F400293

General Info

Members Datasets Scaffolds Average Seq Length
309 204 618 131

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0037005|Ga0373943_0037005_1545_1982
Length 145
Sequence VPDHPGSAGSPDFPGFAVARAGAILAVSDFAASLRFYRDQLGLTEVALYDDPPYVTLTAAGARISLAEQGHPAPDRPGVAMAAPGDPARANVVLVLEVPDADLARKVLESRGVRFLAETYRPPWGGSRFFCVDPDGYLVEIEQPA

Samples

Sample ID Description Type Environment
1 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
72 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 5.83
Rhizosphere 91.91
Stem 0
Stem Tuber 0
Unclassified 11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373943_0037005 3300035170 Bacteria 2341
2 Ga0070683_100000957 3300005329 Bacteria 21480
3 Ga0070666_10098882 3300005335 Bacteria 2009
4 Ga0070680_100242393 3300005336 Bacteria 1524
5 Ga0070680_100373865 3300005336 Bacteria 1213
6 Ga0070682_100171557 3300005337 Bacteria 1508
7 Ga0068868_100360509 3300005338 Bacteria 1247
8 Ga0070691_10084282 3300005341 Bacteria 1560
9 Ga0070687_100035471 3300005343 Bacteria 2477
10 Ga0070671_100087132 3300005355 Bacteria 2613
11 Ga0070674_100047949 3300005356 Bacteria 2930
12 Ga0070667_100042488 3300005367 Bacteria 3814
13 Ga0070709_10001972 3300005434 Bacteria 11184
14 Ga0070709_10116976 3300005434 Unclassified 1801
15 Ga0070709_11731428 3300005434 Unclassified 511
16 Ga0070714_100006399 3300005435 Bacteria 9093
17 Ga0070714_100014388 3300005435 Bacteria 6356
18 Ga0070714_101683089 3300005435 Bacteria 620
19 Ga0070713_100002954 3300005436 Bacteria 11155
20 Ga0070713_100004724 3300005436 Bacteria 9208
21 Ga0070710_10001066 3300005437 Bacteria 12991
22 Ga0070710_10160038 3300005437 Unclassified 1395
23 Ga0070711_100002783 3300005439 Bacteria 10024
24 Ga0070711_100091448 3300005439 Bacteria 2193
25 Ga0070711_100487301 3300005439 Unclassified 1014
26 Ga0070711_100965555 3300005439 Bacteria 730
27 Ga0070705_100032623 3300005440 Bacteria 2895
28 Ga0070708_100940744 3300005445 Bacteria 811
29 Ga0070663_100107105 3300005455 Bacteria 2095
30 Ga0070678_100009646 3300005456 Bacteria 5862
31 Ga0070662_100467262 3300005457 Bacteria 1049
32 Ga0070681_10008270 3300005458 Bacteria 10184
33 Ga0068867_100170551 3300005459 Bacteria 1723
34 Ga0070706_100154954 3300005467 Bacteria 2139
35 Ga0070707_100152785 3300005468 Bacteria 2248
36 Ga0070699_100046549 3300005518 Bacteria 3753
37 Ga0070679_100192001 3300005530 Bacteria 2011
38 Ga0070684_100004936 3300005535 Bacteria 10179
39 Ga0070697_101321799 3300005536 Bacteria 643
40 Ga0070686_100018488 3300005544 Bacteria 4091
41 Ga0070696_100521522 3300005546 Bacteria 948
42 Ga0070665_100320168 3300005548 Bacteria 1555
43 Ga0070704_100048020 3300005549 Bacteria 2986
44 Ga0068856_100121392 3300005614 Bacteria 2615
45 Ga0070702_100002307 3300005615 Bacteria 8180
46 Ga0068861_100188134 3300005719 Bacteria 1724
47 Ga0068861_100995314 3300005719 Bacteria 800
48 Ga0068863_100429534 3300005841 Bacteria 1295
49 Ga0081455_10064435 3300005937 Bacteria 3068
50 Ga0070717_10004816 3300006028 Bacteria 9815
51 Ga0070717_10050866 3300006028 Bacteria 3408
52 Ga0070717_11399611 3300006028 Bacteria 635
53 Ga0070715_10042832 3300006163 Bacteria 1905
54 Ga0070715_10142377 3300006163 Bacteria 1166
55 Ga0070716_100002893 3300006173 Bacteria 7999
56 Ga0070716_100040467 3300006173 Bacteria 2593
57 Ga0070716_100439896 3300006173 Unclassified 948
58 Ga0070712_100006796 3300006175 Bacteria 7118
59 Ga0070712_100849060 3300006175 Bacteria 785
60 Ga0070712_101167138 3300006175 Unclassified 669
61 Ga0097621_100043095 3300006237 Bacteria 3638
62 Ga0068871_100006510 3300006358 Bacteria 8273
63 Ga0075431_101412610 3300006847 Bacteria 655
64 Ga0075434_100000203 3300006871 Bacteria 40085
65 Ga0075434_101355748 3300006871 Bacteria 722
66 Ga0068865_100072507 3300006881 Bacteria 2447
67 Ga0075436_100032149 3300006914 Bacteria 3616
68 Ga0075436_100144730 3300006914 Bacteria 1671
69 Ga0075435_100008338 3300007076 Bacteria 7427
70 Ga0105245_10015474 3300009098 Bacteria 6652
71 Ga0105247_10007241 3300009101 Bacteria 6812
72 Ga0114129_10308918 3300009147 Bacteria 2105
73 Ga0105243_10023729 3300009148 Bacteria 4675
74 Ga0105243_10453386 3300009148 Bacteria 1204
75 Ga0105241_10022690 3300009174 Bacteria 4651
76 Ga0105242_10069686 3300009176 Bacteria 2913
77 Ga0105248_10030951 3300009177 Bacteria 5978
78 Ga0105239_10440056 3300010375 Bacteria 1478
79 Ga0105246_10148906 3300011119 Bacteria 1769
80 Ga0157373_10058673 3300013100 Bacteria 2728
81 Ga0157369_10025081 3300013105 Bacteria 6622
82 Ga0157369_11512188 3300013105 Bacteria 683
83 Ga0157378_10010162 3300013297 Bacteria 8209
84 Ga0157375_10154558 3300013308 Bacteria 2432
85 Ga0157380_10137370 3300014326 Bacteria 2094
86 Ga0157380_12315552 3300014326 Bacteria 602
87 Ga0157379_10003546 3300014968 Bacteria 13218
88 Ga0157376_10034123 3300014969 Bacteria 4105
89 Ga0163161_10364807 3300017792 Bacteria 1151
90 Ga0206356_10054950 3300020070 Bacteria 1912
91 Ga0206354_11644656 3300020081 Bacteria 3199
92 Ga0206353_10382384 3300020082 Bacteria 2206
93 Ga0213875_10001983 3300021388 Bacteria 12658
94 Ga0213875_10208218 3300021388 Unclassified 920
95 Ga0224572_1011566 3300024225 Bacteria 1670
96 Ga0228598_1025621 3300024227 Bacteria 1161
97 Ga0207692_10001587 3300025898 Bacteria 8560
98 Ga0207642_10245413 3300025899 Bacteria 1013
99 Ga0207710_10286447 3300025900 Bacteria 830
100 Ga0207685_10009208 3300025905 Bacteria 2858
101 Ga0207685_10148952 3300025905 Bacteria 1057
102 Ga0207699_10001609 3300025906 Bacteria 10719
103 Ga0207699_10088833 3300025906 Bacteria 1935
104 Ga0207699_10103472 3300025906 Unclassified 1811
105 Ga0207699_11161940 3300025906 Unclassified 572
106 Ga0207684_10734652 3300025910 Archaea 837
107 Ga0207654_10051001 3300025911 Bacteria 2380
108 Ga0207707_10004298 3300025912 Bacteria 12617
109 Ga0207707_10244160 3300025912 Bacteria 1561
110 Ga0207693_10011591 3300025915 Bacteria 7132
111 Ga0207663_10002619 3300025916 Bacteria 8662
112 Ga0207663_10086523 3300025916 Bacteria 2067
113 Ga0207663_11275735 3300025916 Bacteria 592
114 Ga0207662_10039150 3300025918 Bacteria 2780
115 Ga0207652_10337497 3300025921 Bacteria 1360
116 Ga0207646_10184104 3300025922 Bacteria 1886
117 Ga0207646_10384484 3300025922 Bacteria 1268
118 Ga0207687_10344253 3300025927 Bacteria 1213
119 Ga0207700_10001249 3300025928 Bacteria 14483
120 Ga0207700_10002881 3300025928 Bacteria 9910
121 Ga0207664_10004642 3300025929 Bacteria 9322
122 Ga0207664_10010911 3300025929 Bacteria 6435
123 Ga0207664_10535479 3300025929 Bacteria 1050
124 Ga0207644_10289066 3300025931 Bacteria 1318
125 Ga0207686_10045346 3300025934 Bacteria 2704
126 Ga0207709_10069710 3300025935 Bacteria 2227
127 Ga0207669_10156907 3300025937 Bacteria 1602
128 Ga0207704_10298379 3300025938 Bacteria 1233
129 Ga0207704_10363898 3300025938 Bacteria 1130
130 Ga0207665_10006087 3300025939 Bacteria 8011
131 Ga0207665_10258691 3300025939 Bacteria 1289
132 Ga0207665_10620429 3300025939 Bacteria 846
133 Ga0207711_10013409 3300025941 Bacteria 6809
134 Ga0207661_10025704 3300025944 Bacteria 4479
135 Ga0207658_10393835 3300025986 Bacteria 1216
136 Ga0207677_10298007 3300026023 Bacteria 1331
137 Ga0207702_10137456 3300026078 Bacteria 2207
138 Ga0207641_10383910 3300026088 Bacteria 1346
139 Ga0207648_10055553 3300026089 Bacteria 3456
140 Ga0207675_100495562 3300026118 Bacteria 1216
141 Ga0207683_10000159 3300026121 Bacteria 57009
142 Ga0268266_10523771 3300028379 Bacteria 1134
143 Ga0265319_1044739 3300028563 Bacteria 1483
144 Ga0265338_10201265 3300028800 Bacteria 1502
145 Ga0265320_10494640 3300031240 Bacteria 540
146 Ga0265314_10425247 3300031711 Bacteria 713
147 Ga0373944_0208498 3300035089 Bacteria 710
148 Ga0373923_0027473 3300035111 Bacteria 2271
149 Ga0373936_0024308 3300035113 Bacteria 2364
150 Ga0373936_0170866 3300035113 Unclassified 950
151 Ga0373954_0184656 3300035118 Bacteria 1023
152 Ga0373957_0017154 3300035120 Bacteria 2517
153 Ga0373943_0007538 3300035170 Bacteria 4887
154 Ga0373943_0260092 3300035170 Bacteria 977
155 Ga0373955_0276565 3300035172 Bacteria 1010
156 Ga0373955_0720970 3300035172 Bacteria 612
157 Ga0316574_0120319 3300035398 Unclassified 1686
158 Ga0373924_0481193 3300035410 Unclassified 557
159 Ga0373931_0575798 3300035691 Bacteria 734
160 Ga0373935_0709036 3300035692 Bacteria 740
161 Ga0373927_0094448 3300035695 Bacteria 1943
162 Ga0373933_0117356 3300035724 Unclassified 1664
163 Ga0373933_0438710 3300035724 Bacteria 854
164 Ga0373947_0002027 3300035725 Bacteria 12367
165 Ga0373947_0338851 3300035725 Bacteria 1007
166 Ga0373925_0002946 3300037068 Bacteria 13432
167 Ga0373925_0052647 3300037068 Bacteria 3042
168 Ga0373925_0405684 3300037068 Unclassified 1112
169 Ga0373925_0457791 3300037068 Bacteria 1045
170 Ga0395900_0223802 3300037418 Bacteria 1895
171 Ga0395898_0105722 3300037466 Bacteria 2699
172 Ga0395898_0919625 3300037466 Bacteria 812
173 Ga0436364_0266285 3300037853 Bacteria 532
174 Ga0436364_0833426 3300037853 Bacteria 26251
175 Ga0436364_1241158 3300037853 Unclassified 1402
176 Ga0395901_0092520 3300038443 Bacteria 3165
177 Ga0395901_0165378 3300038443 Bacteria 2323
178 Ga0395901_0317264 3300038443 Bacteria 1613
179 Ga0451837_0757120 3300041494 Bacteria 917
180 Ga0466968_0029548 3300044735 Bacteria 2267
181 Ga0466960_0002891 3300044901 Bacteria 6525
182 Ga0466959_0623996 3300045049 Bacteria 724
183 Ga0451576_1011191 3300045051 Bacteria 871
184 Ga0466958_0759151 3300045836 Bacteria 632
185 Ga0466967_1000625 3300045976 Unclassified 832
186 Ga0466967_1216204 3300045976 Bacteria 751
187 Ga0495592_0185324 3300046454 Bacteria 1414
188 Ga0495603_0024909 3300046455 Bacteria 3619
189 Ga0495629_0003298 3300046459 Bacteria 12191
190 Ga0495641_0009218 3300046461 Bacteria 5893
191 Ga0495641_0215287 3300046461 Bacteria 861
192 Ga0495651_0092947 3300046462 Unclassified 2259
193 Ga0495651_0364188 3300046462 Bacteria 952
194 Ga0495653_0400219 3300046463 Bacteria 873
195 Ga0495653_0517195 3300046463 Bacteria 742
196 Ga0495580_0178700 3300046472 Bacteria 1466
197 Ga0495582_0000548 3300046473 Bacteria 20756
198 Ga0495639_0004900 3300046475 Bacteria 5744
199 Ga0495662_0008573 3300046476 Bacteria 5023
200 Ga0495664_0915759 3300046477 Bacteria 512
201 Ga0495584_0192407 3300046491 Bacteria 1037
202 Ga0495607_0314996 3300046501 Bacteria 732
203 Ga0495608_0163580 3300046511 Bacteria 1414
204 Ga0495608_0277889 3300046511 Bacteria 1040
205 Ga0495608_0301141 3300046511 Unclassified 992
206 Ga0495618_0018136 3300046514 Bacteria 4320
207 Ga0495618_0613342 3300046514 Bacteria 646
208 Ga0495630_0006682 3300046517 Bacteria 8221
209 Ga0495630_0576903 3300046517 Unclassified 862
210 Ga0495630_0617483 3300046517 Unclassified 831
211 Ga0495630_0737014 3300046517 Bacteria 753
212 Ga0495652_0052893 3300046529 Unclassified 3462
213 Ga0495652_0086420 3300046529 Bacteria 2575
214 Ga0495652_0331952 3300046529 Unclassified 1095
215 Ga0495665_0005679 3300046531 Bacteria 6732
216 Ga0495665_0008855 3300046531 Bacteria 5462
217 Ga0495640_0084844 3300046533 Bacteria 2099
218 Ga0495640_0145976 3300046533 Bacteria 1522
219 Ga0495640_0195694 3300046533 Unclassified 1283
220 Ga0495586_0001851 3300046535 Bacteria 11515
221 Ga0495586_0304291 3300046535 Bacteria 913
222 Ga0495587_0152950 3300046536 Unclassified 1315
223 Ga0495587_0470852 3300046536 Bacteria 695
224 Ga0495587_0740433 3300046536 Bacteria 538
225 Ga0495645_0035070 3300046543 Bacteria 3658
226 Ga0495645_0137069 3300046543 Bacteria 1711
227 Ga0495667_0009533 3300046559 Bacteria 6581
228 Ga0495667_0206982 3300046559 Bacteria 1254
229 Ga0495667_0218296 3300046559 Bacteria 1217
230 Ga0495667_0687490 3300046559 Bacteria 634
231 Ga0495656_0097632 3300046615 Bacteria 1353
232 Ga0495634_0007682 3300046642 Bacteria 8071
233 Ga0495634_0018788 3300046642 Bacteria 4915
234 Ga0495611_0397621 3300046648 Bacteria 630
235 Ga0495635_0000530 3300046663 Bacteria 24241
236 Ga0495635_0054365 3300046663 Bacteria 2758
237 Ga0495635_0125229 3300046663 Bacteria 1752
238 Ga0495635_0518690 3300046663 Bacteria 783
239 Ga0495657_0167386 3300046675 Bacteria 1356
240 Ga0495657_0167889 3300046675 Unclassified 1353
241 Ga0495657_0464432 3300046675 Unclassified 740
242 Ga0495599_0345926 3300046678 Bacteria 892
243 Ga0495646_0138137 3300046680 Bacteria 1365
244 Ga0495647_0072897 3300046681 Bacteria 1378
245 Ga0495658_0000364 3300046683 Bacteria 25493
246 Ga0495658_0090762 3300046683 Bacteria 1809
247 Ga0495613_0001395 3300046689 Bacteria 18393
248 Ga0495624_0523133 3300046690 Bacteria 709
249 Ga0495600_0153206 3300046809 Bacteria 1492
250 Ga0495600_0250283 3300046809 Unclassified 1127
251 Ga0495581_0006267 3300047315 Bacteria 6895
252 Ga0495581_0794986 3300047315 Unclassified 543
253 Ga0495604_0194416 3300047317 Unclassified 1412
254 Ga0495674_0000369 3300047319 Bacteria 40089
255 Ga0495674_0129845 3300047319 Bacteria 2123
256 Ga0495674_0188092 3300047319 Bacteria 1717
257 Ga0495674_0442240 3300047319 Bacteria 1045
258 Ga0495676_0000728 3300047321 Bacteria 27424
259 Ga0495676_0009308 3300047321 Bacteria 8954
260 Ga0495676_0370006 3300047321 Bacteria 955
261 Ga0495680_0244113 3300047322 Unclassified 1274
262 Ga0495680_0474502 3300047322 Bacteria 853
263 Ga0495675_0144043 3300047444 Bacteria 1476
264 Ga0495684_0001714 3300047471 Bacteria 17650
265 Ga0495684_0099093 3300047471 Bacteria 2203
266 Ga0495684_0240892 3300047471 Bacteria 1319
267 Ga0495593_0005310 3300047673 Bacteria 7615
268 Ga0495593_0127983 3300047673 Unclassified 1290
269 Ga0495602_0338584 3300048088 Bacteria 1089
270 Ga0496100_0088509 3300048903 Bacteria 2107
271 Ga0496101_0028016 3300048904 Bacteria 3930
272 Ga0496102_0015724 3300048905 Bacteria 6593
273 Ga0496103_0034446 3300048906 Bacteria 3096
274 Ga0496104_0043799 3300048907 Bacteria 4203
275 Ga0496105_0067606 3300048908 Bacteria 2950
276 Ga0496105_1410536 3300048908 Bacteria 504
277 Ga0496106_0001300 3300048909 Bacteria 18751
278 Ga0496106_0040681 3300048909 Bacteria 3481
279 Ga0496106_0408485 3300048909 Unclassified 1091
280 Ga0496107_0009990 3300048910 Bacteria 6582
281 Ga0496107_0046933 3300048910 Bacteria 3109
282 Ga0496109_0552612 3300048912 Unclassified 1086
283 Ga0496109_0886372 3300048912 Bacteria 830
284 Ga0496112_0182921 3300048915 Bacteria 2060
285 Ga0496112_0234511 3300048915 Bacteria 1789
286 Ga0496114_0002143 3300048917 Bacteria 15005
287 Ga0496115_0093467 3300048918 Bacteria 2459
288 Ga0501036_1324199 3300049572 Bacteria 585
289 Ga0501067_0186127 3300049583 Bacteria 1156
290 Ga0501069_0157523 3300049585 Bacteria 1307
291 Ga0501074_1155886 3300049590 Bacteria 543
292 Ga0501076_0538978 3300049592 Bacteria 962
293 nmdc:mga0n895_1186403_c1 3300050512 Bacteria 738
294 nmdc:mga0n895_14511_c1 3300050512 Bacteria 7159
295 nmdc:mga0rr50_93777_c1 3300050513 Bacteria 2343
296 nmdc:mga08x19_251424_c1 3300050514 Bacteria 1220
297 nmdc:mga08x19_344471_c1 3300050514 Bacteria 1040
298 nmdc:mga08x19_352309_c1 3300050514 Bacteria 1028
299 nmdc:mga0a205_450_c1 3300050515 Bacteria 30909
300 Ga0495601_0012915 3300053077 Bacteria 5015
301 Ga0495601_0041299 3300053077 Bacteria 2890
302 Ga0495601_0913595 3300053077 Bacteria 554
303 Ga0495612_0013986 3300053078 Bacteria 3232
304 Ga0495655_0252637 3300053083 Bacteria 593
305 Ga0495619_0083476 3300053085 Bacteria 2155
306 Ga0495619_0126536 3300053085 Bacteria 1754
307 Ga0495619_0227063 3300053085 Bacteria 1293
308 Ga0500639_252989 3300053163 Unclassified 704
309 Ga0501084_0848172 3300054114 Bacteria 769
310 Ga0373943_0037005
311 Ga0070683_100000957
312 Ga0070666_10098882
313 Ga0070680_100242393
314 Ga0070680_100373865
315 Ga0070682_100171557
316 Ga0068868_100360509
317 Ga0070691_10084282
318 Ga0070687_100035471
319 Ga0070671_100087132
320 Ga0070674_100047949
321 Ga0070667_100042488
322 Ga0070709_10001972
323 Ga0070709_10116976
324 Ga0070709_11731428
325 Ga0070714_100006399
326 Ga0070714_100014388
327 Ga0070714_101683089
328 Ga0070713_100002954
329 Ga0070713_100004724
330 Ga0070710_10001066
331 Ga0070710_10160038
332 Ga0070711_100002783
333 Ga0070711_100091448
334 Ga0070711_100487301
335 Ga0070711_100965555
336 Ga0070705_100032623
337 Ga0070708_100940744
338 Ga0070663_100107105
339 Ga0070678_100009646
340 Ga0070662_100467262
341 Ga0070681_10008270
342 Ga0068867_100170551
343 Ga0070706_100154954
344 Ga0070707_100152785
345 Ga0070699_100046549
346 Ga0070679_100192001
347 Ga0070684_100004936
348 Ga0070697_101321799
349 Ga0070686_100018488
350 Ga0070696_100521522
351 Ga0070665_100320168
352 Ga0070704_100048020
353 Ga0068856_100121392
354 Ga0070702_100002307
355 Ga0068861_100188134
356 Ga0068861_100995314
357 Ga0068863_100429534
358 Ga0081455_10064435
359 Ga0070717_10004816
360 Ga0070717_10050866
361 Ga0070717_11399611
362 Ga0070715_10042832
363 Ga0070715_10142377
364 Ga0070716_100002893
365 Ga0070716_100040467
366 Ga0070716_100439896
367 Ga0070712_100006796
368 Ga0070712_100849060
369 Ga0070712_101167138
370 Ga0097621_100043095
371 Ga0068871_100006510
372 Ga0075431_101412610
373 Ga0075434_100000203
374 Ga0075434_101355748
375 Ga0068865_100072507
376 Ga0075436_100032149
377 Ga0075436_100144730
378 Ga0075435_100008338
379 Ga0105245_10015474
380 Ga0105247_10007241
381 Ga0114129_10308918
382 Ga0105243_10023729
383 Ga0105243_10453386
384 Ga0105241_10022690
385 Ga0105242_10069686
386 Ga0105248_10030951
387 Ga0105239_10440056
388 Ga0105246_10148906
389 Ga0157373_10058673
390 Ga0157369_10025081
391 Ga0157369_11512188
392 Ga0157378_10010162
393 Ga0157375_10154558
394 Ga0157380_10137370
395 Ga0157380_12315552
396 Ga0157379_10003546
397 Ga0157376_10034123
398 Ga0163161_10364807
399 Ga0206356_10054950
400 Ga0206354_11644656
401 Ga0206353_10382384
402 Ga0213875_10001983
403 Ga0213875_10208218
404 Ga0224572_1011566
405 Ga0228598_1025621
406 Ga0207692_10001587
407 Ga0207642_10245413
408 Ga0207710_10286447
409 Ga0207685_10009208
410 Ga0207685_10148952
411 Ga0207699_10001609
412 Ga0207699_10088833
413 Ga0207699_10103472
414 Ga0207699_11161940
415 Ga0207684_10734652
416 Ga0207654_10051001
417 Ga0207707_10004298
418 Ga0207707_10244160
419 Ga0207693_10011591
420 Ga0207663_10002619
421 Ga0207663_10086523
422 Ga0207663_11275735
423 Ga0207662_10039150
424 Ga0207652_10337497
425 Ga0207646_10184104
426 Ga0207646_10384484
427 Ga0207687_10344253
428 Ga0207700_10001249
429 Ga0207700_10002881
430 Ga0207664_10004642
431 Ga0207664_10010911
432 Ga0207664_10535479
433 Ga0207644_10289066
434 Ga0207686_10045346
435 Ga0207709_10069710
436 Ga0207669_10156907
437 Ga0207704_10298379
438 Ga0207704_10363898
439 Ga0207665_10006087
440 Ga0207665_10258691
441 Ga0207665_10620429
442 Ga0207711_10013409
443 Ga0207661_10025704
444 Ga0207658_10393835
445 Ga0207677_10298007
446 Ga0207702_10137456
447 Ga0207641_10383910
448 Ga0207648_10055553
449 Ga0207675_100495562
450 Ga0207683_10000159
451 Ga0268266_10523771
452 Ga0265319_1044739
453 Ga0265338_10201265
454 Ga0265320_10494640
455 Ga0265314_10425247
456 Ga0373944_0208498
457 Ga0373923_0027473
458 Ga0373936_0024308
459 Ga0373936_0170866
460 Ga0373954_0184656
461 Ga0373957_0017154
462 Ga0373943_0007538
463 Ga0373943_0260092
464 Ga0373955_0276565
465 Ga0373955_0720970
466 Ga0316574_0120319
467 Ga0373924_0481193
468 Ga0373931_0575798
469 Ga0373935_0709036
470 Ga0373927_0094448
471 Ga0373933_0117356
472 Ga0373933_0438710
473 Ga0373947_0002027
474 Ga0373947_0338851
475 Ga0373925_0002946
476 Ga0373925_0052647
477 Ga0373925_0405684
478 Ga0373925_0457791
479 Ga0395900_0223802
480 Ga0395898_0105722
481 Ga0395898_0919625
482 Ga0436364_0266285
483 Ga0436364_0833426
484 Ga0436364_1241158
485 Ga0395901_0092520
486 Ga0395901_0165378
487 Ga0395901_0317264
488 Ga0451837_0757120
489 Ga0466968_0029548
490 Ga0466960_0002891
491 Ga0466959_0623996
492 Ga0451576_1011191
493 Ga0466958_0759151
494 Ga0466967_1000625
495 Ga0466967_1216204
496 Ga0495592_0185324
497 Ga0495603_0024909
498 Ga0495629_0003298
499 Ga0495641_0009218
500 Ga0495641_0215287
501 Ga0495651_0092947
502 Ga0495651_0364188
503 Ga0495653_0400219
504 Ga0495653_0517195
505 Ga0495580_0178700
506 Ga0495582_0000548
507 Ga0495639_0004900
508 Ga0495662_0008573
509 Ga0495664_0915759
510 Ga0495584_0192407
511 Ga0495607_0314996
512 Ga0495608_0163580
513 Ga0495608_0277889
514 Ga0495608_0301141
515 Ga0495618_0018136
516 Ga0495618_0613342
517 Ga0495630_0006682
518 Ga0495630_0576903
519 Ga0495630_0617483
520 Ga0495630_0737014
521 Ga0495652_0052893
522 Ga0495652_0086420
523 Ga0495652_0331952
524 Ga0495665_0005679
525 Ga0495665_0008855
526 Ga0495640_0084844
527 Ga0495640_0145976
528 Ga0495640_0195694
529 Ga0495586_0001851
530 Ga0495586_0304291
531 Ga0495587_0152950
532 Ga0495587_0470852
533 Ga0495587_0740433
534 Ga0495645_0035070
535 Ga0495645_0137069
536 Ga0495667_0009533
537 Ga0495667_0206982
538 Ga0495667_0218296
539 Ga0495667_0687490
540 Ga0495656_0097632
541 Ga0495634_0007682
542 Ga0495634_0018788
543 Ga0495611_0397621
544 Ga0495635_0000530
545 Ga0495635_0054365
546 Ga0495635_0125229
547 Ga0495635_0518690
548 Ga0495657_0167386
549 Ga0495657_0167889
550 Ga0495657_0464432
551 Ga0495599_0345926
552 Ga0495646_0138137
553 Ga0495647_0072897
554 Ga0495658_0000364
555 Ga0495658_0090762
556 Ga0495613_0001395
557 Ga0495624_0523133
558 Ga0495600_0153206
559 Ga0495600_0250283
560 Ga0495581_0006267
561 Ga0495581_0794986
562 Ga0495604_0194416
563 Ga0495674_0000369
564 Ga0495674_0129845
565 Ga0495674_0188092
566 Ga0495674_0442240
567 Ga0495676_0000728
568 Ga0495676_0009308
569 Ga0495676_0370006
570 Ga0495680_0244113
571 Ga0495680_0474502
572 Ga0495675_0144043
573 Ga0495684_0001714
574 Ga0495684_0099093
575 Ga0495684_0240892
576 Ga0495593_0005310
577 Ga0495593_0127983
578 Ga0495602_0338584
579 Ga0496100_0088509
580 Ga0496101_0028016
581 Ga0496102_0015724
582 Ga0496103_0034446
583 Ga0496104_0043799
584 Ga0496105_0067606
585 Ga0496105_1410536
586 Ga0496106_0001300
587 Ga0496106_0040681
588 Ga0496106_0408485
589 Ga0496107_0009990
590 Ga0496107_0046933
591 Ga0496109_0552612
592 Ga0496109_0886372
593 Ga0496112_0182921
594 Ga0496112_0234511
595 Ga0496114_0002143
596 Ga0496115_0093467
597 Ga0501036_1324199
598 Ga0501067_0186127
599 Ga0501069_0157523
600 Ga0501074_1155886
601 Ga0501076_0538978
602 nmdc:mga0n895_1186403_c1
603 nmdc:mga0n895_14511_c1
604 nmdc:mga0rr50_93777_c1
605 nmdc:mga08x19_251424_c1
606 nmdc:mga08x19_344471_c1
607 nmdc:mga08x19_352309_c1
608 nmdc:mga0a205_450_c1
609 Ga0495601_0012915
610 Ga0495601_0041299
611 Ga0495601_0913595
612 Ga0495612_0013986
613 Ga0495655_0252637
614 Ga0495619_0083476
615 Ga0495619_0126536
616 Ga0495619_0227063
617 Ga0500639_252989
618 Ga0501084_0848172

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

18

141

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8585 1 129
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8567 1 129
2i7r-assembly1.cif.gz_B conserved domain protein 0.8497 3 129
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.8382 1 129
2i7r-assembly1.cif.gz_B conserved domain protein 0.8365 3 129
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9335 77 125 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9297 77 127 3.30.720.110
5cviA02 Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) 0.8875 27 51 2.30.30.90
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8773 77 129 3.30.720.110
af_C6T374_10_137_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8655 5 127 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A6J7DED7-F1-model_v4 Unannotated protein 0.9577 1 129
AF-A0A6J7DED7-F1-model_v4 Unannotated protein 0.9505 1 129
AF-A0A538CAV0-F1-model_v4 VOC domain-containing protein 0.9472 2 129
AF-A0A7G9S382-F1-model_v4 VOC family protein 0.9416 1 129
AF-A0A538H7W5-F1-model_v4 VOC family protein 0.9402 1 129

Map