075368_10026013 3300006042 Bacteria 2249
29 Ga0075363_100130648 3300006048 Bacteria 1408
30 Ga0075363_100163674 3300006048 Unclassified 1260
31 Ga0075364_10002467 3300006051 Bacteria 10362
32 Ga0075364_10004632 3300006051 Bacteria 7928
33 Ga0075364_10050564 3300006051 Bacteria 2713
34 Ga0075364_10253255 3300006051 Bacteria 1197
35 Ga0075364_10440344 3300006051 Bacteria 890
36 Ga0075367_10030972 3300006178 Bacteria 3070
37 Ga0075367_10204563 3300006178 Bacteria 1234
38 Ga0075367_10505620 3300006178 Bacteria 767
39 Ga0075428_100019413 3300006844 Bacteria 7523
40 Ga0075428_100825286 3300006844 Bacteria 985
41 Ga0075430_100102135 3300006846 Bacteria 2394
42 Ga0075430_100352404 3300006846 Bacteria 1215
43 Ga0075430_100765806 3300006846 Bacteria 795
44 Ga0075430_100818358 3300006846 Bacteria 767
45 Ga0075430_101184080 3300006846 Bacteria 629
46 Ga0075431_100077954 3300006847 Bacteria 3420
47 Ga0075431_100218063 3300006847 Bacteria 1947
48 Ga0075429_101290721 3300006880 Bacteria 637
49 Ga0097620_100200010 3300006931 Bacteria 2083
50 Ga0097620_100333047 3300006931 Bacteria 1612
51 Ga0111539_11026152 3300009094 Bacteria 959
52 Ga0105245_10015679 3300009098 Bacteria 6607
53 Ga0105245_10022162 3300009098 Bacteria 5578
54 Ga0114129_10160550 3300009147 Bacteria 3071
55 Ga0105243_10032901 3300009148 Bacteria 4008
56 Ga0105242_10008926 3300009176 Bacteria 7694
57 Ga0105242_12048124 3300009176 Bacteria 615
58 Ga0105242_12125153 3300009176 Bacteria 606
59 Ga0105248_10293283 3300009177 Bacteria 1831
60 Ga0105249_10213588 3300009553 Bacteria 1894
61 Ga0105249_10373401 3300009553 Bacteria 1450
62 Ga0157378_10004101 3300013297 Bacteria 12869
63 Ga0157375_10023188 3300013308 Bacteria 5724
64 Ga0157380_12788303 3300014326 Bacteria 555
65 Ga0157379_10083121 3300014968 Bacteria 2870
66 Ga0157376_11053375 3300014969 Unclassified 838
67 Ga0213876_10018196 3300021384 Bacteria 3708
68 Ga0207659_10546359 3300025926 Unclassified 984
69 Ga0207687_10013028 3300025927 Bacteria 5432
70 Ga0207687_10113091 3300025927 Bacteria 2019
71 Ga0207644_10325837 3300025931 Unclassified 1243
72 Ga0207686_10860049 3300025934 Bacteria 730
73 Ga0207669_10457166 3300025937 Bacteria 1013
74 Ga0207669_11541690 3300025937 Unclassified 567
75 Ga0207711_11416706 3300025941 Bacteria 637
76 Ga0207661_10663291 3300025944 Bacteria 959
77 Ga0207668_10155691 3300025972 Bacteria 1775
78 Ga0207640_11574386 3300025981 Bacteria 592
79 Ga0207658_10342436 3300025986 Unclassified 1300
80 Ga0207708_10826611 3300026075 Bacteria 799
81 Ga0207683_10990137 3300026121 Bacteria 780
82 Ga0207698_10957782 3300026142 Unclassified 865
83 Ga0209813_10066633 3300027866 Bacteria 1162
84 Ga0209813_10070588 3300027866 Unclassified 1135
85 Ga0268266_10947805 3300028379 Bacteria 833
86 Ga0268265_10237818 3300028380 Bacteria 1605
87 Ga0268265_11656898 3300028380 Archaea 645
88 Ga0268264_10740974 3300028381 Unclassified 978
89 Ga0307517_10270038 3300028786 Bacteria 979
90 Ga0316575_10243307 3300031665 Bacteria 754
91 Ga0316579_10051595 3300031691 Bacteria 1925
92 Ga0316576_10007388 3300031727 Bacteria 6918
93 Ga0316576_10008130 3300031727 Bacteria 6659
94 Ga0316576_10045389 3300031727 Bacteria 3177
95 Ga0316576_10837833 3300031727 Unclassified 661
96 Ga0316578_10000507 3300031728 Bacteria 13197
97 Ga0316578_10002130 3300031728 Bacteria 8510
98 Ga0316578_10006074 3300031728 Bacteria 5922
99 Ga0316578_10114275 3300031728 Bacteria 1622
100 Ga0316578_10145564 3300031728 Bacteria 1427
101 Ga0316577_10086114 3300031733 Bacteria 1758
102 Ga0316585_10043637 3300032137 Bacteria 1432
103 Ga0316574_0010196 3300035398 Bacteria 5297
104 Ga0316574_0027596 3300035398 Bacteria 3420
105 Ga0316574_0063808 3300035398 Bacteria 2317
106 Ga0316574_0120534 3300035398 Unclassified 1684
107 Ga0316574_0224839 3300035398 Bacteria 1202
108 Ga0373931_0151626 3300035691 Bacteria 1352
109 Ga0316582_0090269 3300036647 Bacteria 2016
110 Ga0316582_0121623 3300036647 Bacteria 1747
111 Ga0316584_0006473 3300036712 Bacteria 7930
112 Ga0316584_0177015 3300036712 Bacteria 1580
113 Ga0316584_0188273 3300036712 Bacteria 1526
114 Ga0316584_0207725 3300036712 Bacteria 1442
115 Ga0436365_1171488 3300039437 Bacteria 23892
116 Ga0439436_0134133 3300041404 Unclassified 695
117 Ga0439466_0192432 3300041411 Unclassified 621
118 Ga0451797_1078511 3300041453 Bacteria 1536
119 Ga0451837_1599815 3300041494 Bacteria 1124
120 Ga0451853_1686915 3300041512 Unclassified 1263
121 Ga0439462_0118748 3300042015 Unclassified 735
122 Ga0439434_0044326 3300042435 Bacteria 1370
123 Ga0451577_0002485 3300042876 Bacteria 21912
124 Ga0466963_0878462 3300044694 Unclassified 632
125 Ga0453684_0018585 3300044712 Bacteria 10656
126 Ga0466967_0707824 3300045976 Bacteria 998
127 Ga0495592_0278282 3300046454 Bacteria 1095
128 Ga0495629_0090230 3300046459 Bacteria 2138
129 Ga0495641_0004660 3300046461 Bacteria 9582
130 Ga0495651_0233914 3300046462 Bacteria 1264
131 Ga0495583_0065382 3300046506 Bacteria 1611
132 Ga0495630_0027809 3300046517 Bacteria 4200
133 Ga0495630_0199902 3300046517 Bacteria 1525
134 Ga0495630_0217409 3300046517 Bacteria 1459
135 Ga0495630_0311119 3300046517 Unclassified 1204
136 Ga0495630_0563467 3300046517 Bacteria 874
137 Ga0495640_0596299 3300046533 Bacteria 667
138 Ga0495586_0304818 3300046535 Bacteria 913
139 Ga0495621_0243619 3300046539 Bacteria 733
140 Ga0495667_0312272 3300046559 Bacteria 995
141 Ga0495634_0004723 3300046642 Bacteria 10602
142 Ga0495588_0261989 3300046674 Bacteria 911
143 Ga0495647_0022852 3300046681 Unclassified 2263
144 Ga0495658_0704433 3300046683 Bacteria 647
145 Ga0495613_0020074 3300046689 Bacteria 4979
146 Ga0495613_0332398 3300046689 Unclassified 1047
147 Ga0495581_0558191 3300047315 Bacteria 664
148 Ga0495680_0155636 3300047322 Bacteria 1663
149 Ga0496100_0093607 3300048903 Bacteria 2056
150 Ga0496101_0034307 3300048904 Bacteria 3583
151 Ga0496102_0033911 3300048905 Bacteria 4590
152 Ga0496102_0046204 3300048905 Bacteria 3954
153 Ga0496103_0035471 3300048906 Bacteria 3054
154 Ga0496104_0010973 3300048907 Bacteria 8106
155 Ga0496104_0669085 3300048907 Bacteria 947
156 Ga0496105_0019685 3300048908 Bacteria 5445
157 Ga0496109_0734449 3300048912 Bacteria 925
158 Ga0496109_1563025 3300048912 Bacteria 594
159 Ga0496110_0025816 3300048913 Bacteria 5023
160 Ga0496110_0079756 3300048913 Bacteria 2915
161 Ga0496110_0633244 3300048913 Bacteria 969
162 Ga0496111_0033963 3300048914 Bacteria 3640
163 Ga0496111_0097117 3300048914 Bacteria 2163
164 Ga0496111_0294061 3300048914 Bacteria 1204
165 Ga0496113_0713170 3300048916 Unclassified 800
166 Ga0496114_0005224 3300048917 Bacteria 10145
167 Ga0496114_0015737 3300048917 Bacteria 6087
168 Ga0496114_0160558 3300048917 Bacteria 1954
169 Ga0496114_0525200 3300048917 Bacteria 1047
170 Ga0496114_0549979 3300048917 Bacteria 1020
171 Ga0496114_1208111 3300048917 Unclassified 642
172 Ga0501031_0013894 3300049568 Bacteria 5246
173 Ga0501031_0074653 3300049568 Bacteria 2208
174 Ga0501031_0706995 3300049568 Bacteria 647
175 Ga0501032_0078194 3300049569 Bacteria 2202
176 Ga0501032_0117724 3300049569 Bacteria 1757
177 Ga0501033_0502340 3300049570 Bacteria 839
178 Ga0501033_0628116 3300049570 Bacteria 735
179 Ga0501033_0775592 3300049570 Bacteria 649
180 Ga0501034_0012944 3300049571 Bacteria 8599
181 Ga0501034_0013572 3300049571 Bacteria 8385
182 Ga0501034_0066741 3300049571 Bacteria 3611
183 Ga0501034_0218103 3300049571 Bacteria 1861
184 Ga0501034_1023094 3300049571 Bacteria 709
185 Ga0501036_0125399 3300049572 Bacteria 2169
186 Ga0501036_0214926 3300049572 Unclassified 1615
187 Ga0501036_0880762 3300049572 Bacteria 735
188 Ga0501037_0038811 3300049573 Bacteria 3507
189 Ga0501038_0066664 3300049574 Bacteria 3065
190 Ga0501038_0159209 3300049574 Bacteria 1836
191 Ga0501038_0229401 3300049574 Bacteria 1478
192 Ga0501038_0265132 3300049574 Bacteria 1356
193 Ga0501038_0636318 3300049574 Bacteria 804
194 Ga0501038_0724709 3300049574 Bacteria 743
195 Ga0501039_0022969 3300049575 Bacteria 4784
196 Ga0501039_0133081 3300049575 Bacteria 1952
197 Ga0501040_0222069 3300049576 Bacteria 1344
198 Ga0501041_0118073 3300049577 Bacteria 1647
199 Ga0501041_0421023 3300049577 Bacteria 847
200 Ga0501042_0007774 3300049578 Bacteria 7046
201 Ga0501042_0154947 3300049578 Bacteria 1653
202 Ga0501042_0206415 3300049578 Bacteria 1417
203 Ga0501042_0476089 3300049578 Bacteria 906
204 Ga0501042_1216940 3300049578 Bacteria 549
205 Ga0501043_0011780 3300049579 Bacteria 6849
206 Ga0501043_0221833 3300049579 Bacteria 1462
207 Ga0501046_0060508 3300049580 Bacteria 2963
208 Ga0501046_0451827 3300049580 Bacteria 924
209 Ga0501046_0669575 3300049580 Bacteria 733
210 Ga0501047_0027017 3300049581 Bacteria 5528
211 Ga0501047_0439173 3300049581 Bacteria 1135
212 Ga0501048_0050827 3300049582 Bacteria 2952
213 Ga0501048_0200804 3300049582 Bacteria 1413
214 Ga0501068_0082712 3300049584 Bacteria 1972
215 Ga0501068_0580078 3300049584 Bacteria 730
216 Ga0501068_0592752 3300049584 Bacteria 722
217 Ga0501068_0603818 3300049584 Bacteria 715
218 Ga0501068_0659901 3300049584 Bacteria 683
219 Ga0501069_0092137 3300049585 Bacteria 1714
220 Ga0501069_0513423 3300049585 Bacteria 715
221 Ga0501070_0000030 3300049586 Bacteria 139270
222 Ga0501070_0002496 3300049586 Bacteria 16119
223 Ga0501070_0008802 3300049586 Bacteria 8536
224 Ga0501070_0155676 3300049586 Bacteria 1884
225 Ga0501071_0009090 3300049587 Bacteria 6597
226 Ga0501071_0073759 3300049587 Bacteria 2490
227 Ga0501071_0089191 3300049587 Bacteria 2263
228 Ga0501071_0104193 3300049587 Bacteria 2093
229 Ga0501072_0107753 3300049588 Bacteria 2217
230 Ga0501072_0515362 3300049588 Bacteria 946
231 Ga0501072_1203485 3300049588 Bacteria 588
232 Ga0501073_0001388 3300049589 Bacteria 17858
233 Ga0501073_0152820 3300049589 Bacteria 1600
234 Ga0501073_0340692 3300049589 Bacteria 1035
235 Ga0501073_0361791 3300049589 Bacteria 1002
236 Ga0501073_0922070 3300049589 Bacteria 601
237 Ga0501074_0041253 3300049590 Bacteria 3342
238 Ga0501074_0229031 3300049590 Bacteria 1323
239 Ga0501074_0464199 3300049590 Bacteria 897
240 Ga0501074_0822018 3300049590 Bacteria 654
241 Ga0501075_0055225 3300049591 Bacteria 2989
242 Ga0501075_0116203 3300049591 Bacteria 2034
243 Ga0501076_0048364 3300049592 Bacteria 3362
244 Ga0501076_0049805 3300049592 Bacteria 3314
245 Ga0501076_0099075 3300049592 Bacteria 2348
246 Ga0501079_0067669 3300049741 Unclassified 2757
247 Ga0501079_0071367 3300049741 Bacteria 2683
248 Ga0501079_0182261 3300049741 Bacteria 1639
249 Ga0501079_1003956 3300049741 Bacteria 657
250 Ga0501080_0001601 3300049742 Bacteria 19213
251 Ga0501080_0024435 3300049742 Bacteria 5600
252 Ga0501080_0029113 3300049742 Bacteria 5141
253 Ga0501080_0036529 3300049742 Bacteria 4585
254 Ga0501080_0722653 3300049742 Bacteria 877
255 Ga0501081_0202803 3300049743 Bacteria 1439
256 Ga0501081_0213463 3300049743 Bacteria 1402
257 Ga0501081_0633933 3300049743 Bacteria 801
258 Ga0501083_0000155 3300049744 Bacteria 45460
259 Ga0501035_0042564 3300049822 Bacteria 4096
260 Ga0501035_0746790 3300049822 Bacteria 786
261 Ga0501044_0004542 3300049823 Bacteria 15515
262 Ga0501044_0473231 3300049823 Bacteria 1157
263 Ga0501044_0944377 3300049823 Bacteria 736
264 Ga0501045_0023117 3300049824 Bacteria 4454
265 Ga0501045_0024263 3300049824 Unclassified 4353
266 Ga0501045_0845273 3300049824 Bacteria 673
267 nmdc:mga03683_17977_c1 3300050489 Bacteria 2682
268 nmdc:mga03683_30421_c1 3300050489 Bacteria 2160
269 nmdc:mga03683_96232_c1 3300050489 Unclassified 1296
270 nmdc:mga03n38_105722_c1 3300050490 Bacteria 1364
271 nmdc:mga03n38_115893_c1 3300050490 Bacteria 1311
272 nmdc:mga03n38_39406_c1 3300050490 Unclassified 2049
273 nmdc:mga03n38_425741_c1 3300050490 Bacteria 735
274 nmdc:mga00v17_13526_c1 3300050491 Bacteria 4534
275 nmdc:mga00v17_386601_c1 3300050491 Bacteria 910
276 nmdc:mga00v17_483718_c1 3300050491 Bacteria 803
277 nmdc:mga00v17_8591_c1 3300050491 Bacteria 5499
278 nmdc:mga00v17_98897_c1 3300050491 Unclassified 1840
279 nmdc:mga0yw44_425917_c1 3300050492 Unclassified 899
280 nmdc:mga0yw44_44085_c1 3300050492 Unclassified 2667
281 nmdc:mga0yw44_4725_c1 3300050492 Bacteria 6304
282 nmdc:mga0yw44_598844_c1 3300050492 Bacteria 749
283 nmdc:mga0yw44_675182_c1 3300050492 Bacteria 702
284 nmdc:mga0k408_585932_c1 3300050493 Bacteria 658
285 nmdc:mga06z11_111718_c1 3300050494 Bacteria 1514
286 nmdc:mga06z11_22267_c1 3300050494 Bacteria 2957
287 nmdc:mga06z11_57977_c1 3300050494 Unclassified 2008
288 nmdc:mga06z11_89419_c1 3300050494 Bacteria 1669
289 nmdc:mga04h51_65118_c1 3300050495 Unclassified 1259
290 nmdc:mga07m45_417266_c1 3300050496 Bacteria 779
291 nmdc:mga05p37_735276_c1 3300050507 Bacteria 1090
292 nmdc:mga0qj67_682153_c1 3300050509 Bacteria 818
293 nmdc:mga06r32_911157_c1 3300050510 Bacteria 835
294 nmdc:mga08y16_2157049_c1 3300050511 Unclassified 504
295 nmdc:mga0sz30_6053_c1 3300050516 Bacteria 4473
296 Ga0495619_0020780 3300053085 Bacteria 4187
297 Ga0500583_0265178 3300053092 Bacteria 846
298 Ga0500566_0384635 3300053094 Bacteria 633
299 Ga0500603_281596 3300053150 Bacteria 537
300 Ga0500604_0032051 3300053151 Bacteria 1546
301 Ga0500616_0000418 3300053153 Bacteria 57046
302 Ga0500616_0052063 3300053153 Bacteria 2154
303 Ga0501084_0000314 3300054114 Bacteria 36782
304 Ga0501084_0302900 3300054114 Bacteria 1350
305 Ga0501084_0472030 3300054114 Unclassified 1060
306 Ga0501082_0152258 3300060353 Bacteria 2009
307 Ga0501082_0157948 3300060353 Bacteria 1970
308 Ga0501082_0373873 3300060353 Bacteria 1243
309 Ga0501082_0456339 3300060353 Unclassified 1117
310 Ga0501082_0518782 3300060353 Bacteria 1042
311 Ga0530510_0098265 3300061734 Bacteria 2140
312 Ga0070674_100303771
313 Ga0070683_100233966
314 Ga0068869_100538050
315 Ga0068868_100253392
316 Ga0068868_102392757
317 Ga0070661_100207075
318 Ga0070669_100471199
319 Ga0070675_100281224
320 Ga0070671_100082836
321 Ga0070673_100903220
322 Ga0070688_100220857
323 Ga0070667_100169466
324 Ga0070700_100212507
325 Ga0070698_101061383
326 Ga0070665_100958548
327 Ga0070665_102261213
328 Ga0070702_100341733
329 Ga0068859_100200015
330 Ga0068859_100333065
331 Ga0068861_100050107
332 Ga0068860_100151759
333 Ga0068860_100359434
334 Ga0068862_100740685
335 Ga0068862_101864262
336 Ga0075365_10005266
337 Ga0075365_10086728
338 Ga0075365_10138409
339 Ga0075368_10026013
340 Ga0075363_100130648
341 Ga0075363_100163674
342 Ga0075364_10002467
343 Ga0075364_10004632
344 Ga0075364_10050564
345 Ga0075364_10253255
346 Ga0075364_10440344
347 Ga0075367_10030972
348 Ga0075367_10204563
349 Ga0075367_10505620
350 Ga0075428_100019413
351 Ga0075428_100825286
352 Ga0075430_100102135
353 Ga0075430_100352404
354 Ga0075430_100765806
355 Ga0075430_100818358
356 Ga0075430_101184080
357 Ga0075431_100077954
358 Ga0075431_100218063
359 Ga0075429_101290721
360 Ga0097620_100200010
361 Ga0097620_100333047
362 Ga0111539_11026152
363 Ga0105245_10015679
364 Ga0105245_10022162
365 Ga0114129_10160550
366 Ga0105243_10032901
367 Ga0105242_10008926
368 Ga0105242_12048124
369 Ga0105242_12125153
370 Ga0105248_10293283
371 Ga0105249_10213588
372 Ga0105249_10373401
373 Ga0157378_10004101
374 Ga0157375_10023188
375 Ga0157380_12788303
376 Ga0157379_10083121
377 Ga0157376_11053375
378 Ga0213876_10018196
379 Ga0207659_10546359
380 Ga0207687_10013028
381 Ga0207687_10113091
382 Ga0207644_10325837
383 Ga0207686_10860049
384 Ga0207669_10457166
385 Ga0207669_11541690
386 Ga0207711_11416706
387 Ga0207661_10663291
388 Ga0207668_10155691
389 Ga0207640_11574386
390 Ga0207658_10342436
391 Ga0207708_10826611
392 Ga0207683_10990137
393 Ga0207698_10957782
394 Ga0209813_10066633
395 Ga0209813_10070588
396 Ga0268266_10947805
397 Ga0268265_10237818
398 Ga0268265_11656898
399 Ga0268264_10740974
400 Ga0307517_10270038
401 Ga0316575_10243307
402 Ga0316579_10051595
403 Ga0316576_10007388
404 Ga0316576_10008130
405 Ga0316576_10045389
406 Ga0316576_10837833
407 Ga0316578_10000507
408 Ga0316578_10002130
409 Ga0316578_10006074
410 Ga0316578_10114275
411 Ga0316578_10145564
412 Ga0316577_10086114
413 Ga0316585_10043637
414 Ga0316574_0010196
415 Ga0316574_0027596
416 Ga0316574_0063808
417 Ga0316574_0120534
418 Ga0316574_0224839
419 Ga0373931_0151626
420 Ga0316582_0090269
421 Ga0316582_0121623
422 Ga0316584_0006473
423 Ga0316584_0177015
424 Ga0316584_0188273
425 Ga0316584_0207725
426 Ga0436365_1171488
427 Ga0439436_0134133
428 Ga0439466_0192432
429 Ga0451797_1078511
430 Ga0451837_1599815
431 Ga0451853_1686915
432 Ga0439462_0118748
433 Ga0439434_0044326
434 Ga0451577_0002485
435 Ga0466963_0878462
436 Ga0453684_0018585
437 Ga0466967_0707824
438 Ga0495592_0278282
439 Ga0495629_0090230
440 Ga0495641_0004660
441 Ga0495651_0233914
442 Ga0495583_0065382
443 Ga0495630_0027809
444 Ga0495630_0199902
445 Ga0495630_0217409
446 Ga0495630_0311119
447 Ga0495630_0563467
448 Ga0495640_0596299
449 Ga0495586_0304818
450 Ga0495621_0243619
451 Ga0495667_0312272
452 Ga0495634_0004723
453 Ga0495588_0261989
454 Ga0495647_0022852
455 Ga0495658_0704433
456 Ga0495613_0020074
457 Ga0495613_0332398
458 Ga0495581_0558191
459 Ga0495680_0155636
460 Ga0496100_0093607
461 Ga0496101_0034307
462 Ga0496102_0033911
463 Ga0496102_0046204
464 Ga0496103_0035471
465 Ga0496104_0010973
466 Ga0496104_0669085
467 Ga0496105_0019685
468 Ga0496109_0734449
469 Ga0496109_1563025
470 Ga0496110_0025816
471 Ga0496110_0079756
472 Ga0496110_0633244
473 Ga0496111_0033963
474 Ga0496111_0097117
475 Ga0496111_0294061
476 Ga0496113_0713170
477 Ga0496114_0005224
478 Ga0496114_0015737
479 Ga0496114_0160558
480 Ga0496114_0525200
481 Ga0496114_0549979
482 Ga0496114_1208111
483 Ga0501031_0013894
484 Ga0501031_0074653
485 Ga0501031_0706995
486 Ga0501032_0078194
487 Ga0501032_0117724
488 Ga0501033_0502340
489 Ga0501033_0628116
490 Ga0501033_0775592
491 Ga0501034_0012944
492 Ga0501034_0013572
493 Ga0501034_0066741
494 Ga0501034_0218103
495 Ga0501034_1023094
496 Ga0501036_0125399
497 Ga0501036_0214926
498 Ga0501036_0880762
499 Ga0501037_0038811
500 Ga0501038_0066664
501 Ga0501038_0159209
502 Ga0501038_0229401
503 Ga0501038_0265132
504 Ga0501038_0636318
505 Ga0501038_0724709
506 Ga0501039_0022969
507 Ga0501039_0133081
508 Ga0501040_0222069
509 Ga0501041_0118073
510 Ga0501041_0421023
511 Ga0501042_0007774
512 Ga0501042_0154947
513 Ga0501042_0206415
514 Ga0501042_0476089
515 Ga0501042_1216940
516 Ga0501043_0011780
517 Ga0501043_0221833
518 Ga0501046_0060508
519 Ga0501046_0451827
520 Ga0501046_0669575
521 Ga0501047_0027017
522 Ga0501047_0439173
523 Ga0501048_0050827
524 Ga0501048_0200804
525 Ga0501068_0082712
526 Ga0501068_0580078
527 Ga0501068_0592752
528 Ga0501068_0603818
529 Ga0501068_0659901
530 Ga0501069_0092137
531 Ga0501069_0513423
532 Ga0501070_0000030
533 Ga0501070_0002496
534 Ga0501070_0008802
535 Ga0501070_0155676
536 Ga0501071_0009090
537 Ga0501071_0073759
538 Ga0501071_0089191
539 Ga0501071_0104193
540 Ga0501072_0107753
541 Ga0501072_0515362
542 Ga0501072_1203485
543 Ga0501073_0001388
544 Ga0501073_0152820
545 Ga0501073_0340692
546 Ga0501073_0361791
547 Ga0501073_0922070
548 Ga0501074_0041253
549 Ga0501074_0229031
550 Ga0501074_0464199
551 Ga0501074_0822018
552 Ga0501075_0055225
553 Ga0501075_0116203
554 Ga0501076_0048364
555 Ga0501076_0049805
556 Ga0501076_0099075
557 Ga0501079_0067669
558 Ga0501079_0071367
559 Ga0501079_0182261
560 Ga0501079_1003956
561 Ga0501080_0001601
562 Ga0501080_0024435
563 Ga0501080_0029113
564 Ga0501080_0036529
565 Ga0501080_0722653
566 Ga0501081_0202803
567 Ga0501081_0213463
568 Ga0501081_0633933
569 Ga0501083_0000155
570 Ga0501035_0042564
571 Ga0501035_0746790
572 Ga0501044_0004542
573 Ga0501044_0473231
574 Ga0501044_0944377
575 Ga0501045_0023117
576 Ga0501045_0024263
577 Ga0501045_0845273
578 nmdc:mga03683_17977_c1
579 nmdc:mga03683_30421_c1
580 nmdc:mga03683_96232_c1
581 nmdc:mga03n38_105722_c1
582 nmdc:mga03n38_115893_c1
583 nmdc:mga03n38_39406_c1
584 nmdc:mga03n38_425741_c1
585 nmdc:mga00v17_13526_c1
586 nmdc:mga00v17_386601_c1
587 nmdc:mga00v17_483718_c1
588 nmdc:mga00v17_8591_c1
589 nmdc:mga00v17_98897_c1
590 nmdc:mga0yw44_425917_c1
591 nmdc:mga0yw44_44085_c1
592 nmdc:mga0yw44_4725_c1
593 nmdc:mga0yw44_598844_c1
594 nmdc:mga0yw44_675182_c1
595 nmdc:mga0k408_585932_c1
596 nmdc:mga06z11_111718_c1
597 nmdc:mga06z11_22267_c1
598 nmdc:mga06z11_57977_c1
599 nmdc:mga06z11_89419_c1
600 nmdc:mga04h51_65118_c1
601 nmdc:mga07m45_417266_c1
602 nmdc:mga05p37_735276_c1
603 nmdc:mga0qj67_682153_c1
604 nmdc:mga06r32_911157_c1
605 nmdc:mga08y16_2157049_c1
606 nmdc:mga0sz30_6053_c1
607 Ga0495619_0020780
608 Ga0500583_0265178
609 Ga0500566_0384635
610 Ga0500603_281596
611 Ga0500604_0032051
612 Ga0500616_0000418
613 Ga0500616_0052063
614 Ga0501084_0000314
615 Ga0501084_0302900
616 Ga0501084_0472030
617 Ga0501082_0152258
618 Ga0501082_0157948
619 Ga0501082_0373873
620 Ga0501082_0456339
621 Ga0501082_0518782
622 Ga0530510_0098265

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11349

DUF3151

Protein of unknown function (DUF3151)

36

163

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cgv-assembly3.cif.gz_C first tpr of spaghetti (rpap3) bound to hsp90 peptide srmeevd 0.8472 28 143
4cgv-assembly4.cif.gz_D first tpr of spaghetti (rpap3) bound to hsp90 peptide srmeevd 0.8432 28 143
8fe7-assembly4.cif.gz_G crystal structure of human o-glcnac transferase (ogt) in complex with an exosite-binding peptide (smg9) and udp-glcnac 0.8414 23 144
8pkp-assembly1.cif.gz_J cryo-em structure of the apo anaphase-promoting complex/cyclosome (apc/c) at 3.2 angstrom resolution 0.8392 41 144
5hgv-assembly1.cif.gz_A structure of an o-glcnac transferase point mutant, d554n in complex with peptide 0.8358 25 144
ID Description Score Start End Superfamily
af_O06310_16_142_1.10.3450.10 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.8968 16 142 1.10.3450.10
af_A4I5Y0_574_646_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8606 56 142 1.25.40.10
af_A0A0R0I3F3_277_391_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8569 28 84 1.25.40.10
af_Q86TZ1_263_346_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8549 44 140 1.25.40.10
3taxC01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8501 28 144 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A383EG36-F1-model_v4 DUF3151 domain-containing protein 0.994 20 144
AF-A0A848UJ29-F1-model_v4 DUF3151 family protein 0.9939 63 143
AF-A0A7K0JZP3-F1-model_v4 deleted 0.9898 70 144
AF-A0A3B9WPE3-F1-model_v4 DUF3151 domain-containing protein 0.987 20 142
AF-A0A7Y2GT20-F1-model_v4 DUF3151 family protein 0.9862 21 147

Map