F400699

General Info

Members Datasets Scaffolds Average Seq Length
310 168 620 327

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10005050|Ga0114129_1000505012
Length 377
Sequence VKSHARLHQDVARKNAAASRGDYEAIALYSRINKSTITNPQSAILTVLFRGQSLGKYKIIAPLGSGGFGTVYLAQDTWIDKKVAIKVPHRQGLDFGELLREPRLLASVSHPNIVAITTAEKQENVFFIVMEYVQGETLENLIAAKGALELNRALDFTCQICNAVDHAHTQGVIHRDLRPANVLVTENDMLKVADFGTSRFLEIAAHGTTVIGSPPYMAPEQFHGKAVFASDIYSLGVTMYQMLTGMLPYDTPAPADLDKLMSGELVTPPKLKNQAIPKAISDIVMRAMAPEIKDRYQRAPDLLNDIMAAIAATQPRRTPQPSAIARPEPAPQRNRDDAQGIQNRLRARETPSARFCWQCRKPLHARADRCPFCGEAQ

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.23
Rhizosphere 96.77
Stem 0
Stem Tuber 0
Unclassified 9.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10005050 3300009147 Bacteria 18571
2 Ga0065712_10012455 3300005290 Bacteria 1882
3 Ga0070683_100004994 3300005329 Bacteria 11013
4 Ga0070683_100030096 3300005329 Bacteria 4923
5 Ga0070683_100154905 3300005329 Bacteria 2173
6 Ga0070670_100010564 3300005331 Bacteria 7883
7 Ga0070677_10013122 3300005333 Bacteria 2891
8 Ga0070677_10037692 3300005333 Bacteria 1887
9 Ga0068869_100015927 3300005334 Bacteria 5058
10 Ga0068868_100072445 3300005338 Bacteria 2749
11 Ga0070689_100050447 3300005340 Bacteria 3215
12 Ga0070661_100059233 3300005344 Unclassified 2807
13 Ga0070661_100184679 3300005344 Bacteria 1588
14 Ga0070692_10097836 3300005345 Bacteria 1604
15 Ga0070668_100092097 3300005347 Bacteria 2390
16 Ga0070669_100009166 3300005353 Bacteria 7052
17 Ga0070669_100018008 3300005353 Bacteria 5047
18 Ga0070669_100095971 3300005353 Bacteria 2230
19 Ga0070675_100001343 3300005354 Bacteria 18014
20 Ga0070675_100105374 3300005354 Bacteria 2379
21 Ga0070671_100078207 3300005355 Unclassified 2765
22 Ga0070674_100051159 3300005356 Bacteria 2846
23 Ga0070674_100072851 3300005356 Bacteria 2434
24 Ga0070674_100137441 3300005356 Bacteria 1830
25 Ga0070673_100115367 3300005364 Bacteria 2233
26 Ga0070688_100196898 3300005365 Bacteria 1407
27 Ga0070700_100007222 3300005441 Bacteria 5985
28 Ga0070694_100005411 3300005444 Bacteria 7727
29 Ga0070678_100058593 3300005456 Bacteria 2827
30 Ga0070662_100034470 3300005457 Unclassified 3570
31 Ga0070662_100191946 3300005457 Bacteria 1616
32 Ga0070681_10030357 3300005458 Bacteria 5424
33 Ga0068867_100013222 3300005459 Bacteria 5847
34 Ga0068867_100058036 3300005459 Bacteria 2868
35 Ga0070707_100054553 3300005468 Bacteria 3832
36 Ga0070707_100214457 3300005468 Bacteria 1876
37 Ga0070699_100002361 3300005518 Bacteria 16930
38 Ga0070679_100053572 3300005530 Bacteria 4016
39 Ga0070684_100108988 3300005535 Bacteria 2481
40 Ga0070672_100011975 3300005543 Bacteria 6066
41 Ga0070672_100063113 3300005543 Bacteria 2925
42 Ga0070672_100164531 3300005543 Bacteria 1842
43 Ga0070672_100257876 3300005543 Bacteria 1470
44 Ga0070695_100003611 3300005545 Bacteria 9029
45 Ga0070693_100026923 3300005547 Bacteria 3109
46 Ga0070665_100003650 3300005548 Bacteria 16301
47 Ga0068855_100127812 3300005563 Unclassified 2905
48 Ga0070664_100097519 3300005564 Bacteria 2552
49 Ga0068864_100062404 3300005618 Bacteria 3229
50 Ga0068858_100062243 3300005842 Bacteria 3450
51 Ga0068862_100127088 3300005844 Bacteria 2252
52 Ga0081455_10166614 3300005937 Bacteria 1683
53 Ga0070712_100099141 3300006175 Bacteria 2150
54 Ga0097621_100005134 3300006237 Bacteria 9198
55 Ga0097621_100100728 3300006237 Bacteria 2430
56 Ga0068871_100001278 3300006358 Bacteria 16815
57 Ga0068871_100003518 3300006358 Bacteria 10778
58 Ga0068871_100087517 3300006358 Unclassified 2590
59 Ga0075428_100000719 3300006844 Bacteria 34288
60 Ga0075428_100068172 3300006844 Bacteria 3892
61 Ga0075428_100108297 3300006844 Unclassified 3028
62 Ga0075428_100188150 3300006844 Bacteria 2233
63 Ga0075430_100000710 3300006846 Bacteria 25418
64 Ga0075430_100088457 3300006846 Unclassified 2592
65 Ga0075431_100016022 3300006847 Bacteria 7607
66 Ga0075431_100019155 3300006847 Bacteria 6974
67 Ga0075431_100046163 3300006847 Bacteria 4491
68 Ga0075431_100476043 3300006847 Bacteria 1242
69 Ga0075433_10015056 3300006852 Bacteria 6332
70 Ga0075433_10046504 3300006852 Bacteria 3775
71 Ga0075433_10079438 3300006852 Bacteria 2890
72 Ga0075433_10212799 3300006852 Archaea 1717
73 Ga0075434_100027370 3300006871 Bacteria 5597
74 Ga0075429_100042813 3300006880 Bacteria 3940
75 Ga0075429_100141359 3300006880 Bacteria 2107
76 Ga0075429_100332050 3300006880 Bacteria 1331
77 Ga0068865_100009577 3300006881 Bacteria 6013
78 Ga0068865_100063662 3300006881 Bacteria 2593
79 Ga0075436_100025075 3300006914 Bacteria 4100
80 Ga0075436_100098734 3300006914 Bacteria 2032
81 Ga0075435_100006626 3300007076 Bacteria 8204
82 Ga0075435_100070264 3300007076 Unclassified 2858
83 Ga0105240_10197143 3300009093 Unclassified 2363
84 Ga0105240_10368738 3300009093 Bacteria 1624
85 Ga0105240_10421397 3300009093 Bacteria 1500
86 Ga0111539_10000629 3300009094 Bacteria 45516
87 Ga0111539_10026364 3300009094 Bacteria 7107
88 Ga0111539_10308610 3300009094 Bacteria 1841
89 Ga0105245_10005017 3300009098 Bacteria 11637
90 Ga0105245_10320487 3300009098 Bacteria 1527
91 Ga0114129_10000086 3300009147 Bacteria 86772
92 Ga0114129_10001643 3300009147 Bacteria 30371
93 Ga0114129_10005815 3300009147 Bacteria 17467
94 Ga0114129_10009110 3300009147 Bacteria 14147
95 Ga0114129_10009213 3300009147 Bacteria 14077
96 Ga0114129_10010695 3300009147 Bacteria 13087
97 Ga0114129_10033496 3300009147 Bacteria 7261
98 Ga0114129_10063812 3300009147 Bacteria 5141
99 Ga0114129_10157541 3300009147 Bacteria 3104
100 Ga0114129_10221391 3300009147 Bacteria 2553
101 Ga0114129_10261306 3300009147 Unclassified 2320
102 Ga0114129_10290786 3300009147 Bacteria 2181
103 Ga0114129_10620197 3300009147 Bacteria 1399
104 Ga0114129_10711075 3300009147 Bacteria 1290
105 Ga0105243_10065908 3300009148 Bacteria 2911
106 Ga0105242_10019726 3300009176 Bacteria 5284
107 Ga0105242_10175564 3300009176 Bacteria 1886
108 Ga0105248_10020513 3300009177 Bacteria 7323
109 Ga0105248_10036129 3300009177 Bacteria 5526
110 Ga0105238_10435922 3300009551 Bacteria 1306
111 Ga0105249_10016775 3300009553 Bacteria 6499
112 Ga0105239_10372006 3300010375 Unclassified 1615
113 Ga0105246_10090134 3300011119 Bacteria 2208
114 Ga0105246_10215184 3300011119 Bacteria 1502
115 Ga0157370_10332601 3300013104 Unclassified 1400
116 Ga0157374_10004332 3300013296 Bacteria 11941
117 Ga0157374_10425170 3300013296 Bacteria 1327
118 Ga0157372_10133109 3300013307 Unclassified 2862
119 Ga0157375_10122261 3300013308 Unclassified 2714
120 Ga0157375_10178772 3300013308 Bacteria 2273
121 Ga0163163_10009842 3300014325 Bacteria 8567
122 Ga0163163_10104432 3300014325 Bacteria 2859
123 Ga0163163_10168528 3300014325 Bacteria 2236
124 Ga0163163_10436384 3300014325 Bacteria 1369
125 Ga0157380_10018169 3300014326 Bacteria 5217
126 Ga0157380_10126879 3300014326 Bacteria 2170
127 Ga0157377_10051392 3300014745 Bacteria 2324
128 Ga0157379_10029584 3300014968 Bacteria 4870
129 Ga0157376_10052480 3300014969 Bacteria 3391
130 Ga0163161_10251586 3300017792 Bacteria 1377
131 Ga0207697_10003241 3300025315 Bacteria 8092
132 Ga0207688_10007123 3300025901 Bacteria 6081
133 Ga0207645_10017359 3300025907 Bacteria 4751
134 Ga0207695_10078801 3300025913 Bacteria 3342
135 Ga0207695_10152811 3300025913 Unclassified 2246
136 Ga0207695_10331622 3300025913 Bacteria 1410
137 Ga0207693_10036658 3300025915 Bacteria 3866
138 Ga0207649_10216150 3300025920 Bacteria 1363
139 Ga0207646_10008835 3300025922 Bacteria 10043
140 Ga0207646_10051510 3300025922 Bacteria 3683
141 Ga0207681_10010924 3300025923 Bacteria 5578
142 Ga0207681_10022880 3300025923 Bacteria 3990
143 Ga0207681_10074403 3300025923 Bacteria 2379
144 Ga0207650_10002354 3300025925 Bacteria 13134
145 Ga0207650_10060081 3300025925 Unclassified 2836
146 Ga0207650_10235271 3300025925 Bacteria 1479
147 Ga0207659_10149726 3300025926 Bacteria 1821
148 Ga0207687_10004936 3300025927 Bacteria 8854
149 Ga0207644_10134899 3300025931 Unclassified 1894
150 Ga0207706_10045988 3300025933 Bacteria 3865
151 Ga0207686_10070885 3300025934 Bacteria 2241
152 Ga0207709_10004299 3300025935 Bacteria 8253
153 Ga0207709_10082834 3300025935 Bacteria 2073
154 Ga0207670_10043467 3300025936 Bacteria 2967
155 Ga0207669_10007720 3300025937 Bacteria 5005
156 Ga0207669_10261531 3300025937 Bacteria 1294
157 Ga0207691_10026222 3300025940 Bacteria 5469
158 Ga0207691_10031912 3300025940 Bacteria 4916
159 Ga0207691_10045515 3300025940 Bacteria 4033
160 Ga0207691_10061775 3300025940 Bacteria 3403
161 Ga0207711_10176071 3300025941 Bacteria 1943
162 Ga0207711_10177520 3300025941 Bacteria 1935
163 Ga0207689_10024643 3300025942 Bacteria 5046
164 Ga0207661_10076979 3300025944 Bacteria 2742
165 Ga0207679_10049168 3300025945 Bacteria 3075
166 Ga0207679_10063353 3300025945 Bacteria 2759
167 Ga0207679_10074682 3300025945 Bacteria 2569
168 Ga0207651_10021741 3300025960 Bacteria 3906
169 Ga0207651_10040618 3300025960 Bacteria 3080
170 Ga0207712_10074601 3300025961 Bacteria 2450
171 Ga0207658_10352002 3300025986 Bacteria 1283
172 Ga0207677_10071856 3300026023 Bacteria 2444
173 Ga0207703_10043867 3300026035 Bacteria 3591
174 Ga0207708_10015231 3300026075 Bacteria 5765
175 Ga0207708_10196961 3300026075 Bacteria 1606
176 Ga0207648_10000066 3300026089 Bacteria 98414
177 Ga0207648_10074096 3300026089 Bacteria 2967
178 Ga0207648_10116437 3300026089 Bacteria 2349
179 Ga0207648_10316382 3300026089 Unclassified 1402
180 Ga0207676_10018398 3300026095 Bacteria 5078
181 Ga0207428_10001491 3300027907 Bacteria 24459
182 Ga0268266_10007289 3300028379 Bacteria 10000
183 Ga0268265_10045412 3300028380 Unclassified 3278
184 Ga0268265_10120992 3300028380 Bacteria 2156
185 Ga0268264_10414436 3300028381 Bacteria 1298
186 Ga0307408_100023858 3300031548 Bacteria 4170
187 Ga0265314_10019952 3300031711 Bacteria 5183
188 Ga0307405_10117262 3300031731 Bacteria 1815
189 Ga0307406_10163350 3300031901 Bacteria 1604
190 Ga0307406_10164343 3300031901 Bacteria 1599
191 Ga0307412_10051191 3300031911 Bacteria 2728
192 Ga0307412_10155961 3300031911 Bacteria 1690
193 Ga0307409_100016238 3300031995 Bacteria 4919
194 Ga0307409_100045700 3300031995 Bacteria 3308
195 Ga0307416_100013603 3300032002 Bacteria 5539
196 Ga0307416_100013935 3300032002 Bacteria 5484
197 Ga0307416_100143674 3300032002 Bacteria 2174
198 Ga0307416_100146342 3300032002 Bacteria 2158
199 Ga0307414_10162218 3300032004 Bacteria 1777
200 Ga0307411_10029307 3300032005 Bacteria 3359
201 Ga0307411_10062009 3300032005 Bacteria 2492
202 Ga0307411_10094726 3300032005 Bacteria 2094
203 Ga0373937_0206143 3300036401 Bacteria 1849
204 Ga0373937_0335621 3300036401 Bacteria 1431
205 Ga0439435_0014113 3300042436 Bacteria 1969
206 Ga0466963_0051266 3300044694 Bacteria 2735
207 Ga0451576_0428504 3300045051 Bacteria 1388
208 Ga0466967_0238483 3300045976 Bacteria 1734
209 Ga0495582_0197078 3300046473 Bacteria 1150
210 Ga0495598_0008889 3300046537 Bacteria 2353
211 Ga0495645_0007571 3300046543 Bacteria 7555
212 Ga0495635_0128899 3300046663 Bacteria 1725
213 Ga0495613_0175724 3300046689 Bacteria 1518
214 Ga0495670_0059967 3300046691 Bacteria 1911
215 Ga0495600_0105436 3300046809 Bacteria 1837
216 Ga0495674_0126208 3300047319 Bacteria 2159
217 Ga0496105_0104948 3300048908 Unclassified 2333
218 Ga0496106_0172825 3300048909 Bacteria 1713
219 Ga0496107_0223804 3300048910 Bacteria 1400
220 Ga0496110_0001365 3300048913 Bacteria 17597
221 Ga0496110_0042900 3300048913 Bacteria 3948
222 Ga0496110_0350261 3300048913 Bacteria 1345
223 Ga0496112_0104566 3300048915 Unclassified 2801
224 Ga0496112_0112827 3300048915 Bacteria 2689
225 Ga0496114_0092767 3300048917 Bacteria 2566
226 Ga0496115_0085933 3300048918 Bacteria 2566
227 Ga0501031_0029970 3300049568 Bacteria 3549
228 Ga0501033_0035273 3300049570 Unclassified 3751
229 Ga0501036_0019182 3300049572 Bacteria 5738
230 Ga0501036_0111408 3300049572 Bacteria 2313
231 Ga0501038_0115943 3300049574 Unclassified 2214
232 Ga0501038_0122767 3300049574 Bacteria 2140
233 Ga0501039_0030738 3300049575 Bacteria 4141
234 Ga0501039_0068676 3300049575 Bacteria 2751
235 Ga0501039_0115808 3300049575 Bacteria 2098
236 Ga0501040_0002616 3300049576 Bacteria 11600
237 Ga0501040_0020097 3300049576 Bacteria 4449
238 Ga0501041_0133268 3300049577 Unclassified 1548
239 Ga0501043_0032412 3300049579 Unclassified 4109
240 Ga0501046_0002001 3300049580 Bacteria 19343
241 Ga0501067_0192954 3300049583 Bacteria 1135
242 Ga0501071_0074589 3300049587 Bacteria 2476
243 Ga0501071_0138433 3300049587 Bacteria 1812
244 Ga0501071_0155915 3300049587 Bacteria 1705
245 Ga0501071_0199346 3300049587 Bacteria 1503
246 Ga0501072_0009690 3300049588 Bacteria 7326
247 Ga0501072_0010961 3300049588 Bacteria 6913
248 Ga0501072_0048366 3300049588 Bacteria 3349
249 Ga0501072_0351435 3300049588 Bacteria 1170
250 Ga0501073_0073656 3300049589 Bacteria 2378
251 Ga0501075_0001650 3300049591 Bacteria 14662
252 Ga0501075_0021038 3300049591 Bacteria 4753
253 Ga0501075_0027887 3300049591 Unclassified 4164
254 Ga0501076_0002811 3300049592 Bacteria 12034
255 Ga0501076_0091183 3300049592 Unclassified 2451
256 Ga0501076_0122752 3300049592 Bacteria 2104
257 Ga0501076_0127673 3300049592 Bacteria 2061
258 Ga0501076_0159674 3300049592 Bacteria 1836
259 Ga0501225_0062684 3300049705 Bacteria 1048
260 Ga0501079_0002101 3300049741 Bacteria 14303
261 Ga0501080_0046578 3300049742 Bacteria 4037
262 Ga0501081_0000743 3300049743 Bacteria 19045
263 Ga0501081_0034377 3300049743 Bacteria 3449
264 Ga0501035_0069858 3300049822 Bacteria 3112
265 Ga0501035_0193671 3300049822 Bacteria 1747
266 Ga0501045_0083968 3300049824 Bacteria 2349
267 nmdc:mga05p37_1753_c1 3300050507 Bacteria 25299
268 nmdc:mga05p37_22480_c1 3300050507 Bacteria 7647
269 nmdc:mga05p37_257816_c1 3300050507 Bacteria 2089
270 nmdc:mga05p37_39228_c1 3300050507 Bacteria 5275
271 nmdc:mga05p37_4912_c1 3300050507 Bacteria 15656
272 nmdc:mga05p37_49424_c1 3300050507 Bacteria 5172
273 nmdc:mga05p37_728_c2 3300050507 Bacteria 34720
274 nmdc:mga05p37_7522_c1 3300050507 Bacteria 12843
275 nmdc:mga09592_5560_c1 3300050508 Bacteria 10260
276 nmdc:mga0qj67_10041_c1 3300050509 Bacteria 7063
277 nmdc:mga0qj67_12114_c1 3300050509 Bacteria 6486
278 nmdc:mga0qj67_122289_c1 3300050509 Bacteria 2106
279 nmdc:mga0qj67_56366_c1 3300050509 Bacteria 3115
280 nmdc:mga06r32_171891_c1 3300050510 Bacteria 2151
281 nmdc:mga06r32_207571_c1 3300050510 Bacteria 1947
282 nmdc:mga06r32_33239_c1 3300050510 Bacteria 4858
283 nmdc:mga06r32_464281_c1 3300050510 Bacteria 1245
284 nmdc:mga06r32_7370_c1 3300050510 Bacteria 9899
285 nmdc:mga06r32_80749_c1 3300050510 Unclassified 2148
286 nmdc:mga08y16_2993_c1 3300050511 Bacteria 17427
287 nmdc:mga08y16_305324_c1 3300050511 Bacteria 1640
288 nmdc:mga08y16_40920_c1 3300050511 Bacteria 4855
289 nmdc:mga08y16_43857_c1 3300050511 Bacteria 4687
290 nmdc:mga0n895_161065_c1 3300050512 Bacteria 2275
291 nmdc:mga0n895_218925_c1 3300050512 Bacteria 1933
292 nmdc:mga0rr50_175878_c1 3300050513 Bacteria 1747
293 nmdc:mga08x19_31786_c1 3300050514 Bacteria 3324
294 nmdc:mga0a205_130467_c1 3300050515 Bacteria 2414
295 nmdc:mga0a205_35932_c1 3300050515 Bacteria 4759
296 nmdc:mga0a205_47626_c1 3300050515 Bacteria 4137
297 nmdc:mga0a205_49305_c1 3300050515 Bacteria 4064
298 nmdc:mga0a205_5457_c2 3300050515 Bacteria 9974
299 nmdc:mga0a205_57628_c1 3300050515 Bacteria 3751
300 Ga0495601_0069815 3300053077 Bacteria 2241
301 Ga0501084_0001070 3300054114 Bacteria 21297
302 Ga0501084_0055224 3300054114 Bacteria 3323
303 Ga0501084_0124591 3300054114 Unclassified 2168
304 Ga0501084_0340974 3300054114 Bacteria 1266
305 Ga0590075_013185 3300059424 Bacteria 2011
306 Ga0590077_005227 3300059426 Bacteria 2659
307 Ga0590077_014714 3300059426 Bacteria 1631
308 Ga0501082_0380282 3300060353 Bacteria 1232
309 Ga0530510_0004954 3300061734 Bacteria 9196
310 Ga0530510_0023763 3300061734 Bacteria 4369
311 Ga0114129_10005050
312 Ga0065712_10012455
313 Ga0070683_100004994
314 Ga0070683_100030096
315 Ga0070683_100154905
316 Ga0070670_100010564
317 Ga0070677_10013122
318 Ga0070677_10037692
319 Ga0068869_100015927
320 Ga0068868_100072445
321 Ga0070689_100050447
322 Ga0070661_100059233
323 Ga0070661_100184679
324 Ga0070692_10097836
325 Ga0070668_100092097
326 Ga0070669_100009166
327 Ga0070669_100018008
328 Ga0070669_100095971
329 Ga0070675_100001343
330 Ga0070675_100105374
331 Ga0070671_100078207
332 Ga0070674_100051159
333 Ga0070674_100072851
334 Ga0070674_100137441
335 Ga0070673_100115367
336 Ga0070688_100196898
337 Ga0070700_100007222
338 Ga0070694_100005411
339 Ga0070678_100058593
340 Ga0070662_100034470
341 Ga0070662_100191946
342 Ga0070681_10030357
343 Ga0068867_100013222
344 Ga0068867_100058036
345 Ga0070707_100054553
346 Ga0070707_100214457
347 Ga0070699_100002361
348 Ga0070679_100053572
349 Ga0070684_100108988
350 Ga0070672_100011975
351 Ga0070672_100063113
352 Ga0070672_100164531
353 Ga0070672_100257876
354 Ga0070695_100003611
355 Ga0070693_100026923
356 Ga0070665_100003650
357 Ga0068855_100127812
358 Ga0070664_100097519
359 Ga0068864_100062404
360 Ga0068858_100062243
361 Ga0068862_100127088
362 Ga0081455_10166614
363 Ga0070712_100099141
364 Ga0097621_100005134
365 Ga0097621_100100728
366 Ga0068871_100001278
367 Ga0068871_100003518
368 Ga0068871_100087517
369 Ga0075428_100000719
370 Ga0075428_100068172
371 Ga0075428_100108297
372 Ga0075428_100188150
373 Ga0075430_100000710
374 Ga0075430_100088457
375 Ga0075431_100016022
376 Ga0075431_100019155
377 Ga0075431_100046163
378 Ga0075431_100476043
379 Ga0075433_10015056
380 Ga0075433_10046504
381 Ga0075433_10079438
382 Ga0075433_10212799
383 Ga0075434_100027370
384 Ga0075429_100042813
385 Ga0075429_100141359
386 Ga0075429_100332050
387 Ga0068865_100009577
388 Ga0068865_100063662
389 Ga0075436_100025075
390 Ga0075436_100098734
391 Ga0075435_100006626
392 Ga0075435_100070264
393 Ga0105240_10197143
394 Ga0105240_10368738
395 Ga0105240_10421397
396 Ga0111539_10000629
397 Ga0111539_10026364
398 Ga0111539_10308610
399 Ga0105245_10005017
400 Ga0105245_10320487
401 Ga0114129_10000086
402 Ga0114129_10001643
403 Ga0114129_10005815
404 Ga0114129_10009110
405 Ga0114129_10009213
406 Ga0114129_10010695
407 Ga0114129_10033496
408 Ga0114129_10063812
409 Ga0114129_10157541
410 Ga0114129_10221391
411 Ga0114129_10261306
412 Ga0114129_10290786
413 Ga0114129_10620197
414 Ga0114129_10711075
415 Ga0105243_10065908
416 Ga0105242_10019726
417 Ga0105242_10175564
418 Ga0105248_10020513
419 Ga0105248_10036129
420 Ga0105238_10435922
421 Ga0105249_10016775
422 Ga0105239_10372006
423 Ga0105246_10090134
424 Ga0105246_10215184
425 Ga0157370_10332601
426 Ga0157374_10004332
427 Ga0157374_10425170
428 Ga0157372_10133109
429 Ga0157375_10122261
430 Ga0157375_10178772
431 Ga0163163_10009842
432 Ga0163163_10104432
433 Ga0163163_10168528
434 Ga0163163_10436384
435 Ga0157380_10018169
436 Ga0157380_10126879
437 Ga0157377_10051392
438 Ga0157379_10029584
439 Ga0157376_10052480
440 Ga0163161_10251586
441 Ga0207697_10003241
442 Ga0207688_10007123
443 Ga0207645_10017359
444 Ga0207695_10078801
445 Ga0207695_10152811
446 Ga0207695_10331622
447 Ga0207693_10036658
448 Ga0207649_10216150
449 Ga0207646_10008835
450 Ga0207646_10051510
451 Ga0207681_10010924
452 Ga0207681_10022880
453 Ga0207681_10074403
454 Ga0207650_10002354
455 Ga0207650_10060081
456 Ga0207650_10235271
457 Ga0207659_10149726
458 Ga0207687_10004936
459 Ga0207644_10134899
460 Ga0207706_10045988
461 Ga0207686_10070885
462 Ga0207709_10004299
463 Ga0207709_10082834
464 Ga0207670_10043467
465 Ga0207669_10007720
466 Ga0207669_10261531
467 Ga0207691_10026222
468 Ga0207691_10031912
469 Ga0207691_10045515
470 Ga0207691_10061775
471 Ga0207711_10176071
472 Ga0207711_10177520
473 Ga0207689_10024643
474 Ga0207661_10076979
475 Ga0207679_10049168
476 Ga0207679_10063353
477 Ga0207679_10074682
478 Ga0207651_10021741
479 Ga0207651_10040618
480 Ga0207712_10074601
481 Ga0207658_10352002
482 Ga0207677_10071856
483 Ga0207703_10043867
484 Ga0207708_10015231
485 Ga0207708_10196961
486 Ga0207648_10000066
487 Ga0207648_10074096
488 Ga0207648_10116437
489 Ga0207648_10316382
490 Ga0207676_10018398
491 Ga0207428_10001491
492 Ga0268266_10007289
493 Ga0268265_10045412
494 Ga0268265_10120992
495 Ga0268264_10414436
496 Ga0307408_100023858
497 Ga0265314_10019952
498 Ga0307405_10117262
499 Ga0307406_10163350
500 Ga0307406_10164343
501 Ga0307412_10051191
502 Ga0307412_10155961
503 Ga0307409_100016238
504 Ga0307409_100045700
505 Ga0307416_100013603
506 Ga0307416_100013935
507 Ga0307416_100143674
508 Ga0307416_100146342
509 Ga0307414_10162218
510 Ga0307411_10029307
511 Ga0307411_10062009
512 Ga0307411_10094726
513 Ga0373937_0206143
514 Ga0373937_0335621
515 Ga0439435_0014113
516 Ga0466963_0051266
517 Ga0451576_0428504
518 Ga0466967_0238483
519 Ga0495582_0197078
520 Ga0495598_0008889
521 Ga0495645_0007571
522 Ga0495635_0128899
523 Ga0495613_0175724
524 Ga0495670_0059967
525 Ga0495600_0105436
526 Ga0495674_0126208
527 Ga0496105_0104948
528 Ga0496106_0172825
529 Ga0496107_0223804
530 Ga0496110_0001365
531 Ga0496110_0042900
532 Ga0496110_0350261
533 Ga0496112_0104566
534 Ga0496112_0112827
535 Ga0496114_0092767
536 Ga0496115_0085933
537 Ga0501031_0029970
538 Ga0501033_0035273
539 Ga0501036_0019182
540 Ga0501036_0111408
541 Ga0501038_0115943
542 Ga0501038_0122767
543 Ga0501039_0030738
544 Ga0501039_0068676
545 Ga0501039_0115808
546 Ga0501040_0002616
547 Ga0501040_0020097
548 Ga0501041_0133268
549 Ga0501043_0032412
550 Ga0501046_0002001
551 Ga0501067_0192954
552 Ga0501071_0074589
553 Ga0501071_0138433
554 Ga0501071_0155915
555 Ga0501071_0199346
556 Ga0501072_0009690
557 Ga0501072_0010961
558 Ga0501072_0048366
559 Ga0501072_0351435
560 Ga0501073_0073656
561 Ga0501075_0001650
562 Ga0501075_0021038
563 Ga0501075_0027887
564 Ga0501076_0002811
565 Ga0501076_0091183
566 Ga0501076_0122752
567 Ga0501076_0127673
568 Ga0501076_0159674
569 Ga0501225_0062684
570 Ga0501079_0002101
571 Ga0501080_0046578
572 Ga0501081_0000743
573 Ga0501081_0034377
574 Ga0501035_0069858
575 Ga0501035_0193671
576 Ga0501045_0083968
577 nmdc:mga05p37_1753_c1
578 nmdc:mga05p37_22480_c1
579 nmdc:mga05p37_257816_c1
580 nmdc:mga05p37_39228_c1
581 nmdc:mga05p37_4912_c1
582 nmdc:mga05p37_49424_c1
583 nmdc:mga05p37_728_c2
584 nmdc:mga05p37_7522_c1
585 nmdc:mga09592_5560_c1
586 nmdc:mga0qj67_10041_c1
587 nmdc:mga0qj67_12114_c1
588 nmdc:mga0qj67_122289_c1
589 nmdc:mga0qj67_56366_c1
590 nmdc:mga06r32_171891_c1
591 nmdc:mga06r32_207571_c1
592 nmdc:mga06r32_33239_c1
593 nmdc:mga06r32_464281_c1
594 nmdc:mga06r32_7370_c1
595 nmdc:mga06r32_80749_c1
596 nmdc:mga08y16_2993_c1
597 nmdc:mga08y16_305324_c1
598 nmdc:mga08y16_40920_c1
599 nmdc:mga08y16_43857_c1
600 nmdc:mga0n895_161065_c1
601 nmdc:mga0n895_218925_c1
602 nmdc:mga0rr50_175878_c1
603 nmdc:mga08x19_31786_c1
604 nmdc:mga0a205_130467_c1
605 nmdc:mga0a205_35932_c1
606 nmdc:mga0a205_47626_c1
607 nmdc:mga0a205_49305_c1
608 nmdc:mga0a205_5457_c2
609 nmdc:mga0a205_57628_c1
610 Ga0495601_0069815
611 Ga0501084_0001070
612 Ga0501084_0055224
613 Ga0501084_0124591
614 Ga0501084_0340974
615 Ga0590075_013185
616 Ga0590077_005227
617 Ga0590077_014714
618 Ga0501082_0380282
619 Ga0530510_0004954
620 Ga0530510_0023763

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07714

PK_Tyr_Ser-Thr

Protein tyrosine and serine/threonine kinase

57

305

0.87

PF00069

Pkinase

Protein kinase domain

57

311

0.85

PF03109

ABC1

ABC1 atypical kinase-like domain

102

209

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xzv-assembly2.cif.gz_B crystal structure of rad53 1-466 in complex with amp-pnp 0.8701 10 259
5xzw-assembly3.cif.gz_B crystal structure of rad53 1-466 0.8698 10 257
4ow8-assembly1.cif.gz_A-2 crystal structure of kinase domain of pkna from mtb 0.8664 2 264
2h34-assembly2.cif.gz_B apoenzyme crystal structure of the tuberculosis serine/threonine kinase, pkne 0.8659 9 265
5tx3-assembly2.cif.gz_B structure of maternal embryonic leucine zipper kinase 0.8635 25 251
ID Description Score Start End Superfamily
af_Q03785_3_79_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9167 2 44 3.30.200.20
2fumD02 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9022 88 263 1.10.510.10
2fumD02 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8918 88 263 1.10.510.10
4eqmD02 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8762 88 267 1.10.510.10
af_P9WI63_100_284_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8625 88 263 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A524HSM1-F1-model_v4 Serine/threonine protein kinase 0.8831 10 267 GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0005524
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0140823
GO:0140855
GO:0140857
GO:1990244
AF-A0A2G6PXA9-F1-model_v4 Protein kinase domain-containing protein 0.8813 2 264 GO:0000407
GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0005524
GO:0005776
GO:0005829
GO:0010506
GO:0016020
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0140823
GO:0140855
GO:0140857
GO:1990244
AF-A0A8B0E4X8-F1-model_v4 deleted 0.8759 3 267
AF-A0A535FTF1-F1-model_v4 Protein kinase domain-containing protein 0.8738 1 263 GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0005524
GO:0006457
GO:0016787
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0051082
GO:0072354
GO:0072371
GO:0072518
GO:0140823
GO:0140855
GO:0140857
GO:1990244
AF-A0A539DG01-F1-model_v4 Serine/threonine protein kinase 0.8733 3 268 GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0005524
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0140823
GO:0140855
GO:0140857
GO:1990244

Map