F400363

General Info

Members Datasets Scaffolds Average Seq Length
309 188 287 225

Family's Representative Sequence

Representative Sequence 3300046520|Ga0495637_0023352|Ga0495637_0023352_1257_1934
Length 225
Sequence MMLHIPGVLTPEQVKSMRERLAATDWVDGRASVGSQGAQVKRNRQLAEGSPLALELGQIVSAALAANPLFFSSVLPLRILPPFFNSYAGGEHYGAHVDGAIRAQRGGAPMRTDVSCTVFLSDPEDYEGGELTVIDSYGTHEAKLPAGDAIVYPSTSIHEVQPVTSGERIASFLWVQSMVRDDWKRAMLYELDTNIQALRAKHGDGPELVGLTGHYHNLLRQWAET

Samples

Sample ID Description Type Environment
1 2547132512 Azospira oryzae 6a3 Isolate Unclassified
2 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
5 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
6 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
7 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
8 2643221638 Duganella sp. Root336D2 Isolate Unclassified
9 2643221645 Massilia sp. Root351 Isolate Unclassified
10 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
11 2643221664 Massilia sp. Root418 Isolate Unclassified
12 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
13 2738541280 Massilia sp. GV090 Isolate Unclassified
14 2738541300 Massilia sp. GV016 Isolate Unclassified
15 2738543018 Massilia sp. GV045 Isolate Unclassified
16 2738543030 Massilia sp. GV097 Isolate Unclassified
17 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
18 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
19 2899924645 Variovorax sp. 369 Isolate Unclassified
20 2928051484 Variovorax sp. 1133 Isolate Unclassified
21 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
22 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
23 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
24 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
25 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
26 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
27 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
28 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
31 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
32 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
33 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
34 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
93 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
94 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
95 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
96 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
97 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
107 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
108 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
111 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
115 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
118 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
124 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
125 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
133 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
143 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
144 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
150 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
151 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
152 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
153 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
168 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
169 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
175 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
176 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
177 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
178 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
179 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
183 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
184 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
185 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
186 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
188 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.88
Metatranscriptomes 0
Isolates 7.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.3
Nodule 0.65
Rhizoplane 2.59
Rhizosphere 61.49
Stem 0
Stem Tuber 0
Unclassified 11.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1001900 3300002738 Bacteria 6322
2 JGI25157J39369_1000029 3300002741 Bacteria 146928
3 JGI25164J39214_1009783 3300002772 Bacteria 937
4 JGI25152J39213_1002944 3300002773 Bacteria 6063
5 JGI25152J39213_1004558 3300002773 Bacteria 4326
6 JGI25150J39212_1001466 3300002774 Bacteria 6570
7 JGI25150J39212_1002854 3300002774 Bacteria 4185
8 JGI25150J39212_1022920 3300002774 Bacteria 933
9 JGI25151J46595_10010303 3300003187 Bacteria 4355
10 JGI25153J46596_10001462 3300003215 Bacteria 14096
11 JGI25153J46596_10007283 3300003215 Bacteria 5470
12 rootH2_10101000 3300003320 Bacteria 7192
13 rootH1_10030643 3300003323 Bacteria 15627
14 JGI25160J50197_1003173 3300003354 Bacteria 7466
15 JGI25161J50226_1004175 3300003374 Bacteria 3089
16 Ga0055539_1001221 3300003752 Bacteria 5180
17 Ga0055526_1001707 3300003771 Bacteria 15319
18 Ga0055526_1002427 3300003771 Bacteria 12628
19 Ga0055526_1007604 3300003771 Bacteria 5592
20 Ga0055537_1002413 3300003773 Bacteria 6281
21 Ga0055524_1000026 3300003775 Bacteria 214653
22 Ga0055524_1001218 3300003775 Bacteria 15238
23 Ga0055524_1002218 3300003775 Bacteria 10185
24 Ga0055524_1002235 3300003775 Bacteria 10137
25 Ga0055534_1002491 3300003784 Bacteria 6328
26 Ga0055534_1013978 3300003784 Bacteria 1521
27 Ga0055530_10000822 3300003791 Bacteria 25684
28 Ga0055530_10009172 3300003791 Bacteria 3842
29 Ga0055530_10009258 3300003791 Bacteria 3814
30 Ga0055531_10005241 3300003794 Bacteria 7614
31 Ga0055531_10018890 3300003794 Bacteria 2820
32 Ga0055543_1000852 3300004625 Bacteria 14731
33 Ga0065165_1002610 3300005262 Bacteria 14731
34 Ga0065165_1021113 3300005262 Bacteria 2270
35 Ga0065715_10025127 3300005293 Bacteria 1952
36 Ga0070658_10030629 3300005327 Bacteria 4322
37 Ga0070661_100156039 3300005344 Bacteria 1727
38 Ga0070663_100154365 3300005455 Bacteria 1763
39 Ga0068853_100143870 3300005539 Bacteria 2142
40 Ga0068857_100000950 3300005577 Bacteria 22106
41 Ga0068854_100271134 3300005578 Bacteria 1363
42 Ga0068856_100001671 3300005614 Bacteria 23232
43 Ga0099826_10000003 3300006948 Bacteria 1067817
44 Ga0105240_10602226 3300009093 Bacteria 1210
45 Ga0105243_10002291 3300009148 Bacteria 16050
46 Ga0105239_10017313 3300010375 Bacteria 7970
47 Ga0157371_10000001 3300013102 Bacteria 1162285
48 Ga0163162_10338827 3300013306 Bacteria 1636
49 Ga0182008_10000139 3300014497 Bacteria 55735
50 Ga0182008_10168082 3300014497 Bacteria 1106
51 Ga0157377_10000036 3300014745 Bacteria 116358
52 Ga0157379_10000268 3300014968 Bacteria 41057
53 Ga0182006_1000010 3300015261 Bacteria 413414
54 Ga0182007_10000021 3300015262 Bacteria 193408
55 Ga0182005_1000009 3300015265 Bacteria 455334
56 Ga0163161_10088842 3300017792 Bacteria 2284
57 Ga0163161_10418096 3300017792 Bacteria 1078
58 Ga0209436_101589 3300025208 Bacteria 7629
59 Ga0209436_103504 3300025208 Bacteria 4146
60 Ga0207427_100623 3300025231 Bacteria 17397
61 Ga0209258_101004 3300025242 Bacteria 12859
62 Ga0207425_1000006 3300025245 Bacteria 808854
63 Ga0207425_1000396 3300025245 Bacteria 29321
64 Ga0209646_1000111 3300025246 Bacteria 155786
65 Ga0209026_1000054 3300025250 Bacteria 242508
66 Ga0209677_100164 3300025253 Bacteria 57973
67 Ga0209759_1000043 3300025256 Bacteria 242513
68 Ga0209129_1000009 3300025258 Bacteria 633100
69 Ga0209129_1001376 3300025258 Bacteria 13650
70 Ga0209565_1000163 3300025263 Bacteria 87185
71 Ga0209565_1000685 3300025263 Bacteria 21069
72 Ga0209565_1001484 3300025263 Bacteria 10249
73 Ga0209565_1005101 3300025263 Bacteria 3866
74 Ga0209565_1014677 3300025263 Bacteria 1790
75 Ga0209130_1001402 3300025284 Bacteria 16103
76 Ga0209675_1000292 3300025291 Bacteria 46656
77 Ga0209675_1002792 3300025291 Bacteria 8712
78 Ga0209675_1007076 3300025291 Bacteria 4371
79 Ga0209675_1022195 3300025291 Bacteria 1674
80 Ga0209025_1000732 3300025294 Bacteria 55664
81 Ga0209564_1000098 3300025295 Bacteria 228906
82 Ga0209564_1001712 3300025295 Bacteria 20652
83 Ga0209564_1031338 3300025295 Bacteria 1627
84 Ga0209758_1000071 3300025297 Bacteria 283749
85 Ga0209050_1000183 3300025298 Bacteria 142357
86 Ga0209050_1000731 3300025298 Bacteria 47889
87 Ga0209050_1001417 3300025298 Bacteria 25912
88 Ga0209256_1000013 3300025299 Bacteria 689442
89 Ga0209256_1000499 3300025299 Bacteria 57588
90 Ga0209256_1001140 3300025299 Bacteria 30214
91 Ga0209256_1003334 3300025299 Bacteria 11393
92 Ga0207426_1001892 3300025302 Bacteria 15204
93 Ga0209051_1046824 3300025303 Bacteria 1483
94 Ga0209257_1000010 3300025304 Bacteria 1158682
95 Ga0207649_10148252 3300025920 Bacteria 1613
96 Ga0207709_10001511 3300025935 Bacteria 16065
97 Ga0207667_10064867 3300025949 Bacteria 3811
98 Ga0207678_10273716 3300026067 Bacteria 1448
99 Ga0207702_10005145 3300026078 Bacteria 11507
100 Ga0207674_10005042 3300026116 Bacteria 15762
101 Ga0207683_10300205 3300026121 Bacteria 1469
102 Ga0207698_10001921 3300026142 Bacteria 12184
103 Ga0209282_1000002 3300027666 Bacteria 1067825
104 Ga0307511_10064839 3300030521 Bacteria 2741
105 Ga0316177_1114841 3300030731 Bacteria 2711
106 Ga0316180_1098216 3300030736 Bacteria 1351
107 Ga0316182_1450463 3300030745 Bacteria 1566
108 Ga0265332_10000010 3300031238 Bacteria 289041
109 Ga0307513_10253638 3300031456 Bacteria 1554
110 Ga0307408_100000232 3300031548 Bacteria 58517
111 Ga0307408_100000703 3300031548 Bacteria 27300
112 Ga0307408_100002923 3300031548 Bacteria 11838
113 Ga0307408_100038174 3300031548 Bacteria 3387
114 Ga0307518_10019136 3300031838 Bacteria 4919
115 Ga0307412_10049772 3300031911 Bacteria 2762
116 Ga0307416_100002440 3300032002 Bacteria 10675
117 Ga0307416_100168636 3300032002 Bacteria 2035
118 Ga0307510_10234655 3300033180 Bacteria 1334
119 Ga0373934_0070025 3300035086 Bacteria 1402
120 Ga0395905_0268280 3300037471 Bacteria 1593
121 Ga0451800_1171059 3300041459 Bacteria 3041
122 Ga0439454_027415 3300042011 Bacteria 876
123 Ga0450904_000039 3300042139 Bacteria 29683
124 Ga0466970_0175752 3300044765 Bacteria 1187
125 Ga0495617_004135 3300046452 Bacteria 5321
126 Ga0495617_015012 3300046452 Bacteria 2628
127 Ga0495617_052580 3300046452 Bacteria 1353
128 Ga0495590_0000030 3300046457 Bacteria 146237
129 Ga0495590_0013570 3300046457 Bacteria 2991
130 Ga0495638_0000105 3300046460 Bacteria 134384
131 Ga0495638_0042363 3300046460 Bacteria 2876
132 Ga0495638_0068951 3300046460 Bacteria 2167
133 Ga0495650_0004889 3300046471 Bacteria 8964
134 Ga0495650_0005195 3300046471 Bacteria 8559
135 Ga0495650_0080446 3300046471 Bacteria 1257
136 Ga0495605_0010777 3300046474 Bacteria 5108
137 Ga0495605_0179263 3300046474 Bacteria 932
138 Ga0495584_0000881 3300046491 Bacteria 19333
139 Ga0495584_0090553 3300046491 Bacteria 1542
140 Ga0495584_0133360 3300046491 Bacteria 1260
141 Ga0495585_0055021 3300046492 Bacteria 2199
142 Ga0495596_0001129 3300046500 Bacteria 15761
143 Ga0495596_0048990 3300046500 Bacteria 1656
144 Ga0495607_0002992 3300046501 Bacteria 13210
145 Ga0495607_0072127 3300046501 Bacteria 1923
146 Ga0495607_0113929 3300046501 Bacteria 1429
147 Ga0495607_0234607 3300046501 Bacteria 890
148 Ga0495583_0000004 3300046506 Bacteria 655287
149 Ga0495583_0000202 3300046506 Bacteria 100020
150 Ga0495583_0000853 3300046506 Bacteria 37126
151 Ga0495583_0010649 3300046506 Bacteria 5344
152 Ga0495606_0000043 3300046507 Bacteria 214367
153 Ga0495606_0002863 3300046507 Bacteria 19091
154 Ga0495606_0024706 3300046507 Bacteria 4323
155 Ga0495606_0048940 3300046507 Bacteria 2776
156 Ga0495610_0000411 3300046512 Bacteria 43910
157 Ga0495616_0059498 3300046513 Bacteria 1878
158 Ga0495616_0085083 3300046513 Bacteria 1506
159 Ga0495616_0172731 3300046513 Bacteria 965
160 Ga0495631_0020946 3300046518 Bacteria 3048
161 Ga0495631_0031717 3300046518 Bacteria 2386
162 Ga0495632_0079324 3300046519 Bacteria 1567
163 Ga0495632_0183600 3300046519 Bacteria 957
164 Ga0495637_0000293 3300046520 Bacteria 38928
165 Ga0495637_0023352 3300046520 Bacteria 2813
166 Ga0495643_0000449 3300046522 Bacteria 52833
167 Ga0495643_0000770 3300046522 Bacteria 35800
168 Ga0495644_0012482 3300046523 Bacteria 3266
169 Ga0495644_0018939 3300046523 Bacteria 2627
170 Ga0495648_0000008 3300046524 Bacteria 336584
171 Ga0495648_0001014 3300046524 Bacteria 28762
172 Ga0495648_0035445 3300046524 Bacteria 3234
173 Ga0495642_0001381 3300046528 Bacteria 10872
174 Ga0495642_0127741 3300046528 Bacteria 1093
175 Ga0495654_0000014 3300046530 Bacteria 312126
176 Ga0495654_0076348 3300046530 Bacteria 1579
177 Ga0495654_0094579 3300046530 Bacteria 1382
178 Ga0495609_0001810 3300046538 Bacteria 13719
179 Ga0495609_0080940 3300046538 Bacteria 1420
180 Ga0495597_0000532 3300046542 Bacteria 31535
181 Ga0495597_0027869 3300046542 Bacteria 2588
182 Ga0495597_0092281 3300046542 Bacteria 1284
183 Ga0495597_0132863 3300046542 Bacteria 1031
184 Ga0495622_0000560 3300046557 Bacteria 22348
185 Ga0495622_0023325 3300046557 Bacteria 2884
186 Ga0495622_0040134 3300046557 Bacteria 2179
187 Ga0495633_0000073 3300046558 Bacteria 130286
188 Ga0495633_0000810 3300046558 Bacteria 27687
189 Ga0495633_0002477 3300046558 Bacteria 13017
190 Ga0495633_0035231 3300046558 Bacteria 2403
191 Ga0495633_0092242 3300046558 Bacteria 1408
192 Ga0495668_0002762 3300046616 Bacteria 14038
193 Ga0495668_0187195 3300046616 Bacteria 1134
194 Ga0495611_0006094 3300046648 Bacteria 5144
195 Ga0495611_0087400 3300046648 Bacteria 1438
196 Ga0495611_0131884 3300046648 Bacteria 1165
197 Ga0495625_0000278 3300046660 Bacteria 79607
198 Ga0495625_0012857 3300046660 Bacteria 6764
199 Ga0495625_0013884 3300046660 Bacteria 6451
200 Ga0495659_0000007 3300046664 Bacteria 105393
201 Ga0495659_0010075 3300046664 Bacteria 3025
202 Ga0495659_0016373 3300046664 Bacteria 2444
203 Ga0495661_0024185 3300046665 Bacteria 3933
204 Ga0495661_0217544 3300046665 Bacteria 991
205 Ga0495661_0300007 3300046665 Bacteria 804
206 Ga0495669_0000086 3300046684 Bacteria 61977
207 Ga0495670_0002113 3300046691 Bacteria 9809
208 Ga0495670_0042752 3300046691 Bacteria 2261
209 Ga0495671_0000234 3300046692 Bacteria 47760
210 Ga0495671_0009033 3300046692 Bacteria 5593
211 Ga0495589_0022444 3300046794 Bacteria 3220
212 Ga0495660_0002304 3300046810 Bacteria 12241
213 Ga0495660_0003861 3300046810 Bacteria 9159
214 Ga0495660_0005830 3300046810 Bacteria 7350
215 Ga0495660_0037696 3300046810 Bacteria 2692
216 Ga0495636_0002555 3300047318 Bacteria 6993
217 Ga0495672_0000013 3300047320 Bacteria 511827
218 Ga0495672_0000014 3300047320 Bacteria 505636
219 Ga0495672_0020123 3300047320 Bacteria 4381
220 Ga0495672_0020712 3300047320 Bacteria 4304
221 Ga0495672_0021376 3300047320 Bacteria 4222
222 Ga0495672_0172158 3300047320 Bacteria 1103
223 Ga0495672_0189171 3300047320 Bacteria 1036
224 Ga0495683_0005993 3300047323 Bacteria 6676
225 Ga0495687_000853 3300047443 Bacteria 32520
226 Ga0495687_013911 3300047443 Bacteria 4169
227 Ga0495677_0002935 3300047445 Bacteria 6628
228 Ga0495677_0012512 3300047445 Bacteria 3093
229 Ga0495679_013823 3300047446 Bacteria 3012
230 Ga0495685_013115 3300047447 Bacteria 2811
231 Ga0495685_023650 3300047447 Bacteria 2115
232 Ga0495673_0046486 3300047469 Bacteria 1923
233 Ga0495681_0020387 3300047470 Bacteria 3599
234 Ga0495686_0001449 3300047472 Bacteria 25844
235 Ga0495686_0002840 3300047472 Bacteria 15644
236 Ga0495626_0011456 3300048091 Bacteria 4689
237 Ga0495626_0015795 3300048091 Bacteria 3854
238 Ga0495626_0017384 3300048091 Bacteria 3632
239 Ga0495626_0019582 3300048091 Bacteria 3384
240 Ga0495626_0037941 3300048091 Bacteria 2287
241 Ga0496101_0005412 3300048904 Bacteria 8133
242 Ga0496102_0000470 3300048905 Bacteria 44790
243 Ga0496102_0140841 3300048905 Bacteria 2261
244 Ga0496103_0017062 3300048906 Bacteria 4341
245 Ga0496103_0108175 3300048906 Bacteria 1764
246 Ga0496114_0011570 3300048917 Bacteria 7052
247 Ga0496117_0000010 3300048920 Bacteria 611954
248 Ga0496118_0000009 3300048921 Bacteria 611954
249 Ga0496121_0007758 3300048924 Bacteria 12857
250 Ga0496121_0016446 3300048924 Bacteria 7639
251 Ga0496121_0322097 3300048924 Bacteria 1040
252 Ga0496122_0006555 3300048925 Bacteria 13310
253 Ga0496123_0007817 3300048926 Bacteria 9954
254 Ga0496124_0052507 3300048927 Bacteria 3462
255 Ga0496125_0000464 3300048928 Bacteria 72660
256 Ga0495678_001203 3300049459 Bacteria 21302
257 Ga0495678_003000 3300049459 Bacteria 10751
258 Ga0495678_006987 3300049459 Bacteria 5920
259 Ga0495678_009055 3300049459 Bacteria 4968
260 Ga0495678_012885 3300049459 Bacteria 3944
261 Ga0495678_088098 3300049459 Bacteria 1099
262 Ga0495682_0000768 3300049460 Bacteria 20542
263 Ga0495682_0001749 3300049460 Bacteria 11005
264 Ga0495682_0067606 3300049460 Bacteria 1287
265 Ga0501292_008267 3300049515 Bacteria 1518
266 Ga0501043_0000012 3300049579 Bacteria 188907
267 Ga0501046_0000030 3300049580 Bacteria 187803
268 Ga0501047_0000049 3300049581 Bacteria 162513
269 Ga0501048_0000082 3300049582 Bacteria 49693
270 Ga0501207_006670 3300049654 Bacteria 1628
271 Ga0501227_001287 3300049665 Bacteria 5627
272 Ga0501238_000212 3300049671 Bacteria 8405
273 Ga0501257_028432 3300049686 Bacteria 1341
274 Ga0501234_014409 3300049707 Bacteria 1242
275 Ga0501234_033023 3300049707 Bacteria 838
276 Ga0501279_001966 3300049775 Bacteria 2709
277 Ga0501279_002574 3300049775 Bacteria 2371
278 Ga0501279_005012 3300049775 Bacteria 1735
279 Ga0501044_0481482 3300049823 Bacteria 1144
280 nmdc:mga0k408_21905_c1 3300050493 Bacteria 3593
281 Ga0500635_0000017 3300053080 Bacteria 113720
282 Ga0500578_0000028 3300053086 Bacteria 144081
283 Ga0500593_000750 3300053117 Bacteria 12222
284 Ga0500624_008682 3300053157 Bacteria 1428
285 Ga0500636_0010154 3300053177 Bacteria 5489
286 Ga0500645_002572 3300053730 Bacteria 7982
287 Ga0500661_002431 3300055283 Bacteria 3505

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10253638 Ga0307513_102536382 198
2 3300046452 Ga0495617_052580 Ga0495617_052580_23_643 206
3 iso_pu_bacteria 2899924645 2899931256 206
4 iso_pu_bacteria 2928051484 2928054119 206
5 3300046457 Ga0495590_0000030 Ga0495590_0000030_62224_62904 214
6 3300046460 Ga0495638_0000105 Ga0495638_0000105_77447_78127 214
7 3300046471 Ga0495650_0004889 Ga0495650_0004889_85_765 214
8 3300046501 Ga0495607_0002992 Ga0495607_0002992_3078_3758 214
9 3300046506 Ga0495583_0000202 Ga0495583_0000202_96185_96865 214
10 3300046507 Ga0495606_0002863 Ga0495606_0002863_9653_10333 214
11 3300046522 Ga0495643_0000770 Ga0495643_0000770_9307_9987 214
12 3300046524 Ga0495648_0000008 Ga0495648_0000008_309926_310606 214
13 3300046528 Ga0495642_0001381 Ga0495642_0001381_518_1198 214
14 3300046542 Ga0495597_0000532 Ga0495597_0000532_3074_3754 214
15 3300046557 Ga0495622_0000560 Ga0495622_0000560_9455_10135 214
16 3300046558 Ga0495633_0000810 Ga0495633_0000810_13884_14564 214
17 3300046616 Ga0495668_0002762 Ga0495668_0002762_3568_4248 214
18 3300046660 Ga0495625_0000278 Ga0495625_0000278_8671_9351 214
19 3300046810 Ga0495660_0005830 Ga0495660_0005830_6091_6771 214
20 3300047443 Ga0495687_013911 Ga0495687_013911_2267_2947 214
21 3300049459 Ga0495678_003000 Ga0495678_003000_1332_2012 214
22 3300049459 Ga0495678_006987 Ga0495678_006987_4365_5045 214
23 3300046523 Ga0495644_0012482 Ga0495644_0012482_15_674 219
24 3300046648 Ga0495611_0087400 Ga0495611_0087400_765_1424 219
25 3300046648 Ga0495611_0131884 Ga0495611_0131884_15_674 219
26 iso_pu_bacteria 2600255292 2601666738 221
27 iso_pu_bacteria 2547132512 2548846430 222
28 iso_pu_bacteria 2574179768 2574429438 222
29 iso_pu_bacteria 2585428057 2587728657 222
30 iso_pu_bacteria 2643221554 2643789187 222
31 iso_pu_bacteria 2643221592 2643971342 222
32 iso_pu_bacteria 2643221625 2644140877 222
33 iso_pu_bacteria 2643221638 2644215126 222
34 iso_pu_bacteria 2643221645 2644249246 222
35 iso_pu_bacteria 2643221648 2644276669 222
36 iso_pu_bacteria 2643221664 2644355827 222
37 iso_pu_bacteria 2738541276 2738717040 222
38 iso_pu_bacteria 2738541280 2738740675 222
39 iso_pu_bacteria 2738541300 2738844996 222
40 iso_pu_bacteria 2738543018 2739277411 222
41 iso_pu_bacteria 2738543030 2739346454 222
42 iso_pu_bacteria 2857547612 2857548504 222
43 iso_pu_bacteria 2885080285 2885084458 222
44 iso_pu_bacteria 2932410948 2932413099 222
45 iso_pu_bacteria 2932416698 2932420614 222
46 3300046492 Ga0495585_0055021 Ga0495585_0055021_390_1064 224
47 3300046500 Ga0495596_0001129 Ga0495596_0001129_12780_13454 224
48 3300046518 Ga0495631_0031717 Ga0495631_0031717_956_1630 224
49 3300046684 Ga0495669_0000086 Ga0495669_0000086_56009_56683 224
50 3300048091 Ga0495626_0017384 Ga0495626_0017384_2905_3579 224
51 3300003771 Ga0055526_1002427 Ga0055526_100242710 225
52 3300003775 Ga0055524_1002235 Ga0055524_10022359 225
53 3300003784 Ga0055534_1013978 Ga0055534_10139781 225
54 3300003791 Ga0055530_10000822 Ga0055530_1000082212 225
55 3300003794 Ga0055531_10018890 Ga0055531_100188902 225
56 3300017792 Ga0163161_10418096 Ga0163161_104180962 225
57 3300046457 Ga0495590_0013570 Ga0495590_0013570_407_1084 225
58 3300046501 Ga0495607_0072127 Ga0495607_0072127_729_1406 225
59 3300046519 Ga0495632_0079324 Ga0495632_0079324_767_1444 225
60 3300046520 Ga0495637_0023352 Ga0495637_0023352_1257_1934 225
61 3300046810 Ga0495660_0002304 Ga0495660_0002304_10625_11302 225
62 3300047323 Ga0495683_0005993 Ga0495683_0005993_736_1413 225
63 3300048917 Ga0496114_0011570 Ga0496114_0011570_2328_3005 225
64 3300048924 Ga0496121_0016446 Ga0496121_0016446_5889_6566 225
65 3300048928 Ga0496125_0000464 Ga0496125_0000464_5143_5820 225
66 3300053117 Ga0500593_000750 Ga0500593_000750_6002_6679 225
67 3300002738 JGI25154J39366_1001900 JGI25154J39366_10019001 226
68 3300002741 JGI25157J39369_1000029 JGI25157J39369_100002920 226
69 3300002772 JGI25164J39214_1009783 JGI25164J39214_10097831 226
70 3300002773 JGI25152J39213_1002944 JGI25152J39213_10029446 226
71 3300002773 JGI25152J39213_1004558 JGI25152J39213_10045583 226
72 3300002774 JGI25150J39212_1001466 JGI25150J39212_10014667 226
73 3300002774 JGI25150J39212_1002854 JGI25150J39212_10028543 226
74 3300002774 JGI25150J39212_1022920 JGI25150J39212_10229202 226
75 3300003187 JGI25151J46595_10010303 JGI25151J46595_100103033 226
76 3300003215 JGI25153J46596_10001462 JGI25153J46596_100014627 226
77 3300003215 JGI25153J46596_10007283 JGI25153J46596_100072832 226
78 3300003320 rootH2_10101000 rootH2_101010005 226
79 3300003323 rootH1_10030643 rootH1_100306437 226
80 3300003354 JGI25160J50197_1003173 JGI25160J50197_10031735 226
81 3300003374 JGI25161J50226_1004175 JGI25161J50226_10041751 226
82 3300003752 Ga0055539_1001221 Ga0055539_10012212 226
83 3300003771 Ga0055526_1001707 Ga0055526_100170714 226
84 3300003771 Ga0055526_1007604 Ga0055526_10076043 226
85 3300003773 Ga0055537_1002413 Ga0055537_10024136 226
86 3300003775 Ga0055524_1000026 Ga0055524_100002677 226
87 3300003775 Ga0055524_1001218 Ga0055524_100121813 226
88 3300003775 Ga0055524_1002218 Ga0055524_10022189 226
89 3300003784 Ga0055534_1002491 Ga0055534_10024915 226
90 3300003791 Ga0055530_10009172 Ga0055530_100091722 226
91 3300003791 Ga0055530_10009258 Ga0055530_100092582 226
92 3300003794 Ga0055531_10005241 Ga0055531_100052412 226
93 3300004625 Ga0055543_1000852 Ga0055543_10008523 226
94 3300005262 Ga0065165_1002610 Ga0065165_10026103 226
95 3300005262 Ga0065165_1021113 Ga0065165_10211133 226
96 3300005293 Ga0065715_10025127 Ga0065715_100251272 226
97 3300005327 Ga0070658_10030629 Ga0070658_100306294 226
98 3300005344 Ga0070661_100156039 Ga0070661_1001560392 226
99 3300005455 Ga0070663_100154365 Ga0070663_1001543652 226
100 3300005539 Ga0068853_100143870 Ga0068853_1001438702 226
101 3300005577 Ga0068857_100000950 Ga0068857_1000009508 226
102 3300005578 Ga0068854_100271134 Ga0068854_1002711342 226
103 3300005614 Ga0068856_100001671 Ga0068856_10000167111 226
104 3300006948 Ga0099826_10000003 Ga0099826_10000003986 226
105 3300009093 Ga0105240_10602226 Ga0105240_106022262 226
106 3300009148 Ga0105243_10002291 Ga0105243_100022916 226
107 3300010375 Ga0105239_10017313 Ga0105239_100173138 226
108 3300013102 Ga0157371_10000001 Ga0157371_10000001240 226
109 3300013306 Ga0163162_10338827 Ga0163162_103388272 226
110 3300014497 Ga0182008_10000139 Ga0182008_100001395 226
111 3300014497 Ga0182008_10168082 Ga0182008_101680821 226
112 3300014745 Ga0157377_10000036 Ga0157377_1000003654 226
113 3300014968 Ga0157379_10000268 Ga0157379_1000026815 226
114 3300015261 Ga0182006_1000010 Ga0182006_1000010314 226
115 3300015262 Ga0182007_10000021 Ga0182007_10000021103 226
116 3300015265 Ga0182005_1000009 Ga0182005_100000969 226
117 3300017792 Ga0163161_10088842 Ga0163161_100888423 226
118 3300025208 Ga0209436_101589 Ga0209436_1015893 226
119 3300025208 Ga0209436_103504 Ga0209436_1035043 226
120 3300025231 Ga0207427_100623 Ga0207427_1006236 226
121 3300025242 Ga0209258_101004 Ga0209258_1010048 226
122 3300025245 Ga0207425_1000006 Ga0207425_1000006687 226
123 3300025245 Ga0207425_1000396 Ga0207425_100039613 226
124 3300025246 Ga0209646_1000111 Ga0209646_100011162 226
125 3300025250 Ga0209026_1000054 Ga0209026_1000054165 226
126 3300025253 Ga0209677_100164 Ga0209677_10016410 226
127 3300025256 Ga0209759_1000043 Ga0209759_100004362 226
128 3300025258 Ga0209129_1000009 Ga0209129_1000009516 226
129 3300025258 Ga0209129_1001376 Ga0209129_10013762 226
130 3300025263 Ga0209565_1000163 Ga0209565_100016340 226
131 3300025263 Ga0209565_1000685 Ga0209565_100068512 226
132 3300025263 Ga0209565_1001484 Ga0209565_10014845 226
133 3300025263 Ga0209565_1005101 Ga0209565_10051013 226
134 3300025263 Ga0209565_1014677 Ga0209565_10146772 226
135 3300025284 Ga0209130_1001402 Ga0209130_100140216 226
136 3300025291 Ga0209675_1000292 Ga0209675_10002926 226
137 3300025291 Ga0209675_1002792 Ga0209675_10027928 226
138 3300025291 Ga0209675_1007076 Ga0209675_10070765 226
139 3300025291 Ga0209675_1022195 Ga0209675_10221952 226
140 3300025294 Ga0209025_1000732 Ga0209025_100073216 226
141 3300025295 Ga0209564_1000098 Ga0209564_1000098104 226
142 3300025295 Ga0209564_1001712 Ga0209564_10017129 226
143 3300025295 Ga0209564_1031338 Ga0209564_10313383 226
144 3300025297 Ga0209758_1000071 Ga0209758_1000071180 226
145 3300025298 Ga0209050_1000183 Ga0209050_100018338 226
146 3300025298 Ga0209050_1000731 Ga0209050_100073112 226
147 3300025298 Ga0209050_1001417 Ga0209050_100141714 226
148 3300025299 Ga0209256_1000013 Ga0209256_1000013579 226
149 3300025299 Ga0209256_1000499 Ga0209256_100049938 226
150 3300025299 Ga0209256_1001140 Ga0209256_100114023 226
151 3300025299 Ga0209256_1003334 Ga0209256_10033349 226
152 3300025302 Ga0207426_1001892 Ga0207426_10018927 226
153 3300025303 Ga0209051_1046824 Ga0209051_10468242 226
154 3300025304 Ga0209257_1000010 Ga0209257_1000010103 226
155 3300025920 Ga0207649_10148252 Ga0207649_101482522 226
156 3300025935 Ga0207709_10001511 Ga0207709_100015116 226
157 3300025949 Ga0207667_10064867 Ga0207667_100648673 226
158 3300026067 Ga0207678_10273716 Ga0207678_102737162 226
159 3300026078 Ga0207702_10005145 Ga0207702_1000514511 226
160 3300026116 Ga0207674_10005042 Ga0207674_100050428 226
161 3300026121 Ga0207683_10300205 Ga0207683_103002051 226
162 3300026142 Ga0207698_10001921 Ga0207698_1000192110 226
163 3300027666 Ga0209282_1000002 Ga0209282_100000222 226
164 3300030521 Ga0307511_10064839 Ga0307511_100648392 226
165 3300030731 Ga0316177_1114841 Ga0316177_11148411 226
166 3300030736 Ga0316180_1098216 Ga0316180_10982162 226
167 3300030745 Ga0316182_1450463 Ga0316182_14504632 226
168 3300031238 Ga0265332_10000010 Ga0265332_10000010160 226
169 3300031548 Ga0307408_100000232 Ga0307408_10000023213 226
170 3300031548 Ga0307408_100000703 Ga0307408_10000070312 226
171 3300031548 Ga0307408_100002923 Ga0307408_10000292310 226
172 3300031548 Ga0307408_100038174 Ga0307408_1000381742 226
173 3300031838 Ga0307518_10019136 Ga0307518_100191368 226
174 3300031911 Ga0307412_10049772 Ga0307412_100497724 226
175 3300032002 Ga0307416_100002440 Ga0307416_1000024409 226
176 3300032002 Ga0307416_100168636 Ga0307416_1001686362 226
177 3300033180 Ga0307510_10234655 Ga0307510_102346552 226
178 3300035086 Ga0373934_0070025 Ga0373934_0070025_460_1140 226
179 3300037471 Ga0395905_0268280 Ga0395905_0268280_532_1212 226
180 3300041459 Ga0451800_1171059 Ga0451800_1171059_1676_2356 226
181 3300042011 Ga0439454_027415 Ga0439454_027415_57_737 226
182 3300042139 Ga0450904_000039 Ga0450904_000039_5347_6027 226
183 3300044765 Ga0466970_0175752 Ga0466970_0175752_468_1148 226
184 3300046452 Ga0495617_004135 Ga0495617_004135_644_1324 226
185 3300046452 Ga0495617_015012 Ga0495617_015012_78_758 226
186 3300046460 Ga0495638_0042363 Ga0495638_0042363_1584_2276 226
187 3300046460 Ga0495638_0068951 Ga0495638_0068951_1322_2002 226
188 3300046471 Ga0495650_0005195 Ga0495650_0005195_1670_2350 226
189 3300046471 Ga0495650_0080446 Ga0495650_0080446_61_741 226
190 3300046474 Ga0495605_0010777 Ga0495605_0010777_16_696 226
191 3300046474 Ga0495605_0179263 Ga0495605_0179263_54_734 226
192 3300046491 Ga0495584_0000881 Ga0495584_0000881_5037_5717 226
193 3300046491 Ga0495584_0090553 Ga0495584_0090553_532_1212 226
194 3300046491 Ga0495584_0133360 Ga0495584_0133360_353_1033 226
195 3300046500 Ga0495596_0048990 Ga0495596_0048990_579_1259 226
196 3300046501 Ga0495607_0113929 Ga0495607_0113929_732_1412 226
197 3300046501 Ga0495607_0234607 Ga0495607_0234607_53_733 226
198 3300046506 Ga0495583_0000004 Ga0495583_0000004_592513_593193 226
199 3300046506 Ga0495583_0000853 Ga0495583_0000853_1788_2480 226
200 3300046506 Ga0495583_0010649 Ga0495583_0010649_4515_5195 226
201 3300046507 Ga0495606_0000043 Ga0495606_0000043_179650_180330 226
202 3300046507 Ga0495606_0024706 Ga0495606_0024706_3537_4217 226
203 3300046507 Ga0495606_0048940 Ga0495606_0048940_333_1013 226
204 3300046512 Ga0495610_0000411 Ga0495610_0000411_1643_2323 226
205 3300046513 Ga0495616_0059498 Ga0495616_0059498_367_1047 226
206 3300046513 Ga0495616_0085083 Ga0495616_0085083_459_1139 226
207 3300046513 Ga0495616_0172731 Ga0495616_0172731_122_802 226
208 3300046518 Ga0495631_0020946 Ga0495631_0020946_230_910 226
209 3300046519 Ga0495632_0183600 Ga0495632_0183600_141_821 226
210 3300046520 Ga0495637_0000293 Ga0495637_0000293_31528_32208 226
211 3300046522 Ga0495643_0000449 Ga0495643_0000449_50861_51553 226
212 3300046523 Ga0495644_0018939 Ga0495644_0018939_180_860 226
213 3300046524 Ga0495648_0001014 Ga0495648_0001014_3121_3801 226
214 3300046524 Ga0495648_0035445 Ga0495648_0035445_837_1517 226
215 3300046528 Ga0495642_0127741 Ga0495642_0127741_218_898 226
216 3300046530 Ga0495654_0000014 Ga0495654_0000014_6734_7414 226
217 3300046530 Ga0495654_0076348 Ga0495654_0076348_434_1114 226
218 3300046530 Ga0495654_0094579 Ga0495654_0094579_568_1248 226
219 3300046538 Ga0495609_0001810 Ga0495609_0001810_5116_5796 226
220 3300046538 Ga0495609_0080940 Ga0495609_0080940_103_783 226
221 3300046542 Ga0495597_0027869 Ga0495597_0027869_1036_1716 226
222 3300046542 Ga0495597_0092281 Ga0495597_0092281_573_1253 226
223 3300046542 Ga0495597_0132863 Ga0495597_0132863_41_721 226
224 3300046557 Ga0495622_0023325 Ga0495622_0023325_1148_1828 226
225 3300046557 Ga0495622_0040134 Ga0495622_0040134_457_1137 226
226 3300046558 Ga0495633_0000073 Ga0495633_0000073_110689_111369 226
227 3300046558 Ga0495633_0002477 Ga0495633_0002477_979_1659 226
228 3300046558 Ga0495633_0035231 Ga0495633_0035231_950_1630 226
229 3300046558 Ga0495633_0092242 Ga0495633_0092242_212_892 226
230 3300046616 Ga0495668_0187195 Ga0495668_0187195_196_876 226
231 3300046648 Ga0495611_0006094 Ga0495611_0006094_542_1222 226
232 3300046660 Ga0495625_0012857 Ga0495625_0012857_5046_5726 226
233 3300046660 Ga0495625_0013884 Ga0495625_0013884_410_1090 226
234 3300046664 Ga0495659_0000007 Ga0495659_0000007_4024_4704 226
235 3300046664 Ga0495659_0010075 Ga0495659_0010075_1380_2060 226
236 3300046664 Ga0495659_0016373 Ga0495659_0016373_1748_2428 226
237 3300046665 Ga0495661_0024185 Ga0495661_0024185_1508_2188 226
238 3300046665 Ga0495661_0217544 Ga0495661_0217544_25_705 226
239 3300046665 Ga0495661_0300007 Ga0495661_0300007_28_708 226
240 3300046691 Ga0495670_0002113 Ga0495670_0002113_8359_9039 226
241 3300046691 Ga0495670_0042752 Ga0495670_0042752_1495_2175 226
242 3300046692 Ga0495671_0000234 Ga0495671_0000234_37193_37873 226
243 3300046692 Ga0495671_0009033 Ga0495671_0009033_283_963 226
244 3300046794 Ga0495589_0022444 Ga0495589_0022444_537_1217 226
245 3300046810 Ga0495660_0003861 Ga0495660_0003861_3550_4230 226
246 3300046810 Ga0495660_0037696 Ga0495660_0037696_231_911 226
247 3300047318 Ga0495636_0002555 Ga0495636_0002555_989_1669 226
248 3300047320 Ga0495672_0000013 Ga0495672_0000013_390406_391086 226
249 3300047320 Ga0495672_0000014 Ga0495672_0000014_107385_108065 226
250 3300047320 Ga0495672_0020123 Ga0495672_0020123_3645_4325 226
251 3300047320 Ga0495672_0020712 Ga0495672_0020712_48_728 226
252 3300047320 Ga0495672_0021376 Ga0495672_0021376_3281_3961 226
253 3300047320 Ga0495672_0172158 Ga0495672_0172158_14_694 226
254 3300047320 Ga0495672_0189171 Ga0495672_0189171_276_956 226
255 3300047443 Ga0495687_000853 Ga0495687_000853_7499_8179 226
256 3300047445 Ga0495677_0002935 Ga0495677_0002935_5169_5849 226
257 3300047445 Ga0495677_0012512 Ga0495677_0012512_2112_2792 226
258 3300047446 Ga0495679_013823 Ga0495679_013823_138_818 226
259 3300047447 Ga0495685_013115 Ga0495685_013115_840_1520 226
260 3300047447 Ga0495685_023650 Ga0495685_023650_836_1516 226
261 3300047469 Ga0495673_0046486 Ga0495673_0046486_379_1059 226
262 3300047470 Ga0495681_0020387 Ga0495681_0020387_2394_3074 226
263 3300047472 Ga0495686_0001449 Ga0495686_0001449_9754_10434 226
264 3300047472 Ga0495686_0002840 Ga0495686_0002840_11566_12246 226
265 3300048091 Ga0495626_0011456 Ga0495626_0011456_898_1578 226
266 3300048091 Ga0495626_0015795 Ga0495626_0015795_742_1422 226
267 3300048091 Ga0495626_0019582 Ga0495626_0019582_161_841 226
268 3300048091 Ga0495626_0037941 Ga0495626_0037941_1558_2238 226
269 3300048904 Ga0496101_0005412 Ga0496101_0005412_3400_4080 226
270 3300048905 Ga0496102_0000470 Ga0496102_0000470_38842_39522 226
271 3300048905 Ga0496102_0140841 Ga0496102_0140841_558_1238 226
272 3300048906 Ga0496103_0017062 Ga0496103_0017062_3239_3919 226
273 3300048906 Ga0496103_0108175 Ga0496103_0108175_528_1208 226
274 3300048920 Ga0496117_0000010 Ga0496117_0000010_527134_527814 226
275 3300048921 Ga0496118_0000009 Ga0496118_0000009_84141_84821 226
276 3300048924 Ga0496121_0007758 Ga0496121_0007758_6403_7083 226
277 3300048924 Ga0496121_0322097 Ga0496121_0322097_250_930 226
278 3300048925 Ga0496122_0006555 Ga0496122_0006555_9017_9697 226
279 3300048926 Ga0496123_0007817 Ga0496123_0007817_4188_4868 226
280 3300048927 Ga0496124_0052507 Ga0496124_0052507_739_1419 226
281 3300049459 Ga0495678_001203 Ga0495678_001203_10283_10963 226
282 3300049459 Ga0495678_009055 Ga0495678_009055_353_1033 226
283 3300049459 Ga0495678_012885 Ga0495678_012885_2798_3478 226
284 3300049459 Ga0495678_088098 Ga0495678_088098_156_836 226
285 3300049460 Ga0495682_0000768 Ga0495682_0000768_9691_10371 226
286 3300049460 Ga0495682_0001749 Ga0495682_0001749_63_743 226
287 3300049460 Ga0495682_0067606 Ga0495682_0067606_590_1270 226
288 3300049515 Ga0501292_008267 Ga0501292_008267_111_791 226
289 3300049579 Ga0501043_0000012 Ga0501043_0000012_99671_100351 226
290 3300049580 Ga0501046_0000030 Ga0501046_0000030_99643_100323 226
291 3300049581 Ga0501047_0000049 Ga0501047_0000049_74340_75020 226
292 3300049582 Ga0501048_0000082 Ga0501048_0000082_30000_30680 226
293 3300049654 Ga0501207_006670 Ga0501207_006670_189_881 226
294 3300049665 Ga0501227_001287 Ga0501227_001287_343_1023 226
295 3300049671 Ga0501238_000212 Ga0501238_000212_1884_2564 226
296 3300049686 Ga0501257_028432 Ga0501257_028432_421_1101 226
297 3300049707 Ga0501234_014409 Ga0501234_014409_388_1080 226
298 3300049707 Ga0501234_033023 Ga0501234_033023_144_824 226
299 3300049775 Ga0501279_001966 Ga0501279_001966_304_984 226
300 3300049775 Ga0501279_002574 Ga0501279_002574_1425_2117 226
301 3300049775 Ga0501279_005012 Ga0501279_005012_260_940 226
302 3300049823 Ga0501044_0481482 Ga0501044_0481482_86_766 226
303 3300050493 nmdc:mga0k408_21905_c1 nmdc:mga0k408_21905_c1_409_1089 226
304 3300053080 Ga0500635_0000017 Ga0500635_0000017_709_1389 226
305 3300053086 Ga0500578_0000028 Ga0500578_0000028_11707_12387 226
306 3300053157 Ga0500624_008682 Ga0500624_008682_498_1178 226
307 3300053177 Ga0500636_0010154 Ga0500636_0010154_593_1273 226
308 3300053730 Ga0500645_002572 Ga0500645_002572_2387_3067 226
309 3300055283 Ga0500661_002431 Ga0500661_002431_2440_3120 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18331

PKHD_C

PKHD-type hydroxylase C-terminal domain

182

224

0.99

PF13640

2OG-FeII_Oxy_3

2OG-Fe(II) oxygenase superfamily

82

176

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dkq-assembly1.cif.gz_B-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9736 2 226
3dkq-assembly1.cif.gz_C-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9643 1 226
6nye-assembly1.cif.gz_B crystal structure of computationally designed protein xax 0.9608 184 223
3dkq-assembly1.cif.gz_A-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9469 1 226
3dkq-assembly1.cif.gz_C-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9388 1 226
ID Description Score Start End Superfamily
3dkqC01 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.9668 2 178 2.60.120.620
3dkqA02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9452 180 226 4.10.860.20
3dkqC02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9373 180 226 4.10.860.20
3dkqC01 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.9333 2 178 2.60.120.620
3dkqA02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9262 180 226 4.10.860.20
ID Description Score Start End GO Terms
AF-A0A1F8U6U9-F1-model_v4 Fe2+-dependent dioxygenase 0.9911 40 226 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418
AF-A0A840FY28-F1-model_v4 PKHD-type hydroxylase (EC 1.14.11.-) 0.9889 2 226 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418
AF-A0A855HGU6-F1-model_v4 deleted 0.9868 1 171
AF-A0A1H8NHS7-F1-model_v4 PKHD-type hydroxylase 0.9862 1 200 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418
AF-A0A7J7AXL6-F1-model_v4 deleted 0.9862 1 178

Feature Viewer

pLDDT pTM Quality
95.05 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map