F400605

General Info

Members Datasets Scaffolds Average Seq Length
310 184 620 456

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100113810|Ga0070698_1001138102
Length 436
Sequence MIRLLAEALAPAHQQYLHQARQMQALSFAAHIPLVAFGISFPVLVLFAEARWLRTGDALYRTIARRWTRIMVALFAVGVITGTILSFEMGLLWPNFTATFGSVFGLGFAIEGFSFFLEAIFIGIYVYGWDRLSPRTHFASGIPIVLTGFTGSLMVISVNAWMNHPGGFTLRDGKVVEVHQWQALFGNTYLWHELIHMYIAGYIAVGRLRGRWGRYERTALAIPLTAAALAAPVQVLVGDWAARDVAHTQPVKLAAIEGLAHTTRGAPEHLLGWYENGRVRFGIEIPHGLSLLAGHSWNAKVQGLDVVPPADRPPVNVVRISFQTMVGIGTLLALLGVVFVXXRXRRRRLPESRWFYRALAAAGPLSVVALIAGWVTTEVGRQPWVVYRVMPTAEAVTGAGGIPVGYAVLALAYVLVAIGVAWVLRRLSRMPLEAPQ

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
124 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
125 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
128 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
129 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 13.87
Rhizosphere 82.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100113810 3300005471 Bacteria 2670
2 Ga0070658_10053238 3300005327 Bacteria 3284
3 Ga0070683_100063056 3300005329 Bacteria 3447
4 Ga0070670_100040739 3300005331 Bacteria 3992
5 Ga0068869_100002128 3300005334 Bacteria 11899
6 Ga0070680_100034076 3300005336 Bacteria 4106
7 Ga0070682_100016013 3300005337 Bacteria 4354
8 Ga0068868_100034374 3300005338 Bacteria 3913
9 Ga0070660_100050581 3300005339 Bacteria 3198
10 Ga0070689_100030704 3300005340 Bacteria 4080
11 Ga0070691_10006106 3300005341 Bacteria 5499
12 Ga0070692_10023054 3300005345 Bacteria 3046
13 Ga0070671_100002386 3300005355 Bacteria 14514
14 Ga0070674_100135290 3300005356 Bacteria 1843
15 Ga0070673_100055240 3300005364 Bacteria 3128
16 Ga0070688_100072570 3300005365 Bacteria 2206
17 Ga0070714_100199187 3300005435 Bacteria 1831
18 Ga0070713_100015622 3300005436 Bacteria 5685
19 Ga0070711_100144319 3300005439 Bacteria 1788
20 Ga0070705_100034400 3300005440 Bacteria 2832
21 Ga0070705_100040120 3300005440 Bacteria 2660
22 Ga0070708_100011259 3300005445 Bacteria 7274
23 Ga0070708_100051057 3300005445 Bacteria 3663
24 Ga0070663_100033507 3300005455 Bacteria 3549
25 Ga0070663_100077783 3300005455 Bacteria 2430
26 Ga0070678_100002228 3300005456 Bacteria 10541
27 Ga0070678_100002833 3300005456 Bacteria 9595
28 Ga0070681_10064533 3300005458 Bacteria 3632
29 Ga0070685_10021950 3300005466 Bacteria 3474
30 Ga0070706_100035734 3300005467 Bacteria 4587
31 Ga0070707_100061449 3300005468 Bacteria 3603
32 Ga0070698_100005687 3300005471 Bacteria 13647
33 Ga0070698_100011998 3300005471 Bacteria 9188
34 Ga0070698_100123407 3300005471 Bacteria 2548
35 Ga0070698_100280525 3300005471 Bacteria 1597
36 Ga0070679_100049501 3300005530 Bacteria 4185
37 Ga0070684_100042902 3300005535 Bacteria 3906
38 Ga0068853_100047002 3300005539 Bacteria 3703
39 Ga0070686_100007424 3300005544 Bacteria 6116
40 Ga0070695_100024998 3300005545 Bacteria 3684
41 Ga0070693_100001038 3300005547 Bacteria 12392
42 Ga0070665_100119821 3300005548 Bacteria 2633
43 Ga0068855_100076008 3300005563 Bacteria 3898
44 Ga0068854_100039063 3300005578 Bacteria 3341
45 Ga0070702_100014991 3300005615 Bacteria 3946
46 Ga0068864_100009793 3300005618 Bacteria 7902
47 Ga0068864_100266864 3300005618 Bacteria 1594
48 Ga0068866_10004988 3300005718 Bacteria 5465
49 Ga0068870_10000101 3300005840 Bacteria 28668
50 Ga0068863_100007923 3300005841 Bacteria 10385
51 Ga0068858_100021263 3300005842 Bacteria 6060
52 Ga0068858_100152402 3300005842 Bacteria 2174
53 Ga0081455_10049141 3300005937 Bacteria 3638
54 Ga0081540_1004503 3300005983 Bacteria 10581
55 Ga0070717_10006633 3300006028 Bacteria 8529
56 Ga0075365_10001119 3300006038 Bacteria 11701
57 Ga0070716_100039972 3300006173 Bacteria 2607
58 Ga0070712_100000002 3300006175 Bacteria 288475
59 Ga0097621_100049530 3300006237 Bacteria 3413
60 Ga0068871_100032812 3300006358 Bacteria 4105
61 Ga0075428_100178601 3300006844 Bacteria 2298
62 Ga0075433_10002505 3300006852 Bacteria 13968
63 Ga0075434_100007459 3300006871 Bacteria 10118
64 Ga0075429_100112125 3300006880 Bacteria 2384
65 Ga0105240_10015977 3300009093 Bacteria 10176
66 Ga0111539_10024704 3300009094 Bacteria 7370
67 Ga0105245_10055506 3300009098 Bacteria 3558
68 Ga0105245_10093683 3300009098 Bacteria 2768
69 Ga0105247_10007213 3300009101 Bacteria 6825
70 Ga0105247_10014303 3300009101 Bacteria 4764
71 Ga0105242_10228652 3300009176 Bacteria 1666
72 Ga0105238_10203305 3300009551 Bacteria 1957
73 Ga0105239_10001112 3300010375 Bacteria 37113
74 Ga0105246_10004192 3300011119 Bacteria 8760
75 Ga0157371_10027876 3300013102 Bacteria 4093
76 Ga0157370_10074343 3300013104 Bacteria 3205
77 Ga0157369_10107995 3300013105 Bacteria 2960
78 Ga0157369_10126835 3300013105 Bacteria 2705
79 Ga0157374_10032524 3300013296 Bacteria 4750
80 Ga0157378_10012106 3300013297 Bacteria 7556
81 Ga0157372_10031330 3300013307 Bacteria 5823
82 Ga0157375_10220979 3300013308 Bacteria 2053
83 Ga0157379_10012906 3300014968 Bacteria 7309
84 Ga0157376_10053431 3300014969 Bacteria 3364
85 Ga0157376_10173403 3300014969 Bacteria 1966
86 Ga0206356_11160004 3300020070 Bacteria 1878
87 Ga0213874_10006710 3300021377 Bacteria 2734
88 Ga0207656_10014624 3300025321 Bacteria 3028
89 Ga0207692_10095021 3300025898 Bacteria 1624
90 Ga0207688_10018105 3300025901 Bacteria 3835
91 Ga0207645_10079184 3300025907 Bacteria 2106
92 Ga0207643_10000139 3300025908 Bacteria 48989
93 Ga0207705_10005587 3300025909 Bacteria 9400
94 Ga0207684_10022488 3300025910 Bacteria 5382
95 Ga0207684_10129591 3300025910 Bacteria 2165
96 Ga0207654_10038585 3300025911 Bacteria 2681
97 Ga0207707_10049945 3300025912 Bacteria 3644
98 Ga0207707_10199014 3300025912 Bacteria 1747
99 Ga0207695_10068604 3300025913 Bacteria 3633
100 Ga0207671_10159930 3300025914 Bacteria 1744
101 Ga0207693_10000014 3300025915 Bacteria 148984
102 Ga0207693_10030190 3300025915 Bacteria 4280
103 Ga0207660_10018959 3300025917 Bacteria 4595
104 Ga0207657_10015567 3300025919 Bacteria 7362
105 Ga0207649_10002674 3300025920 Bacteria 9886
106 Ga0207652_10005311 3300025921 Bacteria 10452
107 Ga0207646_10004627 3300025922 Bacteria 14860
108 Ga0207646_10015372 3300025922 Bacteria 7230
109 Ga0207646_10052350 3300025922 Bacteria 3653
110 Ga0207650_10020865 3300025925 Bacteria 4627
111 Ga0207687_10041345 3300025927 Bacteria 3165
112 Ga0207700_10047259 3300025928 Bacteria 3189
113 Ga0207700_10063839 3300025928 Bacteria 2803
114 Ga0207664_10000191 3300025929 Bacteria 45902
115 Ga0207664_10010906 3300025929 Bacteria 6437
116 Ga0207664_10044939 3300025929 Bacteria 3461
117 Ga0207644_10002051 3300025931 Bacteria 13049
118 Ga0207690_10039981 3300025932 Bacteria 3063
119 Ga0207691_10007427 3300025940 Bacteria 10551
120 Ga0207711_10026213 3300025941 Bacteria 4890
121 Ga0207689_10001405 3300025942 Bacteria 22984
122 Ga0207661_10047786 3300025944 Bacteria 3399
123 Ga0207679_10004380 3300025945 Bacteria 8788
124 Ga0207679_10101196 3300025945 Bacteria 2254
125 Ga0207667_10039234 3300025949 Bacteria 5049
126 Ga0207703_10049293 3300026035 Bacteria 3404
127 Ga0207678_10000814 3300026067 Bacteria 28557
128 Ga0207678_10090839 3300026067 Bacteria 2610
129 Ga0207708_10039419 3300026075 Bacteria 3599
130 Ga0207702_10003390 3300026078 Bacteria 14595
131 Ga0207641_10007330 3300026088 Bacteria 9185
132 Ga0207676_10003894 3300026095 Bacteria 10544
133 Ga0207675_100127168 3300026118 Bacteria 2415
134 Ga0207683_10000073 3300026121 Bacteria 78066
135 Ga0207683_10000311 3300026121 Bacteria 44062
136 Ga0207428_10004132 3300027907 Bacteria 13915
137 Ga0268266_10015779 3300028379 Bacteria 6468
138 Ga0268264_10027597 3300028381 Bacteria 4641
139 Ga0307416_100050598 3300032002 Bacteria 3313
140 Ga0307416_100067340 3300032002 Bacteria 2953
141 Ga0373943_0016272 3300035170 Bacteria 3389
142 Ga0395899_0032774 3300037312 Bacteria 3904
143 Ga0395899_0039579 3300037312 Bacteria 3528
144 Ga0395899_0116820 3300037312 Bacteria 1914
145 Ga0395900_0003490 3300037418 Bacteria 16966
146 Ga0395900_0023317 3300037418 Bacteria 6334
147 Ga0395900_0045078 3300037418 Bacteria 4542
148 Ga0395900_0049663 3300037418 Bacteria 4322
149 Ga0395900_0097124 3300037418 Bacteria 3027
150 Ga0395900_0097889 3300037418 Bacteria 3014
151 Ga0395900_0127161 3300037418 Bacteria 2613
152 Ga0395900_0143678 3300037418 Bacteria 2442
153 Ga0395898_0014326 3300037466 Bacteria 8148
154 Ga0395898_0014735 3300037466 Bacteria 8025
155 Ga0395898_0017574 3300037466 Bacteria 7297
156 Ga0395898_0020190 3300037466 Bacteria 6767
157 Ga0395898_0035098 3300037466 Bacteria 4991
158 Ga0395898_0041295 3300037466 Bacteria 4557
159 Ga0395898_0045363 3300037466 Bacteria 4321
160 Ga0395898_0057716 3300037466 Bacteria 3781
161 Ga0395898_0080041 3300037466 Bacteria 3151
162 Ga0395898_0116180 3300037466 Bacteria 2564
163 Ga0395898_0130292 3300037466 Bacteria 2409
164 Ga0395898_0133970 3300037466 Bacteria 2372
165 Ga0395898_0180231 3300037466 Bacteria 2019
166 Ga0395905_0017195 3300037471 Bacteria 6869
167 Ga0395905_0020942 3300037471 Bacteria 6192
168 Ga0395905_0035422 3300037471 Bacteria 4687
169 Ga0395905_0041918 3300037471 Bacteria 4295
170 Ga0395905_0048978 3300037471 Bacteria 3959
171 Ga0395905_0068863 3300037471 Bacteria 3315
172 Ga0395905_0075324 3300037471 Bacteria 3163
173 Ga0395905_0125484 3300037471 Bacteria 2413
174 Ga0395905_0143173 3300037471 Bacteria 2249
175 Ga0395905_0186031 3300037471 Bacteria 1949
176 Ga0395901_0005707 3300038443 Bacteria 12597
177 Ga0395901_0006763 3300038443 Bacteria 11582
178 Ga0395901_0019881 3300038443 Bacteria 6870
179 Ga0395901_0023565 3300038443 Bacteria 6311
180 Ga0395901_0027274 3300038443 Bacteria 5867
181 Ga0395901_0027582 3300038443 Bacteria 5836
182 Ga0395901_0030227 3300038443 Bacteria 5581
183 Ga0395901_0032231 3300038443 Bacteria 5408
184 Ga0395901_0039894 3300038443 Bacteria 4861
185 Ga0395901_0045557 3300038443 Bacteria 4552
186 Ga0395901_0046344 3300038443 Bacteria 4515
187 Ga0395901_0059958 3300038443 Bacteria 3959
188 Ga0395901_0068699 3300038443 Bacteria 3691
189 Ga0395901_0131275 3300038443 Bacteria 2632
190 Ga0395901_0154382 3300038443 Bacteria 2411
191 Ga0395901_0166027 3300038443 Bacteria 2318
192 Ga0395901_0238649 3300038443 Bacteria 1896
193 Ga0436365_0620675 3300039437 Bacteria 2828
194 Ga0436365_0651573 3300039437 Bacteria 2310
195 Ga0436365_1191549 3300039437 Bacteria 4741
196 Ga0436363_0194262 3300039450 Bacteria 4433
197 Ga0436363_0654155 3300039450 Bacteria 35800
198 Ga0436363_1000575 3300039450 Bacteria 2148
199 Ga0451793_1367992 3300041452 Bacteria 2301
200 Ga0451802_0248935 3300041460 Bacteria 5543
201 Ga0451849_1575621 3300041505 Bacteria 2365
202 Ga0451853_0306499 3300041512 Bacteria 2345
203 Ga0439455_0017623 3300042012 Bacteria 1667
204 Ga0439463_007814 3300042016 Bacteria 2641
205 Ga0439459_0005233 3300042438 Bacteria 2123
206 Ga0466961_0020680 3300044693 Bacteria 4235
207 Ga0466963_0030619 3300044694 Bacteria 3474
208 Ga0466963_0036291 3300044694 Bacteria 3214
209 Ga0466963_0044640 3300044694 Bacteria 2918
210 Ga0466963_0051134 3300044694 Bacteria 2738
211 Ga0466963_0064340 3300044694 Bacteria 2456
212 Ga0466963_0119604 3300044694 Bacteria 1812
213 Ga0466964_0021721 3300044706 Bacteria 2484
214 Ga0466971_0000327 3300044719 Bacteria 18324
215 Ga0466971_0039524 3300044719 Bacteria 2117
216 Ga0466957_0002681 3300044842 Bacteria 9618
217 Ga0466960_0000920 3300044901 Bacteria 10415
218 Ga0466960_0024517 3300044901 Bacteria 2722
219 Ga0466959_0003058 3300045049 Bacteria 10824
220 Ga0466959_0050928 3300045049 Bacteria 3039
221 Ga0466959_0071812 3300045049 Bacteria 2506
222 Ga0466958_0001996 3300045836 Bacteria 10037
223 Ga0466958_0032917 3300045836 Bacteria 3086
224 Ga0466967_0000682 3300045976 Bacteria 17220
225 Ga0466967_0001418 3300045976 Bacteria 13869
226 Ga0466967_0002136 3300045976 Bacteria 12121
227 Ga0466967_0003606 3300045976 Bacteria 10162
228 Ga0466967_0005224 3300045976 Bacteria 8945
229 Ga0466967_0013262 3300045976 Bacteria 6358
230 Ga0466967_0022440 3300045976 Bacteria 5150
231 Ga0466967_0032243 3300045976 Bacteria 4421
232 Ga0466967_0217715 3300045976 Bacteria 1813
233 Ga0495603_0042615 3300046455 Bacteria 2713
234 Ga0495641_0047389 3300046461 Bacteria 1973
235 Ga0495580_0049552 3300046472 Bacteria 2972
236 Ga0495608_0039759 3300046511 Bacteria 3151
237 Ga0495586_0006121 3300046535 Bacteria 6431
238 Ga0495587_0029187 3300046536 Bacteria 3350
239 Ga0495667_0066242 3300046559 Bacteria 2361
240 Ga0495634_0013847 3300046642 Bacteria 5827
241 Ga0495635_0023292 3300046663 Bacteria 4316
242 Ga0495657_0058960 3300046675 Bacteria 2547
243 Ga0495599_0016356 3300046678 Bacteria 4606
244 Ga0495646_0014262 3300046680 Bacteria 5055
245 Ga0495658_0023071 3300046683 Bacteria 3300
246 Ga0495613_0039706 3300046689 Bacteria 3489
247 Ga0495581_0045208 3300047315 Bacteria 2546
248 Ga0495604_0028657 3300047317 Bacteria 4430
249 Ga0495674_0110956 3300047319 Bacteria 2325
250 Ga0495674_0116698 3300047319 Bacteria 2258
251 Ga0495672_0031598 3300047320 Bacteria 3304
252 Ga0495676_0119849 3300047321 Bacteria 1916
253 Ga0495680_0007284 3300047322 Bacteria 10181
254 Ga0495680_0124133 3300047322 Bacteria 1904
255 Ga0496100_0006669 3300048903 Bacteria 6314
256 Ga0496100_0016457 3300048903 Bacteria 4344
257 Ga0496101_0016379 3300048904 Bacteria 5007
258 Ga0496101_0017420 3300048904 Bacteria 4873
259 Ga0496102_0010451 3300048905 Bacteria 7987
260 Ga0496102_0040231 3300048905 Bacteria 4228
261 Ga0496102_0181263 3300048905 Bacteria 1985
262 Ga0496103_0011992 3300048906 Bacteria 5148
263 Ga0496104_0031677 3300048907 Bacteria 4918
264 Ga0496104_0050804 3300048907 Bacteria 3911
265 Ga0496104_0065534 3300048907 Bacteria 3447
266 Ga0496104_0114896 3300048907 Bacteria 2582
267 Ga0496105_0006963 3300048908 Bacteria 8711
268 Ga0496105_0008959 3300048908 Bacteria 7806
269 Ga0496105_0063780 3300048908 Bacteria 3040
270 Ga0496105_0126094 3300048908 Bacteria 2110
271 Ga0496106_0004925 3300048909 Bacteria 9882
272 Ga0496106_0007281 3300048909 Bacteria 8175
273 Ga0496106_0016855 3300048909 Bacteria 5407
274 Ga0496107_0003812 3300048910 Bacteria 10126
275 Ga0496107_0012550 3300048910 Bacteria 5916
276 Ga0496107_0017866 3300048910 Bacteria 4992
277 Ga0496108_0028349 3300048911 Bacteria 4632
278 Ga0496108_0058306 3300048911 Bacteria 3245
279 Ga0496109_0028128 3300048912 Bacteria 5026
280 Ga0496109_0036334 3300048912 Bacteria 4446
281 Ga0496109_0093338 3300048912 Bacteria 2785
282 Ga0496109_0295573 3300048912 Bacteria 1527
283 Ga0496110_0024729 3300048913 Bacteria 5122
284 Ga0496110_0057275 3300048913 Bacteria 3431
285 Ga0496110_0064113 3300048913 Bacteria 3246
286 Ga0496111_0003555 3300048914 Bacteria 9649
287 Ga0496111_0004115 3300048914 Bacteria 9131
288 Ga0496111_0013582 3300048914 Bacteria 5546
289 Ga0496111_0014467 3300048914 Bacteria 5391
290 Ga0496112_0013675 3300048915 Bacteria 7500
291 Ga0496112_0020692 3300048915 Bacteria 6241
292 Ga0496112_0027392 3300048915 Bacteria 5493
293 Ga0496112_0082029 3300048915 Bacteria 3189
294 Ga0496112_0343086 3300048915 Bacteria 1437
295 Ga0496114_0008404 3300048917 Bacteria 8176
296 Ga0501034_0012618 3300049571 Bacteria 8719
297 Ga0501047_0025150 3300049581 Bacteria 5720
298 Ga0501067_0013589 3300049583 Bacteria 4508
299 Ga0501067_0033800 3300049583 Bacteria 2837
300 Ga0501069_0004713 3300049585 Bacteria 7049
301 Ga0501070_0013592 3300049586 Bacteria 6861
302 nmdc:mga0yw44_40031_c1 3300050492 Bacteria 2782
303 nmdc:mga0n895_4938_c1 3300050512 Bacteria 11062
304 nmdc:mga0rr50_3291_c1 3300050513 Bacteria 9276
305 nmdc:mga0rr50_4140_c1 3300050513 Bacteria 8478
306 nmdc:mga08x19_3228_c1 3300050514 Bacteria 9778
307 nmdc:mga08x19_65506_c1 3300050514 Bacteria 2360
308 nmdc:mga0a205_67307_c1 3300050515 Bacteria 3460
309 Ga0495612_0019277 3300053078 Bacteria 2733
310 Ga0500616_0076530 3300053153 Bacteria 1691
311 Ga0070698_100113810
312 Ga0070658_10053238
313 Ga0070683_100063056
314 Ga0070670_100040739
315 Ga0068869_100002128
316 Ga0070680_100034076
317 Ga0070682_100016013
318 Ga0068868_100034374
319 Ga0070660_100050581
320 Ga0070689_100030704
321 Ga0070691_10006106
322 Ga0070692_10023054
323 Ga0070671_100002386
324 Ga0070674_100135290
325 Ga0070673_100055240
326 Ga0070688_100072570
327 Ga0070714_100199187
328 Ga0070713_100015622
329 Ga0070711_100144319
330 Ga0070705_100034400
331 Ga0070705_100040120
332 Ga0070708_100011259
333 Ga0070708_100051057
334 Ga0070663_100033507
335 Ga0070663_100077783
336 Ga0070678_100002228
337 Ga0070678_100002833
338 Ga0070681_10064533
339 Ga0070685_10021950
340 Ga0070706_100035734
341 Ga0070707_100061449
342 Ga0070698_100005687
343 Ga0070698_100011998
344 Ga0070698_100123407
345 Ga0070698_100280525
346 Ga0070679_100049501
347 Ga0070684_100042902
348 Ga0068853_100047002
349 Ga0070686_100007424
350 Ga0070695_100024998
351 Ga0070693_100001038
352 Ga0070665_100119821
353 Ga0068855_100076008
354 Ga0068854_100039063
355 Ga0070702_100014991
356 Ga0068864_100009793
357 Ga0068864_100266864
358 Ga0068866_10004988
359 Ga0068870_10000101
360 Ga0068863_100007923
361 Ga0068858_100021263
362 Ga0068858_100152402
363 Ga0081455_10049141
364 Ga0081540_1004503
365 Ga0070717_10006633
366 Ga0075365_10001119
367 Ga0070716_100039972
368 Ga0070712_100000002
369 Ga0097621_100049530
370 Ga0068871_100032812
371 Ga0075428_100178601
372 Ga0075433_10002505
373 Ga0075434_100007459
374 Ga0075429_100112125
375 Ga0105240_10015977
376 Ga0111539_10024704
377 Ga0105245_10055506
378 Ga0105245_10093683
379 Ga0105247_10007213
380 Ga0105247_10014303
381 Ga0105242_10228652
382 Ga0105238_10203305
383 Ga0105239_10001112
384 Ga0105246_10004192
385 Ga0157371_10027876
386 Ga0157370_10074343
387 Ga0157369_10107995
388 Ga0157369_10126835
389 Ga0157374_10032524
390 Ga0157378_10012106
391 Ga0157372_10031330
392 Ga0157375_10220979
393 Ga0157379_10012906
394 Ga0157376_10053431
395 Ga0157376_10173403
396 Ga0206356_11160004
397 Ga0213874_10006710
398 Ga0207656_10014624
399 Ga0207692_10095021
400 Ga0207688_10018105
401 Ga0207645_10079184
402 Ga0207643_10000139
403 Ga0207705_10005587
404 Ga0207684_10022488
405 Ga0207684_10129591
406 Ga0207654_10038585
407 Ga0207707_10049945
408 Ga0207707_10199014
409 Ga0207695_10068604
410 Ga0207671_10159930
411 Ga0207693_10000014
412 Ga0207693_10030190
413 Ga0207660_10018959
414 Ga0207657_10015567
415 Ga0207649_10002674
416 Ga0207652_10005311
417 Ga0207646_10004627
418 Ga0207646_10015372
419 Ga0207646_10052350
420 Ga0207650_10020865
421 Ga0207687_10041345
422 Ga0207700_10047259
423 Ga0207700_10063839
424 Ga0207664_10000191
425 Ga0207664_10010906
426 Ga0207664_10044939
427 Ga0207644_10002051
428 Ga0207690_10039981
429 Ga0207691_10007427
430 Ga0207711_10026213
431 Ga0207689_10001405
432 Ga0207661_10047786
433 Ga0207679_10004380
434 Ga0207679_10101196
435 Ga0207667_10039234
436 Ga0207703_10049293
437 Ga0207678_10000814
438 Ga0207678_10090839
439 Ga0207708_10039419
440 Ga0207702_10003390
441 Ga0207641_10007330
442 Ga0207676_10003894
443 Ga0207675_100127168
444 Ga0207683_10000073
445 Ga0207683_10000311
446 Ga0207428_10004132
447 Ga0268266_10015779
448 Ga0268264_10027597
449 Ga0307416_100050598
450 Ga0307416_100067340
451 Ga0373943_0016272
452 Ga0395899_0032774
453 Ga0395899_0039579
454 Ga0395899_0116820
455 Ga0395900_0003490
456 Ga0395900_0023317
457 Ga0395900_0045078
458 Ga0395900_0049663
459 Ga0395900_0097124
460 Ga0395900_0097889
461 Ga0395900_0127161
462 Ga0395900_0143678
463 Ga0395898_0014326
464 Ga0395898_0014735
465 Ga0395898_0017574
466 Ga0395898_0020190
467 Ga0395898_0035098
468 Ga0395898_0041295
469 Ga0395898_0045363
470 Ga0395898_0057716
471 Ga0395898_0080041
472 Ga0395898_0116180
473 Ga0395898_0130292
474 Ga0395898_0133970
475 Ga0395898_0180231
476 Ga0395905_0017195
477 Ga0395905_0020942
478 Ga0395905_0035422
479 Ga0395905_0041918
480 Ga0395905_0048978
481 Ga0395905_0068863
482 Ga0395905_0075324
483 Ga0395905_0125484
484 Ga0395905_0143173
485 Ga0395905_0186031
486 Ga0395901_0005707
487 Ga0395901_0006763
488 Ga0395901_0019881
489 Ga0395901_0023565
490 Ga0395901_0027274
491 Ga0395901_0027582
492 Ga0395901_0030227
493 Ga0395901_0032231
494 Ga0395901_0039894
495 Ga0395901_0045557
496 Ga0395901_0046344
497 Ga0395901_0059958
498 Ga0395901_0068699
499 Ga0395901_0131275
500 Ga0395901_0154382
501 Ga0395901_0166027
502 Ga0395901_0238649
503 Ga0436365_0620675
504 Ga0436365_0651573
505 Ga0436365_1191549
506 Ga0436363_0194262
507 Ga0436363_0654155
508 Ga0436363_1000575
509 Ga0451793_1367992
510 Ga0451802_0248935
511 Ga0451849_1575621
512 Ga0451853_0306499
513 Ga0439455_0017623
514 Ga0439463_007814
515 Ga0439459_0005233
516 Ga0466961_0020680
517 Ga0466963_0030619
518 Ga0466963_0036291
519 Ga0466963_0044640
520 Ga0466963_0051134
521 Ga0466963_0064340
522 Ga0466963_0119604
523 Ga0466964_0021721
524 Ga0466971_0000327
525 Ga0466971_0039524
526 Ga0466957_0002681
527 Ga0466960_0000920
528 Ga0466960_0024517
529 Ga0466959_0003058
530 Ga0466959_0050928
531 Ga0466959_0071812
532 Ga0466958_0001996
533 Ga0466958_0032917
534 Ga0466967_0000682
535 Ga0466967_0001418
536 Ga0466967_0002136
537 Ga0466967_0003606
538 Ga0466967_0005224
539 Ga0466967_0013262
540 Ga0466967_0022440
541 Ga0466967_0032243
542 Ga0466967_0217715
543 Ga0495603_0042615
544 Ga0495641_0047389
545 Ga0495580_0049552
546 Ga0495608_0039759
547 Ga0495586_0006121
548 Ga0495587_0029187
549 Ga0495667_0066242
550 Ga0495634_0013847
551 Ga0495635_0023292
552 Ga0495657_0058960
553 Ga0495599_0016356
554 Ga0495646_0014262
555 Ga0495658_0023071
556 Ga0495613_0039706
557 Ga0495581_0045208
558 Ga0495604_0028657
559 Ga0495674_0110956
560 Ga0495674_0116698
561 Ga0495672_0031598
562 Ga0495676_0119849
563 Ga0495680_0007284
564 Ga0495680_0124133
565 Ga0496100_0006669
566 Ga0496100_0016457
567 Ga0496101_0016379
568 Ga0496101_0017420
569 Ga0496102_0010451
570 Ga0496102_0040231
571 Ga0496102_0181263
572 Ga0496103_0011992
573 Ga0496104_0031677
574 Ga0496104_0050804
575 Ga0496104_0065534
576 Ga0496104_0114896
577 Ga0496105_0006963
578 Ga0496105_0008959
579 Ga0496105_0063780
580 Ga0496105_0126094
581 Ga0496106_0004925
582 Ga0496106_0007281
583 Ga0496106_0016855
584 Ga0496107_0003812
585 Ga0496107_0012550
586 Ga0496107_0017866
587 Ga0496108_0028349
588 Ga0496108_0058306
589 Ga0496109_0028128
590 Ga0496109_0036334
591 Ga0496109_0093338
592 Ga0496109_0295573
593 Ga0496110_0024729
594 Ga0496110_0057275
595 Ga0496110_0064113
596 Ga0496111_0003555
597 Ga0496111_0004115
598 Ga0496111_0013582
599 Ga0496111_0014467
600 Ga0496112_0013675
601 Ga0496112_0020692
602 Ga0496112_0027392
603 Ga0496112_0082029
604 Ga0496112_0343086
605 Ga0496114_0008404
606 Ga0501034_0012618
607 Ga0501047_0025150
608 Ga0501067_0013589
609 Ga0501067_0033800
610 Ga0501069_0004713
611 Ga0501070_0013592
612 nmdc:mga0yw44_40031_c1
613 nmdc:mga0n895_4938_c1
614 nmdc:mga0rr50_3291_c1
615 nmdc:mga0rr50_4140_c1
616 nmdc:mga08x19_3228_c1
617 nmdc:mga08x19_65506_c1
618 nmdc:mga0a205_67307_c1
619 Ga0495612_0019277
620 Ga0500616_0076530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01654

Cyt_bd_oxida_I

Cytochrome bd terminal oxidase subunit I

19

431

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ir6-assembly1.cif.gz_A the structure of bd oxidase from geobacillus thermodenitrificans 0.9038 14 435
7ose-assembly1.cif.gz_D cytochrome bd-ii type oxidase with bound aurachin d 0.8928 14 437
5ir6-assembly1.cif.gz_A the structure of bd oxidase from geobacillus thermodenitrificans 0.882 14 435
7nkz-assembly1.cif.gz_A cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.8719 14 437
7ose-assembly1.cif.gz_D cytochrome bd-ii type oxidase with bound aurachin d 0.8346 14 437
ID Description Score Start End Superfamily
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.582 23 382 1.20.1630.10
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.573 23 382 1.20.1630.10
af_Q54RB8_187_364_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5403 25 152 1.20.120.1770
af_Q8IY95_26_259_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5174 27 156 1.20.1070.10
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.4826 25 380 1.20.1630.10
ID Description Score Start End GO Terms
AF-A0A499VB84-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9837 15 141 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A3B9Z2M6-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9818 14 143 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A7W1IV37-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9808 14 157 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A537WDP4-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9782 14 263 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A222TQ28-F1-model_v4 deleted 0.977 15 157

Map