F400754

General Info

Members Datasets Scaffolds Average Seq Length
310 177 620 209

Family's Representative Sequence

Representative Sequence 3300025917|Ga0207660_10022458|Ga0207660_100224583
Length 235
Sequence MPAASAIALFCLASVALAVVPGPAVTYIVTHSIDKGRRAGLVSALGIASGGLVHVVAATVGLSALIASSATAFTAVKLVGAAYLVAVGIRRIASRKEDDEIQSVPAPHRRLYVQGVVVNVLNPKTALFFLAFLPQFVDPARGAIWLQVAFLGILFALIAFASDVSYALLADLLAGRLRRSSRGARVRRWLTGGIFIALGVTAATAHRGTVIDIPRLYRGSLPEKRSRWLRELTGR

Samples

Sample ID Description Type Environment
1 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
59 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
69 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
70 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
71 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
72 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
81 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
82 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
83 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
84 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
173 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 1.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 16.45
Rhizosphere 83.23
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207660_10022458 3300025917 Bacteria 4251
2 JGI25406J46586_10019567 3300003203 Unclassified 2754
3 Ga0070658_10076998 3300005327 Bacteria 2736
4 Ga0070658_10157762 3300005327 Bacteria 1902
5 Ga0070683_100179970 3300005329 Bacteria 2007
6 Ga0070683_100431652 3300005329 Bacteria 1257
7 Ga0070683_100888132 3300005329 Bacteria 855
8 Ga0070680_100057495 3300005336 Bacteria 3179
9 Ga0070680_100136389 3300005336 Bacteria 2056
10 Ga0070680_100354861 3300005336 Bacteria 1247
11 Ga0070682_100149008 3300005337 Bacteria 1603
12 Ga0068868_100477979 3300005338 Bacteria 1088
13 Ga0070660_100029220 3300005339 Bacteria 4129
14 Ga0070660_100054510 3300005339 Bacteria 3088
15 Ga0070660_100514051 3300005339 Bacteria 997
16 Ga0070714_100154897 3300005435 Bacteria 2068
17 Ga0070713_100114224 3300005436 Bacteria 2359
18 Ga0070710_10084213 3300005437 Bacteria 1863
19 Ga0070711_100085612 3300005439 Bacteria 2258
20 Ga0070681_10066196 3300005458 Bacteria 3582
21 Ga0070681_10509557 3300005458 Bacteria 1117
22 Ga0070679_100010621 3300005530 Bacteria 8738
23 Ga0070679_100066664 3300005530 Bacteria 3588
24 Ga0070679_100144490 3300005530 Bacteria 2357
25 Ga0070684_100061830 3300005535 Bacteria 3278
26 Ga0070684_100235239 3300005535 Bacteria 1673
27 Ga0068855_100119369 3300005563 Bacteria 3019
28 Ga0068855_100179950 3300005563 Bacteria 2391
29 Ga0068855_100669046 3300005563 Bacteria 1113
30 Ga0070664_100390841 3300005564 Bacteria 1271
31 Ga0068857_100030098 3300005577 Bacteria 4791
32 Ga0068856_100620446 3300005614 Bacteria 1102
33 Ga0068852_100086065 3300005616 Bacteria 2801
34 Ga0068851_10240307 3300005834 Bacteria 1024
35 Ga0081538_10001556 3300005981 Bacteria 23519
36 Ga0081538_10098030 3300005981 Bacteria 1487
37 Ga0081539_10003298 3300005985 Bacteria 20193
38 Ga0070717_10063525 3300006028 Bacteria 3065
39 Ga0070712_100601993 3300006175 Bacteria 930
40 Ga0097621_100500786 3300006237 Bacteria 1100
41 Ga0075434_100070157 3300006871 Bacteria 3495
42 Ga0105240_10450163 3300009093 Bacteria 1441
43 Ga0111539_10734446 3300009094 Bacteria 1149
44 Ga0111539_10972755 3300009094 Bacteria 987
45 Ga0111539_11533828 3300009094 Bacteria 773
46 Ga0114129_10519120 3300009147 Bacteria 1553
47 Ga0105243_10084212 3300009148 Bacteria 2604
48 Ga0105242_10004056 3300009176 Bacteria 11378
49 Ga0105242_10907199 3300009176 Bacteria 882
50 Ga0105248_10400079 3300009177 Bacteria 1546
51 Ga0157370_10075406 3300013104 Bacteria 3179
52 Ga0157369_10004049 3300013105 Bacteria 17368
53 Ga0157369_10005636 3300013105 Bacteria 14546
54 Ga0157369_10024357 3300013105 Bacteria 6734
55 Ga0157369_10085049 3300013105 Bacteria 3380
56 Ga0157374_10750314 3300013296 Bacteria 991
57 Ga0157378_10208146 3300013297 Bacteria 1853
58 Ga0157372_10087906 3300013307 Bacteria 3527
59 Ga0157375_10123782 3300013308 Bacteria 2698
60 Ga0206356_11431211 3300020070 Bacteria 1627
61 Ga0206354_10038193 3300020081 Bacteria 1411
62 Ga0206354_10989008 3300020081 Bacteria 1605
63 Ga0206353_10103595 3300020082 Bacteria 4025
64 Ga0206353_10198565 3300020082 Bacteria 4664
65 Ga0206353_12048701 3300020082 Bacteria 7936
66 Ga0207685_10043237 3300025905 Bacteria 1696
67 Ga0207705_10082406 3300025909 Bacteria 2346
68 Ga0207705_10201539 3300025909 Bacteria 1508
69 Ga0207705_10356732 3300025909 Bacteria 1127
70 Ga0207705_10439797 3300025909 Bacteria 1011
71 Ga0207707_10047959 3300025912 Bacteria 3721
72 Ga0207707_10504340 3300025912 Bacteria 1032
73 Ga0207660_10315934 3300025917 Bacteria 1246
74 Ga0207657_10016620 3300025919 Bacteria 7089
75 Ga0207657_10025597 3300025919 Bacteria 5437
76 Ga0207652_10021013 3300025921 Bacteria 5384
77 Ga0207652_10076376 3300025921 Bacteria 2921
78 Ga0207652_10324053 3300025921 Bacteria 1391
79 Ga0207646_10240488 3300025922 Bacteria 1635
80 Ga0207664_10069094 3300025929 Bacteria 2840
81 Ga0207664_10784619 3300025929 Bacteria 857
82 Ga0207644_10113222 3300025931 Bacteria 2054
83 Ga0207686_10116162 3300025934 Bacteria 1813
84 Ga0207686_10810945 3300025934 Bacteria 751
85 Ga0207711_10276401 3300025941 Bacteria 1546
86 Ga0207661_10497872 3300025944 Bacteria 1113
87 Ga0207667_10769376 3300025949 Bacteria 961
88 Ga0207677_10731549 3300026023 Bacteria 880
89 Ga0207678_10273140 3300026067 Bacteria 1450
90 Ga0207674_10133376 3300026116 Bacteria 2446
91 Ga0265326_10060140 3300028558 Bacteria 1075
92 Ga0265318_10002819 3300028577 Bacteria 9076
93 Ga0265338_10043633 3300028800 Bacteria 4155
94 Ga0265320_10028305 3300031240 Bacteria 2911
95 Ga0307408_100036926 3300031548 Bacteria 3438
96 Ga0307408_100281175 3300031548 Bacteria 1386
97 Ga0265314_10138157 3300031711 Bacteria 1511
98 Ga0307405_10135029 3300031731 Bacteria 1711
99 Ga0307409_100087660 3300031995 Bacteria 2537
100 Ga0307411_10293654 3300032005 Bacteria 1300
101 Ga0307415_100014369 3300032126 Bacteria 4653
102 Ga0373945_0010565 3300035116 Bacteria 3042
103 Ga0373957_0216652 3300035120 Bacteria 801
104 Ga0373957_0222483 3300035120 Bacteria 790
105 Ga0373943_0000090 3300035170 Bacteria 33196
106 Ga0373935_0716182 3300035692 Bacteria 736
107 Ga0373947_0000266 3300035725 Bacteria 29609
108 Ga0373937_0462975 3300036401 Bacteria 1204
109 Ga0395899_0238211 3300037312 Unclassified 1253
110 Ga0395899_0254901 3300037312 Bacteria 1202
111 Ga0395900_0063347 3300037418 Bacteria 3801
112 Ga0395900_0136919 3300037418 Bacteria 2509
113 Ga0395900_0228195 3300037418 Bacteria 1874
114 Ga0395900_0625573 3300037418 Bacteria 1015
115 Ga0395898_0004082 3300037466 Bacteria 16015
116 Ga0395898_0038547 3300037466 Bacteria 4735
117 Ga0395898_0273081 3300037466 Bacteria 1612
118 Ga0395898_0372375 3300037466 Bacteria 1362
119 Ga0395898_0503066 3300037466 Bacteria 1152
120 Ga0395898_0594656 3300037466 Bacteria 1049
121 Ga0395905_0238165 3300037471 Bacteria 1701
122 Ga0395905_0327185 3300037471 Bacteria 1423
123 Ga0395905_0826160 3300037471 Bacteria 829
124 Ga0395901_0006813 3300038443 Bacteria 11538
125 Ga0395901_0008455 3300038443 Bacteria 10400
126 Ga0395901_0173055 3300038443 Bacteria 2265
127 Ga0395901_0255653 3300038443 Unclassified 1824
128 Ga0395901_0394022 3300038443 Bacteria 1423
129 Ga0395901_0990890 3300038443 Bacteria 817
130 Ga0395901_1073414 3300038443 Bacteria 777
131 Ga0436365_1417768 3300039437 Bacteria 947
132 Ga0439461_0006766 3300041410 Bacteria 2005
133 Ga0439452_030500 3300042010 Bacteria 1329
134 Ga0439454_022048 3300042011 Bacteria 946
135 Ga0439446_0035445 3300042156 Bacteria 1455
136 Ga0466969_0247810 3300044656 Bacteria 808
137 Ga0466966_0119206 3300044684 Bacteria 1622
138 Ga0466961_0150091 3300044693 Bacteria 1455
139 Ga0466963_0020250 3300044694 Bacteria 4183
140 Ga0466970_0030046 3300044765 Bacteria 2865
141 Ga0466967_0101062 3300045976 Bacteria 2635
142 Ga0466967_0163785 3300045976 Bacteria 2089
143 Ga0495592_0031165 3300046454 Bacteria 4031
144 Ga0495603_0284744 3300046455 Bacteria 950
145 Ga0495629_0020994 3300046459 Bacteria 4661
146 Ga0495629_0060003 3300046459 Bacteria 2659
147 Ga0495629_0117791 3300046459 Bacteria 1850
148 Ga0495641_0002960 3300046461 Bacteria 13075
149 Ga0495641_0035510 3300046461 Bacteria 2349
150 Ga0495641_0045610 3300046461 Bacteria 2018
151 Ga0495651_0069048 3300046462 Bacteria 2692
152 Ga0495653_0022612 3300046463 Bacteria 5085
153 Ga0495582_0000205 3300046473 Bacteria 32805
154 Ga0495639_0000856 3300046475 Bacteria 13796
155 Ga0495662_0002316 3300046476 Bacteria 9603
156 Ga0495594_0022107 3300046499 Bacteria 3401
157 Ga0495608_0008052 3300046511 Bacteria 7407
158 Ga0495608_0181254 3300046511 Bacteria 1332
159 Ga0495618_0075652 3300046514 Bacteria 2145
160 Ga0495628_0262302 3300046516 Bacteria 1287
161 Ga0495630_0076765 3300046517 Bacteria 2518
162 Ga0495630_0136302 3300046517 Bacteria 1865
163 Ga0495652_0046104 3300046529 Bacteria 3743
164 Ga0495652_0401669 3300046529 Bacteria 970
165 Ga0495665_0002580 3300046531 Bacteria 9785
166 Ga0495640_0461564 3300046533 Bacteria 775
167 Ga0495587_0073617 3300046536 Bacteria 1984
168 Ga0495645_0107437 3300046543 Bacteria 1978
169 Ga0495667_0071363 3300046559 Bacteria 2265
170 Ga0495667_0218122 3300046559 Bacteria 1218
171 Ga0495667_0250359 3300046559 Bacteria 1127
172 Ga0495634_0099220 3300046642 Bacteria 1883
173 Ga0495635_0004657 3300046663 Bacteria 9522
174 Ga0495657_0006877 3300046675 Bacteria 8839
175 Ga0495599_0019136 3300046678 Bacteria 4269
176 Ga0495599_0210834 3300046678 Bacteria 1191
177 Ga0495623_0090446 3300046679 Bacteria 1879
178 Ga0495646_0026906 3300046680 Bacteria 3611
179 Ga0495647_0002488 3300046681 Bacteria 5831
180 Ga0495658_0001591 3300046683 Bacteria 11831
181 Ga0495658_0081394 3300046683 Bacteria 1901
182 Ga0495613_0003799 3300046689 Bacteria 11321
183 Ga0495613_0110194 3300046689 Bacteria 1984
184 Ga0495613_0363370 3300046689 Bacteria 992
185 Ga0495624_0023864 3300046690 Bacteria 4029
186 Ga0495600_0071884 3300046809 Bacteria 2260
187 Ga0495581_0001349 3300047315 Bacteria 13571
188 Ga0495604_0163395 3300047317 Bacteria 1571
189 Ga0495674_0024294 3300047319 Bacteria 5571
190 Ga0495676_0029766 3300047321 Bacteria 4645
191 Ga0495680_0013317 3300047322 Bacteria 7181
192 Ga0495680_0059134 3300047322 Bacteria 2960
193 Ga0495675_0005032 3300047444 Bacteria 8040
194 Ga0495684_0051776 3300047471 Bacteria 3133
195 Ga0495684_0592283 3300047471 Bacteria 749
196 Ga0495593_0028506 3300047673 Bacteria 3066
197 Ga0495602_0072673 3300048088 Bacteria 2931
198 Ga0495614_0015700 3300048089 Bacteria 3299
199 Ga0496100_0002444 3300048903 Bacteria 9423
200 Ga0496100_0040928 3300048903 Bacteria 2951
201 Ga0496100_0247106 3300048903 Bacteria 1318
202 Ga0496101_0003866 3300048904 Bacteria 9361
203 Ga0496101_0011267 3300048904 Bacteria 5926
204 Ga0496101_0014522 3300048904 Bacteria 5294
205 Ga0496101_0051871 3300048904 Bacteria 2956
206 Ga0496102_0006241 3300048905 Bacteria 10162
207 Ga0496102_0025507 3300048905 Bacteria 5263
208 Ga0496102_0025746 3300048905 Bacteria 5239
209 Ga0496102_0219336 3300048905 Bacteria 1793
210 Ga0496103_0081391 3300048906 Bacteria 2037
211 Ga0496104_0007187 3300048907 Bacteria 9818
212 Ga0496104_0007748 3300048907 Bacteria 9512
213 Ga0496105_0000727 3300048908 Bacteria 22313
214 Ga0496105_0036921 3300048908 Bacteria 4025
215 Ga0496105_0216035 3300048908 Bacteria 1562
216 Ga0496106_0006625 3300048909 Bacteria 8573
217 Ga0496106_0055480 3300048909 Bacteria 2995
218 Ga0496106_0170488 3300048909 Bacteria 1725
219 Ga0496106_0332689 3300048909 Bacteria 1219
220 Ga0496107_0005051 3300048910 Bacteria 8996
221 Ga0496107_0057236 3300048910 Bacteria 2818
222 Ga0496107_0182667 3300048910 Bacteria 1557
223 Ga0496107_0396707 3300048910 Bacteria 1026
224 Ga0496108_0005382 3300048911 Bacteria 10346
225 Ga0496108_0066299 3300048911 Bacteria 3044
226 Ga0496109_0002882 3300048912 Bacteria 14396
227 Ga0496109_0008262 3300048912 Bacteria 8838
228 Ga0496109_0106969 3300048912 Bacteria 2598
229 Ga0496110_0011595 3300048913 Bacteria 7225
230 Ga0496110_0015470 3300048913 Bacteria 6350
231 Ga0496110_0316307 3300048913 Bacteria 1422
232 Ga0496111_0100715 3300048914 Bacteria 2122
233 Ga0496111_0187793 3300048914 Bacteria 1536
234 Ga0496112_0003410 3300048915 Bacteria 13125
235 Ga0496112_0017788 3300048915 Bacteria 6689
236 Ga0496112_0173238 3300048915 Bacteria 2123
237 Ga0496112_0189299 3300048915 Bacteria 2020
238 Ga0496112_0324255 3300048915 Bacteria 1484
239 Ga0496113_0108304 3300048916 Bacteria 2160
240 Ga0496113_0151378 3300048916 Bacteria 1830
241 Ga0496114_0017716 3300048917 Bacteria 5755
242 Ga0496114_0048812 3300048917 Bacteria 3521
243 Ga0496114_0057003 3300048917 Bacteria 3261
244 Ga0496114_0350081 3300048917 Bacteria 1306
245 Ga0496114_0653490 3300048917 Bacteria 925
246 Ga0496114_0795853 3300048917 Bacteria 824
247 Ga0496115_0001688 3300048918 Bacteria 15856
248 Ga0496115_0030878 3300048918 Bacteria 4218
249 Ga0496115_0041616 3300048918 Bacteria 3657
250 Ga0501031_0217234 3300049568 Bacteria 1245
251 Ga0501033_0257064 3300049570 Bacteria 1237
252 Ga0501036_0024964 3300049572 Bacteria 5041
253 Ga0501036_0034618 3300049572 Bacteria 4273
254 Ga0501036_0313666 3300049572 Bacteria 1311
255 Ga0501038_0170030 3300049574 Bacteria 1765
256 Ga0501039_0312914 3300049575 Bacteria 1234
257 Ga0501040_0084914 3300049576 Bacteria 2197
258 Ga0501040_0123647 3300049576 Bacteria 1816
259 Ga0501040_0481010 3300049576 Bacteria 895
260 Ga0501042_0021768 3300049578 Bacteria 4471
261 Ga0501042_0112171 3300049578 Bacteria 1963
262 Ga0501042_0642337 3300049578 Bacteria 771
263 Ga0501046_0420258 3300049580 Bacteria 964
264 Ga0501048_0494220 3300049582 Bacteria 877
265 Ga0501069_0148544 3300049585 Bacteria 1346
266 Ga0501071_0042327 3300049587 Bacteria 3263
267 Ga0501071_0220037 3300049587 Bacteria 1429
268 Ga0501072_0183661 3300049588 Bacteria 1668
269 Ga0501072_0377174 3300049588 Bacteria 1125
270 Ga0501072_0431226 3300049588 Bacteria 1044
271 Ga0501074_0206052 3300049590 Bacteria 1401
272 Ga0501074_0221170 3300049590 Bacteria 1348
273 Ga0501074_0271790 3300049590 Bacteria 1205
274 Ga0501075_0048438 3300049591 Bacteria 3193
275 Ga0501075_0080750 3300049591 Bacteria 2462
276 Ga0501076_0048157 3300049592 Bacteria 3370
277 Ga0501076_0325471 3300049592 Bacteria 1261
278 Ga0501076_0543944 3300049592 Bacteria 957
279 Ga0501076_0639142 3300049592 Bacteria 878
280 Ga0501077_0023366 3300049593 Bacteria 3920
281 Ga0501077_0024831 3300049593 Bacteria 3805
282 Ga0501077_0094777 3300049593 Bacteria 1892
283 Ga0501079_0047066 3300049741 Bacteria 3328
284 Ga0501079_0075793 3300049741 Bacteria 2601
285 Ga0501079_0422429 3300049741 Bacteria 1046
286 Ga0501080_0112682 3300049742 Bacteria 2522
287 Ga0501080_0260812 3300049742 Bacteria 1579
288 Ga0501081_0055219 3300049743 Bacteria 2744
289 Ga0501081_0075629 3300049743 Bacteria 2351
290 Ga0501081_0084456 3300049743 Bacteria 2227
291 Ga0501081_0096775 3300049743 Bacteria 2082
292 Ga0501081_0713503 3300049743 Bacteria 753
293 Ga0501083_0167881 3300049744 Bacteria 1435
294 Ga0501035_0521232 3300049822 Bacteria 976
295 Ga0501045_0039551 3300049824 Bacteria 3432
296 nmdc:mga08y16_320990_c1 3300050511 Bacteria 1594
297 nmdc:mga0n895_29391_c1 3300050512 Bacteria 5241
298 nmdc:mga0a205_219555_c1 3300050515 Bacteria 1787
299 Ga0495655_0000866 3300053083 Bacteria 4721
300 Ga0495595_0344749 3300053084 Bacteria 751
301 Ga0495619_0009137 3300053085 Bacteria 6257
302 Ga0501084_0012813 3300054114 Bacteria 6947
303 Ga0501084_0016363 3300054114 Bacteria 6159
304 Ga0501084_0075858 3300054114 Bacteria 2817
305 Ga0501084_0153453 3300054114 Bacteria 1942
306 Ga0501084_0523358 3300054114 Bacteria 1002
307 Ga0501082_0302671 3300060353 Bacteria 1392
308 Ga0501082_0374683 3300060353 Bacteria 1242
309 Ga0501082_0941738 3300060353 Bacteria 755
310 Ga0530510_0199335 3300061734 Bacteria 1486
311 Ga0207660_10022458
312 JGI25406J46586_10019567
313 Ga0070658_10076998
314 Ga0070658_10157762
315 Ga0070683_100179970
316 Ga0070683_100431652
317 Ga0070683_100888132
318 Ga0070680_100057495
319 Ga0070680_100136389
320 Ga0070680_100354861
321 Ga0070682_100149008
322 Ga0068868_100477979
323 Ga0070660_100029220
324 Ga0070660_100054510
325 Ga0070660_100514051
326 Ga0070714_100154897
327 Ga0070713_100114224
328 Ga0070710_10084213
329 Ga0070711_100085612
330 Ga0070681_10066196
331 Ga0070681_10509557
332 Ga0070679_100010621
333 Ga0070679_100066664
334 Ga0070679_100144490
335 Ga0070684_100061830
336 Ga0070684_100235239
337 Ga0068855_100119369
338 Ga0068855_100179950
339 Ga0068855_100669046
340 Ga0070664_100390841
341 Ga0068857_100030098
342 Ga0068856_100620446
343 Ga0068852_100086065
344 Ga0068851_10240307
345 Ga0081538_10001556
346 Ga0081538_10098030
347 Ga0081539_10003298
348 Ga0070717_10063525
349 Ga0070712_100601993
350 Ga0097621_100500786
351 Ga0075434_100070157
352 Ga0105240_10450163
353 Ga0111539_10734446
354 Ga0111539_10972755
355 Ga0111539_11533828
356 Ga0114129_10519120
357 Ga0105243_10084212
358 Ga0105242_10004056
359 Ga0105242_10907199
360 Ga0105248_10400079
361 Ga0157370_10075406
362 Ga0157369_10004049
363 Ga0157369_10005636
364 Ga0157369_10024357
365 Ga0157369_10085049
366 Ga0157374_10750314
367 Ga0157378_10208146
368 Ga0157372_10087906
369 Ga0157375_10123782
370 Ga0206356_11431211
371 Ga0206354_10038193
372 Ga0206354_10989008
373 Ga0206353_10103595
374 Ga0206353_10198565
375 Ga0206353_12048701
376 Ga0207685_10043237
377 Ga0207705_10082406
378 Ga0207705_10201539
379 Ga0207705_10356732
380 Ga0207705_10439797
381 Ga0207707_10047959
382 Ga0207707_10504340
383 Ga0207660_10315934
384 Ga0207657_10016620
385 Ga0207657_10025597
386 Ga0207652_10021013
387 Ga0207652_10076376
388 Ga0207652_10324053
389 Ga0207646_10240488
390 Ga0207664_10069094
391 Ga0207664_10784619
392 Ga0207644_10113222
393 Ga0207686_10116162
394 Ga0207686_10810945
395 Ga0207711_10276401
396 Ga0207661_10497872
397 Ga0207667_10769376
398 Ga0207677_10731549
399 Ga0207678_10273140
400 Ga0207674_10133376
401 Ga0265326_10060140
402 Ga0265318_10002819
403 Ga0265338_10043633
404 Ga0265320_10028305
405 Ga0307408_100036926
406 Ga0307408_100281175
407 Ga0265314_10138157
408 Ga0307405_10135029
409 Ga0307409_100087660
410 Ga0307411_10293654
411 Ga0307415_100014369
412 Ga0373945_0010565
413 Ga0373957_0216652
414 Ga0373957_0222483
415 Ga0373943_0000090
416 Ga0373935_0716182
417 Ga0373947_0000266
418 Ga0373937_0462975
419 Ga0395899_0238211
420 Ga0395899_0254901
421 Ga0395900_0063347
422 Ga0395900_0136919
423 Ga0395900_0228195
424 Ga0395900_0625573
425 Ga0395898_0004082
426 Ga0395898_0038547
427 Ga0395898_0273081
428 Ga0395898_0372375
429 Ga0395898_0503066
430 Ga0395898_0594656
431 Ga0395905_0238165
432 Ga0395905_0327185
433 Ga0395905_0826160
434 Ga0395901_0006813
435 Ga0395901_0008455
436 Ga0395901_0173055
437 Ga0395901_0255653
438 Ga0395901_0394022
439 Ga0395901_0990890
440 Ga0395901_1073414
441 Ga0436365_1417768
442 Ga0439461_0006766
443 Ga0439452_030500
444 Ga0439454_022048
445 Ga0439446_0035445
446 Ga0466969_0247810
447 Ga0466966_0119206
448 Ga0466961_0150091
449 Ga0466963_0020250
450 Ga0466970_0030046
451 Ga0466967_0101062
452 Ga0466967_0163785
453 Ga0495592_0031165
454 Ga0495603_0284744
455 Ga0495629_0020994
456 Ga0495629_0060003
457 Ga0495629_0117791
458 Ga0495641_0002960
459 Ga0495641_0035510
460 Ga0495641_0045610
461 Ga0495651_0069048
462 Ga0495653_0022612
463 Ga0495582_0000205
464 Ga0495639_0000856
465 Ga0495662_0002316
466 Ga0495594_0022107
467 Ga0495608_0008052
468 Ga0495608_0181254
469 Ga0495618_0075652
470 Ga0495628_0262302
471 Ga0495630_0076765
472 Ga0495630_0136302
473 Ga0495652_0046104
474 Ga0495652_0401669
475 Ga0495665_0002580
476 Ga0495640_0461564
477 Ga0495587_0073617
478 Ga0495645_0107437
479 Ga0495667_0071363
480 Ga0495667_0218122
481 Ga0495667_0250359
482 Ga0495634_0099220
483 Ga0495635_0004657
484 Ga0495657_0006877
485 Ga0495599_0019136
486 Ga0495599_0210834
487 Ga0495623_0090446
488 Ga0495646_0026906
489 Ga0495647_0002488
490 Ga0495658_0001591
491 Ga0495658_0081394
492 Ga0495613_0003799
493 Ga0495613_0110194
494 Ga0495613_0363370
495 Ga0495624_0023864
496 Ga0495600_0071884
497 Ga0495581_0001349
498 Ga0495604_0163395
499 Ga0495674_0024294
500 Ga0495676_0029766
501 Ga0495680_0013317
502 Ga0495680_0059134
503 Ga0495675_0005032
504 Ga0495684_0051776
505 Ga0495684_0592283
506 Ga0495593_0028506
507 Ga0495602_0072673
508 Ga0495614_0015700
509 Ga0496100_0002444
510 Ga0496100_0040928
511 Ga0496100_0247106
512 Ga0496101_0003866
513 Ga0496101_0011267
514 Ga0496101_0014522
515 Ga0496101_0051871
516 Ga0496102_0006241
517 Ga0496102_0025507
518 Ga0496102_0025746
519 Ga0496102_0219336
520 Ga0496103_0081391
521 Ga0496104_0007187
522 Ga0496104_0007748
523 Ga0496105_0000727
524 Ga0496105_0036921
525 Ga0496105_0216035
526 Ga0496106_0006625
527 Ga0496106_0055480
528 Ga0496106_0170488
529 Ga0496106_0332689
530 Ga0496107_0005051
531 Ga0496107_0057236
532 Ga0496107_0182667
533 Ga0496107_0396707
534 Ga0496108_0005382
535 Ga0496108_0066299
536 Ga0496109_0002882
537 Ga0496109_0008262
538 Ga0496109_0106969
539 Ga0496110_0011595
540 Ga0496110_0015470
541 Ga0496110_0316307
542 Ga0496111_0100715
543 Ga0496111_0187793
544 Ga0496112_0003410
545 Ga0496112_0017788
546 Ga0496112_0173238
547 Ga0496112_0189299
548 Ga0496112_0324255
549 Ga0496113_0108304
550 Ga0496113_0151378
551 Ga0496114_0017716
552 Ga0496114_0048812
553 Ga0496114_0057003
554 Ga0496114_0350081
555 Ga0496114_0653490
556 Ga0496114_0795853
557 Ga0496115_0001688
558 Ga0496115_0030878
559 Ga0496115_0041616
560 Ga0501031_0217234
561 Ga0501033_0257064
562 Ga0501036_0024964
563 Ga0501036_0034618
564 Ga0501036_0313666
565 Ga0501038_0170030
566 Ga0501039_0312914
567 Ga0501040_0084914
568 Ga0501040_0123647
569 Ga0501040_0481010
570 Ga0501042_0021768
571 Ga0501042_0112171
572 Ga0501042_0642337
573 Ga0501046_0420258
574 Ga0501048_0494220
575 Ga0501069_0148544
576 Ga0501071_0042327
577 Ga0501071_0220037
578 Ga0501072_0183661
579 Ga0501072_0377174
580 Ga0501072_0431226
581 Ga0501074_0206052
582 Ga0501074_0221170
583 Ga0501074_0271790
584 Ga0501075_0048438
585 Ga0501075_0080750
586 Ga0501076_0048157
587 Ga0501076_0325471
588 Ga0501076_0543944
589 Ga0501076_0639142
590 Ga0501077_0023366
591 Ga0501077_0024831
592 Ga0501077_0094777
593 Ga0501079_0047066
594 Ga0501079_0075793
595 Ga0501079_0422429
596 Ga0501080_0112682
597 Ga0501080_0260812
598 Ga0501081_0055219
599 Ga0501081_0075629
600 Ga0501081_0084456
601 Ga0501081_0096775
602 Ga0501081_0713503
603 Ga0501083_0167881
604 Ga0501035_0521232
605 Ga0501045_0039551
606 nmdc:mga08y16_320990_c1
607 nmdc:mga0n895_29391_c1
608 nmdc:mga0a205_219555_c1
609 Ga0495655_0000866
610 Ga0495595_0344749
611 Ga0495619_0009137
612 Ga0501084_0012813
613 Ga0501084_0016363
614 Ga0501084_0075858
615 Ga0501084_0153453
616 Ga0501084_0523358
617 Ga0501082_0302671
618 Ga0501082_0374683
619 Ga0501082_0941738
620 Ga0530510_0199335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

15

206

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.5699 11 201
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.5326 11 201
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.4859 1 205
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.4805 1 205
8evu-assembly1.cif.gz_E cryo em structure of vibrio cholerae nqr 0.4535 6 205
ID Description Score Start End Superfamily
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5808 6 207 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5676 6 207 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4478 26 203 1.20.1250.20
af_P75870_401_526_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4386 10 170 1.10.1760.20
af_E7FB53_277_463_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4373 7 204 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A0G3BNC7-F1-model_v4 LysE family translocator 0.8775 2 207 GO:0005886
GO:0015171
AF-A0A0N8IAZ5-F1-model_v4 Amino acid transporter 0.8731 4 202 GO:0005886
GO:0015171
AF-A0A418WER0-F1-model_v4 LysE family translocator 0.8724 3 207 GO:0005886
GO:0015171
AF-A0A0G3BNC7-F1-model_v4 LysE family translocator 0.8697 2 207 GO:0005886
GO:0015171
AF-A0A7V9UN16-F1-model_v4 LysE family translocator 0.8681 2 205 GO:0005886
GO:0015171

Map