F401063

General Info

Members Datasets Scaffolds Average Seq Length
311 164 622 208

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100408565|Ga0070689_1004085652
Length 224
Sequence LQNVYPHAWKGCGPMLHATILVLSLILFSAVVISVLIARPAITASRGGKILAFVAMFCLPIFCGVLGVSKEMVRSKSTNFCLSCHTMDGYGKSLYVDDPTHLPASHFQNHRVPADEACFSCHTNYAMFGGLKVKLYGLKHVAIYYLGTPPAPENIKLYEPYNNRECLHCHLGARSFEEGAVHNADPATLPAIKSNQLSCLSSGCHEIAHDLAHLKDAKFWKAGK

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
73 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
74 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
75 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
101 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
121 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
122 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
130 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
163 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
164 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.46
Metatranscriptomes 3.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.43
Rhizosphere 92.6
Stem 0
Stem Tuber 0
Unclassified 32.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100408565 3300005340 Bacteria 1149
2 Ga0065715_10165322 3300005293 Bacteria 1592
3 Ga0070690_100278524 3300005330 Bacteria 1192
4 Ga0070666_10075513 3300005335 Bacteria 2298
5 Ga0070680_100039015 3300005336 Bacteria 3842
6 Ga0070661_100212266 3300005344 Unclassified 1482
7 Ga0070692_10340613 3300005345 Unclassified 928
8 Ga0070703_10001218 3300005406 Bacteria 7843
9 Ga0070709_10026871 3300005434 Unclassified 3416
10 Ga0070709_10178965 3300005434 Bacteria 1488
11 Ga0070709_10240862 3300005434 Unclassified 1299
12 Ga0070714_101119845 3300005435 Unclassified 767
13 Ga0070713_100024942 3300005436 Bacteria 4666
14 Ga0070713_100576451 3300005436 Unclassified 1067
15 Ga0070713_100833057 3300005436 Bacteria 885
16 Ga0070710_10058208 3300005437 Unclassified 2192
17 Ga0070710_10167695 3300005437 Bacteria 1366
18 Ga0070711_100007264 3300005439 Bacteria 6732
19 Ga0070711_100020255 3300005439 Unclassified 4283
20 Ga0070711_100039563 3300005439 Bacteria 3177
21 Ga0070711_100334842 3300005439 Bacteria 1213
22 Ga0070711_100342949 3300005439 Bacteria 1199
23 Ga0070705_100008265 3300005440 Bacteria 5151
24 Ga0070705_100052307 3300005440 Bacteria 2385
25 Ga0070705_100263379 3300005440 Viruses 1217
26 Ga0070694_100020247 3300005444 Bacteria 4239
27 Ga0070694_100064877 3300005444 Unclassified 2500
28 Ga0070694_100252198 3300005444 Bacteria 1335
29 Ga0070708_100000430 3300005445 Bacteria 31264
30 Ga0070708_100011559 3300005445 Bacteria 7187
31 Ga0070708_100051501 3300005445 Bacteria 3648
32 Ga0070708_100133724 3300005445 Bacteria 2296
33 Ga0070681_10022036 3300005458 Bacteria 6393
34 Ga0070681_10045831 3300005458 Bacteria 4373
35 Ga0070681_10131100 3300005458 Bacteria 2439
36 Ga0070681_10913884 3300005458 Bacteria 796
37 Ga0070706_100006706 3300005467 Bacteria 10868
38 Ga0070706_100028555 3300005467 Bacteria 5137
39 Ga0070706_100073835 3300005467 Bacteria 3157
40 Ga0070706_100081179 3300005467 Bacteria 3003
41 Ga0070706_100218517 3300005467 Unclassified 1779
42 Ga0070707_100041218 3300005468 Bacteria 4418
43 Ga0070707_100250106 3300005468 Unclassified 1725
44 Ga0070707_100326522 3300005468 Bacteria 1491
45 Ga0070698_100004102 3300005471 Bacteria 16003
46 Ga0070699_100009102 3300005518 Bacteria 8609
47 Ga0070699_100016316 3300005518 Bacteria 6378
48 Ga0070679_100017738 3300005530 Bacteria 6891
49 Ga0070679_100057890 3300005530 Bacteria 3862
50 Ga0070679_100155126 3300005530 Bacteria 2265
51 Ga0070697_100000326 3300005536 Bacteria 37671
52 Ga0070697_100000868 3300005536 Bacteria 22740
53 Ga0070697_100001484 3300005536 Bacteria 17845
54 Ga0070697_100057331 3300005536 Bacteria 3169
55 Ga0070697_100184120 3300005536 Unclassified 1771
56 Ga0070697_100677594 3300005536 Unclassified 909
57 Ga0068853_100214840 3300005539 Unclassified 1754
58 Ga0070686_100073100 3300005544 Unclassified 2250
59 Ga0070695_100000899 3300005545 Bacteria 16058
60 Ga0070695_100012153 3300005545 Bacteria 5162
61 Ga0070695_100062631 3300005545 Bacteria 2416
62 Ga0070695_100347454 3300005545 Unclassified 1110
63 Ga0070695_100568766 3300005545 Bacteria 886
64 Ga0070696_100001003 3300005546 Bacteria 18310
65 Ga0070696_100067198 3300005546 Bacteria 2515
66 Ga0070696_100106958 3300005546 Bacteria 2011
67 Ga0070693_100000004 3300005547 Bacteria 94899
68 Ga0070693_100000150 3300005547 Bacteria 31809
69 Ga0070693_100005678 3300005547 Bacteria 6020
70 Ga0070693_100145707 3300005547 Unclassified 1495
71 Ga0070693_100273644 3300005547 Unclassified 1128
72 Ga0070665_100006558 3300005548 Bacteria 11830
73 Ga0070665_100093913 3300005548 Archaea 3004
74 Ga0070704_100065659 3300005549 Bacteria 2613
75 Ga0070704_100807820 3300005549 Bacteria 838
76 Ga0068856_100007603 3300005614 Bacteria 10576
77 Ga0068856_100097204 3300005614 Bacteria 2933
78 Ga0068856_100238192 3300005614 Bacteria 1835
79 Ga0068859_100155386 3300005617 Bacteria 2365
80 Ga0068864_100826371 3300005618 Unclassified 912
81 Ga0068870_10071978 3300005840 Bacteria 1888
82 Ga0068863_100012007 3300005841 Bacteria 8369
83 Ga0068863_100068858 3300005841 Archaea 3347
84 Ga0068863_100419591 3300005841 Bacteria 1311
85 Ga0068858_100179761 3300005842 Bacteria 1997
86 Ga0068858_100319997 3300005842 Bacteria 1482
87 Ga0068858_100747050 3300005842 Unclassified 953
88 Ga0068860_100006448 3300005843 Bacteria 11782
89 Ga0068860_100104491 3300005843 Bacteria 2704
90 Ga0070717_10023237 3300006028 Unclassified 4910
91 Ga0070715_10035992 3300006163 Bacteria 2039
92 Ga0070716_100200777 3300006173 Unclassified 1325
93 Ga0070716_100552936 3300006173 Unclassified 858
94 Ga0070716_100622333 3300006173 Bacteria 815
95 Ga0070712_100024816 3300006175 Unclassified 3977
96 Ga0070712_100159216 3300006175 Unclassified 1742
97 Ga0070712_100448382 3300006175 Bacteria 1074
98 Ga0097621_100025321 3300006237 Unclassified 4640
99 Ga0097621_100146652 3300006237 Bacteria 2021
100 Ga0097621_100289544 3300006237 Unclassified 1444
101 Ga0097621_100453347 3300006237 Bacteria 1156
102 Ga0068871_100011527 3300006358 Bacteria 6484
103 Ga0068871_100034912 3300006358 Bacteria 3993
104 Ga0075430_100507148 3300006846 Unclassified 996
105 Ga0075431_100847033 3300006847 Unclassified 886
106 Ga0075433_10119531 3300006852 Bacteria 2339
107 Ga0075434_100060609 3300006871 Bacteria 3763
108 Ga0075434_100473146 3300006871 Unclassified 1274
109 Ga0097620_100155389 3300006931 Bacteria 2365
110 Ga0075435_100019254 3300007076 Bacteria 5208
111 Ga0099795_10285140 3300007788 Unclassified 722
112 Ga0099795_10303958 3300007788 Unclassified 702
113 Ga0105240_10323555 3300009093 Bacteria 1757
114 Ga0105240_10325912 3300009093 Unclassified 1749
115 Ga0111539_10873585 3300009094 Bacteria 1046
116 Ga0105245_10008638 3300009098 Bacteria 8883
117 Ga0105245_10170353 3300009098 Bacteria 2073
118 Ga0105245_10250517 3300009098 Bacteria 1720
119 Ga0105247_10051982 3300009101 Bacteria 2525
120 Ga0105247_10072041 3300009101 Unclassified 2162
121 Ga0105247_10225960 3300009101 Unclassified 1269
122 Ga0114129_10475522 3300009147 Bacteria 1636
123 Ga0105241_10014492 3300009174 Bacteria 5774
124 Ga0105241_10025671 3300009174 Bacteria 4379
125 Ga0105241_10050281 3300009174 Bacteria 3177
126 Ga0105242_10025519 3300009176 Unclassified 4677
127 Ga0105248_10081076 3300009177 Unclassified 3648
128 Ga0105248_10643586 3300009177 Unclassified 1196
129 Ga0105237_10180712 3300009545 Unclassified 2110
130 Ga0105237_10260502 3300009545 Bacteria 1737
131 Ga0105237_10303241 3300009545 Unclassified 1600
132 Ga0105238_10042387 3300009551 Unclassified 4609
133 Ga0105238_10141558 3300009551 Unclassified 2382
134 Ga0105249_10628052 3300009553 Unclassified 1131
135 Ga0105249_11428701 3300009553 Unclassified 764
136 Ga0105239_10286537 3300010375 Bacteria 1855
137 Ga0105239_10286934 3300010375 Bacteria 1853
138 Ga0157373_10035232 3300013100 Bacteria 3594
139 Ga0157374_10833823 3300013296 Bacteria 939
140 Ga0157378_10004737 3300013297 Unclassified 11919
141 Ga0157378_10011294 3300013297 Bacteria 7817
142 Ga0157378_10023831 3300013297 Bacteria 5384
143 Ga0157378_10305361 3300013297 Unclassified 1541
144 Ga0157378_10929124 3300013297 Unclassified 902
145 Ga0163162_10010985 3300013306 Bacteria 8819
146 Ga0163162_10028850 3300013306 Bacteria 5493
147 Ga0157372_11146709 3300013307 Unclassified 899
148 Ga0157375_10687659 3300013308 Unclassified 1177
149 Ga0157375_10877175 3300013308 Viruses 1042
150 Ga0163163_10127961 3300014325 Bacteria 2578
151 Ga0163163_10826220 3300014325 Unclassified 990
152 Ga0157379_10014093 3300014968 Bacteria 7008
153 Ga0157379_10124906 3300014968 Bacteria 2315
154 Ga0157379_10415421 3300014968 Bacteria 1238
155 Ga0157376_10000053 3300014969 Bacteria 100358
156 Ga0157376_10022707 3300014969 Bacteria 4896
157 Ga0224569_100469 3300022732 Bacteria 3465
158 Ga0224571_100170 3300022734 Bacteria 2966
159 Ga0224572_1005585 3300024225 Bacteria 2247
160 Ga0228598_1003294 3300024227 Bacteria 3483
161 Ga0207653_10002701 3300025885 Bacteria 5636
162 Ga0207653_10003552 3300025885 Unclassified 4908
163 Ga0207692_10214007 3300025898 Bacteria 1139
164 Ga0207685_10141423 3300025905 Bacteria 1079
165 Ga0207699_10006867 3300025906 Bacteria 5536
166 Ga0207699_10046148 3300025906 Bacteria 2547
167 Ga0207699_10056877 3300025906 Unclassified 2334
168 Ga0207699_10145795 3300025906 Bacteria 1561
169 Ga0207684_10002897 3300025910 Bacteria 17008
170 Ga0207684_10005310 3300025910 Bacteria 11923
171 Ga0207684_10037718 3300025910 Bacteria 4101
172 Ga0207684_10139682 3300025910 Bacteria 2082
173 Ga0207684_10503582 3300025910 Unclassified 1038
174 Ga0207654_10005572 3300025911 Bacteria 6366
175 Ga0207654_10150454 3300025911 Bacteria 1493
176 Ga0207707_10018798 3300025912 Bacteria 6027
177 Ga0207707_10119874 3300025912 Bacteria 2300
178 Ga0207707_10178919 3300025912 Bacteria 1852
179 Ga0207695_10377358 3300025913 Unclassified 1304
180 Ga0207695_10401874 3300025913 Unclassified 1254
181 Ga0207693_10000675 3300025915 Bacteria 30648
182 Ga0207693_10002457 3300025915 Bacteria 16100
183 Ga0207693_10051894 3300025915 Bacteria 3217
184 Ga0207693_10058098 3300025915 Unclassified 3031
185 Ga0207693_10081577 3300025915 Bacteria 2532
186 Ga0207693_10649045 3300025915 Bacteria 820
187 Ga0207663_10029891 3300025916 Bacteria 3206
188 Ga0207663_10107799 3300025916 Bacteria 1885
189 Ga0207663_10136825 3300025916 Bacteria 1701
190 Ga0207663_10279025 3300025916 Bacteria 1240
191 Ga0207660_10030099 3300025917 Bacteria 3729
192 Ga0207652_10012222 3300025921 Bacteria 6937
193 Ga0207652_10015773 3300025921 Bacteria 6155
194 Ga0207652_10030631 3300025921 Bacteria 4507
195 Ga0207646_10009125 3300025922 Bacteria 9844
196 Ga0207646_10457397 3300025922 Unclassified 1151
197 Ga0207694_10092935 3300025924 Unclassified 2382
198 Ga0207687_10034834 3300025927 Bacteria 3422
199 Ga0207700_10508243 3300025928 Unclassified 1067
200 Ga0207670_10293610 3300025936 Unclassified 1271
201 Ga0207704_10226761 3300025938 Unclassified 1386
202 Ga0207665_10095365 3300025939 Bacteria 2067
203 Ga0207665_10115506 3300025939 Bacteria 1891
204 Ga0207665_10251720 3300025939 Bacteria 1305
205 Ga0207665_10368436 3300025939 Unclassified 1088
206 Ga0207665_10656138 3300025939 Bacteria 823
207 Ga0207712_10107657 3300025961 Bacteria 2085
208 Ga0207677_10084404 3300026023 Bacteria 2289
209 Ga0207703_10340328 3300026035 Bacteria 1379
210 Ga0207703_10853484 3300026035 Bacteria 871
211 Ga0207702_10030481 3300026078 Unclassified 4495
212 Ga0207702_10248039 3300026078 Bacteria 1671
213 Ga0207641_10004372 3300026088 Bacteria 12246
214 Ga0207641_10081507 3300026088 Archaea 2810
215 Ga0207641_10537498 3300026088 Unclassified 1138
216 Ga0265354_1000030 3300028016 Bacteria 22210
217 Ga0265354_1000095 3300028016 Bacteria 15142
218 Ga0265354_1000898 3300028016 Bacteria 4739
219 Ga0265354_1003606 3300028016 Bacteria 1713
220 Ga0265357_1007848 3300028023 Bacteria 1038
221 Ga0268266_10001385 3300028379 Bacteria 29151
222 Ga0268264_10035148 3300028381 Bacteria 4125
223 Ga0268264_10054731 3300028381 Bacteria 3332
224 Ga0265319_1000594 3300028563 Bacteria 24134
225 Ga0265318_10003272 3300028577 Bacteria 8235
226 Ga0265338_10143537 3300028800 Bacteria 1866
227 Ga0265770_1007318 3300030878 Unclassified 1551
228 Ga0265770_1014961 3300030878 Bacteria 1176
229 Ga0265765_1001307 3300030879 Bacteria 2274
230 Ga0265765_1002950 3300030879 Unclassified 1683
231 Ga0265760_10027890 3300031090 Unclassified 1656
232 Ga0265760_10038582 3300031090 Unclassified 1420
233 Ga0265760_10041740 3300031090 Bacteria 1368
234 Ga0265760_10079824 3300031090 Bacteria 1012
235 Ga0265332_10082714 3300031238 Unclassified 1361
236 Ga0265332_10156749 3300031238 Bacteria 952
237 Ga0265320_10004820 3300031240 Bacteria 8769
238 Ga0265325_10005661 3300031241 Bacteria 7686
239 Ga0265325_10013882 3300031241 Bacteria 4571
240 Ga0265329_10014560 3300031242 Bacteria 2773
241 Ga0265329_10052395 3300031242 Unclassified 1298
242 Ga0265329_10131500 3300031242 Unclassified 806
243 Ga0265340_10002487 3300031247 Bacteria 10473
244 Ga0265339_10023444 3300031249 Bacteria 3567
245 Ga0265331_10000131 3300031250 Bacteria 98518
246 Ga0265331_10004813 3300031250 Bacteria 8313
247 Ga0265316_10039681 3300031344 Bacteria 3780
248 Ga0265316_10081665 3300031344 Unclassified 2478
249 Ga0265316_10131472 3300031344 Bacteria 1885
250 Ga0265313_10001931 3300031595 Bacteria 18789
251 Ga0265313_10199940 3300031595 Bacteria 832
252 Ga0265342_10005332 3300031712 Bacteria 9839
253 Ga0316212_1000667 3300033547 Bacteria 4304
254 Ga0316212_1002743 3300033547 Unclassified 2518
255 Ga0316212_1003099 3300033547 Bacteria 2395
256 Ga0373940_0099542 3300035088 Unclassified 881
257 Ga0373932_0019800 3300035112 Bacteria 1758
258 Ga0373931_0232995 3300035691 Unclassified 1113
259 Ga0373927_0336229 3300035695 Unclassified 995
260 Ga0373933_0401183 3300035724 Unclassified 894
261 Ga0373937_0139053 3300036401 Bacteria 2271
262 Ga0265778_000304 3300036457 Unclassified 3694
263 Ga0265778_008269 3300036457 Unclassified 1154
264 Ga0373925_0389794 3300037068 Unclassified 1135
265 Ga0242420_043709 3300038996 Unclassified 861
266 Ga0436362_1147662 3300039453 Unclassified 1530
267 Ga0495651_0001760 3300046462 Bacteria 16712
268 Ga0495651_0156695 3300046462 Unclassified 1636
269 Ga0495580_0053164 3300046472 Bacteria 2859
270 Ga0495582_0238654 3300046473 Bacteria 1042
271 Ga0495664_0100147 3300046477 Bacteria 1745
272 Ga0495628_0032746 3300046516 Bacteria 4194
273 Ga0495630_0418328 3300046517 Unclassified 1027
274 Ga0495642_0265657 3300046528 Unclassified 751
275 Ga0495645_0081208 3300046543 Bacteria 2326
276 Ga0495667_0032589 3300046559 Bacteria 3491
277 Ga0495600_0020960 3300046809 Bacteria 4183
278 Ga0495674_0148579 3300047319 Unclassified 1966
279 Ga0495680_0000203 3300047322 Bacteria 64243
280 Ga0495675_0006503 3300047444 Bacteria 7153
281 Ga0496100_0098528 3300048903 Bacteria 2010
282 Ga0496100_0147146 3300048903 Unclassified 1676
283 Ga0496101_0000982 3300048904 Bacteria 16857
284 Ga0496102_0019876 3300048905 Bacteria 5922
285 Ga0496102_0060274 3300048905 Bacteria 3471
286 Ga0496102_0643440 3300048905 Unclassified 983
287 Ga0496103_0276703 3300048906 Unclassified 1080
288 Ga0496104_0263327 3300048907 Bacteria 1637
289 Ga0496105_0133195 3300048908 Unclassified 2048
290 Ga0496106_0340042 3300048909 Unclassified 1205
291 Ga0496107_0038874 3300048910 Unclassified 3413
292 Ga0496107_0204107 3300048910 Unclassified 1469
293 Ga0496108_0733092 3300048911 Unclassified 856
294 Ga0496112_0021700 3300048915 Bacteria 6109
295 Ga0496112_0087952 3300048915 Bacteria 3074
296 Ga0496112_0198533 3300048915 Bacteria 1966
297 Ga0496112_0281337 3300048915 Unclassified 1611
298 Ga0496114_0131784 3300048917 Unclassified 2159
299 Ga0496114_0577121 3300048917 Unclassified 992
300 Ga0496115_0012051 3300048918 Bacteria 6500
301 nmdc:mga05p37_1248524_c1 3300050507 Unclassified 763
302 nmdc:mga05p37_165985_c1 3300050507 Bacteria 2695
303 nmdc:mga0n895_116307_c1 3300050512 Bacteria 2693
304 nmdc:mga0n895_473536_c1 3300050512 Unclassified 1263
305 nmdc:mga0rr50_132826_c1 3300050513 Bacteria 1995
306 nmdc:mga08x19_214910_c1 3300050514 Unclassified 1320
307 nmdc:mga0a205_446368_c1 3300050515 Unclassified 1154
308 Ga0495601_0062125 3300053077 Bacteria 2372
309 Ga0495612_0129005 3300053078 Unclassified 1092
310 Ga0495655_0000038 3300053083 Bacteria 27166
311 Ga0587102_007487 3300059649 Bacteria 1016
312 Ga0070689_100408565
313 Ga0065715_10165322
314 Ga0070690_100278524
315 Ga0070666_10075513
316 Ga0070680_100039015
317 Ga0070661_100212266
318 Ga0070692_10340613
319 Ga0070703_10001218
320 Ga0070709_10026871
321 Ga0070709_10178965
322 Ga0070709_10240862
323 Ga0070714_101119845
324 Ga0070713_100024942
325 Ga0070713_100576451
326 Ga0070713_100833057
327 Ga0070710_10058208
328 Ga0070710_10167695
329 Ga0070711_100007264
330 Ga0070711_100020255
331 Ga0070711_100039563
332 Ga0070711_100334842
333 Ga0070711_100342949
334 Ga0070705_100008265
335 Ga0070705_100052307
336 Ga0070705_100263379
337 Ga0070694_100020247
338 Ga0070694_100064877
339 Ga0070694_100252198
340 Ga0070708_100000430
341 Ga0070708_100011559
342 Ga0070708_100051501
343 Ga0070708_100133724
344 Ga0070681_10022036
345 Ga0070681_10045831
346 Ga0070681_10131100
347 Ga0070681_10913884
348 Ga0070706_100006706
349 Ga0070706_100028555
350 Ga0070706_100073835
351 Ga0070706_100081179
352 Ga0070706_100218517
353 Ga0070707_100041218
354 Ga0070707_100250106
355 Ga0070707_100326522
356 Ga0070698_100004102
357 Ga0070699_100009102
358 Ga0070699_100016316
359 Ga0070679_100017738
360 Ga0070679_100057890
361 Ga0070679_100155126
362 Ga0070697_100000326
363 Ga0070697_100000868
364 Ga0070697_100001484
365 Ga0070697_100057331
366 Ga0070697_100184120
367 Ga0070697_100677594
368 Ga0068853_100214840
369 Ga0070686_100073100
370 Ga0070695_100000899
371 Ga0070695_100012153
372 Ga0070695_100062631
373 Ga0070695_100347454
374 Ga0070695_100568766
375 Ga0070696_100001003
376 Ga0070696_100067198
377 Ga0070696_100106958
378 Ga0070693_100000004
379 Ga0070693_100000150
380 Ga0070693_100005678
381 Ga0070693_100145707
382 Ga0070693_100273644
383 Ga0070665_100006558
384 Ga0070665_100093913
385 Ga0070704_100065659
386 Ga0070704_100807820
387 Ga0068856_100007603
388 Ga0068856_100097204
389 Ga0068856_100238192
390 Ga0068859_100155386
391 Ga0068864_100826371
392 Ga0068870_10071978
393 Ga0068863_100012007
394 Ga0068863_100068858
395 Ga0068863_100419591
396 Ga0068858_100179761
397 Ga0068858_100319997
398 Ga0068858_100747050
399 Ga0068860_100006448
400 Ga0068860_100104491
401 Ga0070717_10023237
402 Ga0070715_10035992
403 Ga0070716_100200777
404 Ga0070716_100552936
405 Ga0070716_100622333
406 Ga0070712_100024816
407 Ga0070712_100159216
408 Ga0070712_100448382
409 Ga0097621_100025321
410 Ga0097621_100146652
411 Ga0097621_100289544
412 Ga0097621_100453347
413 Ga0068871_100011527
414 Ga0068871_100034912
415 Ga0075430_100507148
416 Ga0075431_100847033
417 Ga0075433_10119531
418 Ga0075434_100060609
419 Ga0075434_100473146
420 Ga0097620_100155389
421 Ga0075435_100019254
422 Ga0099795_10285140
423 Ga0099795_10303958
424 Ga0105240_10323555
425 Ga0105240_10325912
426 Ga0111539_10873585
427 Ga0105245_10008638
428 Ga0105245_10170353
429 Ga0105245_10250517
430 Ga0105247_10051982
431 Ga0105247_10072041
432 Ga0105247_10225960
433 Ga0114129_10475522
434 Ga0105241_10014492
435 Ga0105241_10025671
436 Ga0105241_10050281
437 Ga0105242_10025519
438 Ga0105248_10081076
439 Ga0105248_10643586
440 Ga0105237_10180712
441 Ga0105237_10260502
442 Ga0105237_10303241
443 Ga0105238_10042387
444 Ga0105238_10141558
445 Ga0105249_10628052
446 Ga0105249_11428701
447 Ga0105239_10286537
448 Ga0105239_10286934
449 Ga0157373_10035232
450 Ga0157374_10833823
451 Ga0157378_10004737
452 Ga0157378_10011294
453 Ga0157378_10023831
454 Ga0157378_10305361
455 Ga0157378_10929124
456 Ga0163162_10010985
457 Ga0163162_10028850
458 Ga0157372_11146709
459 Ga0157375_10687659
460 Ga0157375_10877175
461 Ga0163163_10127961
462 Ga0163163_10826220
463 Ga0157379_10014093
464 Ga0157379_10124906
465 Ga0157379_10415421
466 Ga0157376_10000053
467 Ga0157376_10022707
468 Ga0224569_100469
469 Ga0224571_100170
470 Ga0224572_1005585
471 Ga0228598_1003294
472 Ga0207653_10002701
473 Ga0207653_10003552
474 Ga0207692_10214007
475 Ga0207685_10141423
476 Ga0207699_10006867
477 Ga0207699_10046148
478 Ga0207699_10056877
479 Ga0207699_10145795
480 Ga0207684_10002897
481 Ga0207684_10005310
482 Ga0207684_10037718
483 Ga0207684_10139682
484 Ga0207684_10503582
485 Ga0207654_10005572
486 Ga0207654_10150454
487 Ga0207707_10018798
488 Ga0207707_10119874
489 Ga0207707_10178919
490 Ga0207695_10377358
491 Ga0207695_10401874
492 Ga0207693_10000675
493 Ga0207693_10002457
494 Ga0207693_10051894
495 Ga0207693_10058098
496 Ga0207693_10081577
497 Ga0207693_10649045
498 Ga0207663_10029891
499 Ga0207663_10107799
500 Ga0207663_10136825
501 Ga0207663_10279025
502 Ga0207660_10030099
503 Ga0207652_10012222
504 Ga0207652_10015773
505 Ga0207652_10030631
506 Ga0207646_10009125
507 Ga0207646_10457397
508 Ga0207694_10092935
509 Ga0207687_10034834
510 Ga0207700_10508243
511 Ga0207670_10293610
512 Ga0207704_10226761
513 Ga0207665_10095365
514 Ga0207665_10115506
515 Ga0207665_10251720
516 Ga0207665_10368436
517 Ga0207665_10656138
518 Ga0207712_10107657
519 Ga0207677_10084404
520 Ga0207703_10340328
521 Ga0207703_10853484
522 Ga0207702_10030481
523 Ga0207702_10248039
524 Ga0207641_10004372
525 Ga0207641_10081507
526 Ga0207641_10537498
527 Ga0265354_1000030
528 Ga0265354_1000095
529 Ga0265354_1000898
530 Ga0265354_1003606
531 Ga0265357_1007848
532 Ga0268266_10001385
533 Ga0268264_10035148
534 Ga0268264_10054731
535 Ga0265319_1000594
536 Ga0265318_10003272
537 Ga0265338_10143537
538 Ga0265770_1007318
539 Ga0265770_1014961
540 Ga0265765_1001307
541 Ga0265765_1002950
542 Ga0265760_10027890
543 Ga0265760_10038582
544 Ga0265760_10041740
545 Ga0265760_10079824
546 Ga0265332_10082714
547 Ga0265332_10156749
548 Ga0265320_10004820
549 Ga0265325_10005661
550 Ga0265325_10013882
551 Ga0265329_10014560
552 Ga0265329_10052395
553 Ga0265329_10131500
554 Ga0265340_10002487
555 Ga0265339_10023444
556 Ga0265331_10000131
557 Ga0265331_10004813
558 Ga0265316_10039681
559 Ga0265316_10081665
560 Ga0265316_10131472
561 Ga0265313_10001931
562 Ga0265313_10199940
563 Ga0265342_10005332
564 Ga0316212_1000667
565 Ga0316212_1002743
566 Ga0316212_1003099
567 Ga0373940_0099542
568 Ga0373932_0019800
569 Ga0373931_0232995
570 Ga0373927_0336229
571 Ga0373933_0401183
572 Ga0373937_0139053
573 Ga0265778_000304
574 Ga0265778_008269
575 Ga0373925_0389794
576 Ga0242420_043709
577 Ga0436362_1147662
578 Ga0495651_0001760
579 Ga0495651_0156695
580 Ga0495580_0053164
581 Ga0495582_0238654
582 Ga0495664_0100147
583 Ga0495628_0032746
584 Ga0495630_0418328
585 Ga0495642_0265657
586 Ga0495645_0081208
587 Ga0495667_0032589
588 Ga0495600_0020960
589 Ga0495674_0148579
590 Ga0495680_0000203
591 Ga0495675_0006503
592 Ga0496100_0098528
593 Ga0496100_0147146
594 Ga0496101_0000982
595 Ga0496102_0019876
596 Ga0496102_0060274
597 Ga0496102_0643440
598 Ga0496103_0276703
599 Ga0496104_0263327
600 Ga0496105_0133195
601 Ga0496106_0340042
602 Ga0496107_0038874
603 Ga0496107_0204107
604 Ga0496108_0733092
605 Ga0496112_0021700
606 Ga0496112_0087952
607 Ga0496112_0198533
608 Ga0496112_0281337
609 Ga0496114_0131784
610 Ga0496114_0577121
611 Ga0496115_0012051
612 nmdc:mga05p37_1248524_c1
613 nmdc:mga05p37_165985_c1
614 nmdc:mga0n895_116307_c1
615 nmdc:mga0n895_473536_c1
616 nmdc:mga0rr50_132826_c1
617 nmdc:mga08x19_214910_c1
618 nmdc:mga0a205_446368_c1
619 Ga0495601_0062125
620 Ga0495612_0129005
621 Ga0495655_0000038
622 Ga0587102_007487

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03264

Cytochrom_NNT

NapC/NirT cytochrome c family, N-terminal region

44

214

0.76

Map