F400180

General Info

Members Datasets Scaffolds Average Seq Length
309 175 618 191

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10462728|Ga0114129_104627283
Length 204
Sequence MLPHSYELPAALLLLVGGILSCFAGYRLFKITLAIYGFIFGAMMASSTMGVTNTTGMLVAALVGGIVGAAILVFAYFIGIALIGAGLGAVVAHFGWSAIRTGDPPVVAVIVLAILGAVGAMMLQRYVIIVATAFGGAWTMIVGAIALMETRGVVSAATRTSRAGDVWIMYPTTPAPGQTWVPLAWIGLGLIGTAVQLGITGRKR

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
127 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
128 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
129 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
130 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
131 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
134 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
137 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.47
Rhizosphere 93.53
Stem 0
Stem Tuber 0
Unclassified 8.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10462728 3300009147 Bacteria 1662
2 Ga0065712_10091049 3300005290 Bacteria 2393
3 Ga0065707_10021791 3300005295 Bacteria 1393
4 Ga0070658_10339992 3300005327 Bacteria 1284
5 Ga0070676_10028956 3300005328 Bacteria 3147
6 Ga0070690_100057181 3300005330 Bacteria 2503
7 Ga0070670_100151462 3300005331 Bacteria 2007
8 Ga0070670_100194562 3300005331 Bacteria 1761
9 Ga0070670_100567340 3300005331 Bacteria 1014
10 Ga0068869_100207926 3300005334 Unclassified 1546
11 Ga0070666_10006154 3300005335 Bacteria 7378
12 Ga0070680_100036932 3300005336 Bacteria 3947
13 Ga0070680_100226910 3300005336 Bacteria 1577
14 Ga0068868_100490294 3300005338 Bacteria 1075
15 Ga0068868_100534833 3300005338 Bacteria 1031
16 Ga0070660_100020483 3300005339 Bacteria 4861
17 Ga0070660_100233416 3300005339 Bacteria 1497
18 Ga0070689_100065837 3300005340 Bacteria 2823
19 Ga0070689_100268391 3300005340 Bacteria 1412
20 Ga0070689_100778752 3300005340 Bacteria 840
21 Ga0070691_10017904 3300005341 Bacteria 3261
22 Ga0070687_100133711 3300005343 Unclassified 1435
23 Ga0070668_100363638 3300005347 Bacteria 1227
24 Ga0070669_100155395 3300005353 Bacteria 1773
25 Ga0070675_100003223 3300005354 Bacteria 12362
26 Ga0070675_100163705 3300005354 Bacteria 1915
27 Ga0070674_100145664 3300005356 Bacteria 1782
28 Ga0070673_100931245 3300005364 Bacteria 807
29 Ga0070688_100189223 3300005365 Bacteria 1433
30 Ga0070688_100447534 3300005365 Bacteria 965
31 Ga0070688_100813048 3300005365 Bacteria 732
32 Ga0070688_100933613 3300005365 Bacteria 686
33 Ga0070703_10119513 3300005406 Bacteria 954
34 Ga0070701_10015198 3300005438 Bacteria 3549
35 Ga0070705_100092033 3300005440 Bacteria 1892
36 Ga0070700_100400610 3300005441 Bacteria 1032
37 Ga0070694_100006907 3300005444 Bacteria 6898
38 Ga0070694_100021436 3300005444 Bacteria 4129
39 Ga0070694_100244821 3300005444 Bacteria 1354
40 Ga0070708_100691991 3300005445 Bacteria 960
41 Ga0070678_100496511 3300005456 Bacteria 1076
42 Ga0070662_100054625 3300005457 Bacteria 2895
43 Ga0070681_10106447 3300005458 Bacteria 2746
44 Ga0070681_10133112 3300005458 Bacteria 2418
45 Ga0068867_100022772 3300005459 Bacteria 4482
46 Ga0070685_10183689 3300005466 Bacteria 1348
47 Ga0070707_100150031 3300005468 Bacteria 2270
48 Ga0070707_100278714 3300005468 Unclassified 1625
49 Ga0070707_100975026 3300005468 Bacteria 813
50 Ga0070698_100100821 3300005471 Bacteria 2860
51 Ga0070698_100128212 3300005471 Bacteria 2494
52 Ga0070698_100342799 3300005471 Bacteria 1426
53 Ga0070698_100395700 3300005471 Bacteria 1315
54 Ga0070698_100692649 3300005471 Bacteria 961
55 Ga0070698_100836640 3300005471 Bacteria 865
56 Ga0070699_100202186 3300005518 Unclassified 1767
57 Ga0070699_100268043 3300005518 Bacteria 1528
58 Ga0070699_100502979 3300005518 Bacteria 1101
59 Ga0070679_100110730 3300005530 Bacteria 2732
60 Ga0070679_100251202 3300005530 Bacteria 1725
61 Ga0070684_100676069 3300005535 Bacteria 962
62 Ga0070697_100049495 3300005536 Bacteria 3411
63 Ga0070697_100717255 3300005536 Unclassified 883
64 Ga0068853_100588637 3300005539 Bacteria 1056
65 Ga0068853_100739740 3300005539 Bacteria 940
66 Ga0070672_100291530 3300005543 Bacteria 1382
67 Ga0070672_100481484 3300005543 Bacteria 1072
68 Ga0070686_100019422 3300005544 Bacteria 4004
69 Ga0070686_100492079 3300005544 Bacteria 950
70 Ga0070695_100314221 3300005545 Bacteria 1162
71 Ga0070695_100425267 3300005545 Bacteria 1012
72 Ga0070665_100164579 3300005548 Bacteria 2220
73 Ga0070704_100027089 3300005549 Bacteria 3796
74 Ga0070704_100031294 3300005549 Bacteria 3577
75 Ga0070704_100113976 3300005549 Bacteria 2062
76 Ga0070704_100727627 3300005549 Bacteria 882
77 Ga0068855_100068396 3300005563 Bacteria 4135
78 Ga0068855_100343705 3300005563 Unclassified 1645
79 Ga0068854_100015949 3300005578 Bacteria 4995
80 Ga0068854_100076283 3300005578 Bacteria 2463
81 Ga0068852_100392312 3300005616 Unclassified 1364
82 Ga0068859_100524665 3300005617 Bacteria 1279
83 Ga0068859_100654665 3300005617 Bacteria 1142
84 Ga0068859_101224676 3300005617 Bacteria 827
85 Ga0068859_101396086 3300005617 Bacteria 772
86 Ga0068864_100058932 3300005618 Bacteria 3320
87 Ga0068861_100014767 3300005719 Bacteria 5487
88 Ga0068861_100703342 3300005719 Bacteria 939
89 Ga0068863_100222386 3300005841 Bacteria 1819
90 Ga0068863_100533717 3300005841 Bacteria 1157
91 Ga0068863_100692602 3300005841 Bacteria 1012
92 Ga0068858_100555510 3300005842 Bacteria 1112
93 Ga0068862_100098393 3300005844 Bacteria 2555
94 Ga0068862_100912817 3300005844 Bacteria 864
95 Ga0068862_101429627 3300005844 Unclassified 695
96 Ga0081539_10034901 3300005985 Bacteria 3032
97 Ga0075432_10184340 3300006058 Bacteria 818
98 Ga0070715_10082591 3300006163 Bacteria 1462
99 Ga0097621_100111462 3300006237 Bacteria 2312
100 Ga0068871_100215079 3300006358 Bacteria 1663
101 Ga0075428_100800870 3300006844 Bacteria 1001
102 Ga0075431_100129554 3300006847 Bacteria 2603
103 Ga0075433_10104570 3300006852 Bacteria 2508
104 Ga0075433_10295314 3300006852 Bacteria 1435
105 Ga0075433_10968203 3300006852 Bacteria 741
106 Ga0075434_100004883 3300006871 Bacteria 12148
107 Ga0075434_100031212 3300006871 Bacteria 5252
108 Ga0075434_100041061 3300006871 Bacteria 4582
109 Ga0075434_100052908 3300006871 Bacteria 4035
110 Ga0075434_100133301 3300006871 Bacteria 2504
111 Ga0075434_100272116 3300006871 Bacteria 1713
112 Ga0075429_100152347 3300006880 Bacteria 2024
113 Ga0068865_100723601 3300006881 Bacteria 852
114 Ga0075436_100005353 3300006914 Bacteria 8832
115 Ga0075436_100031878 3300006914 Bacteria 3631
116 Ga0075436_100104236 3300006914 Bacteria 1977
117 Ga0075436_100209232 3300006914 Bacteria 1382
118 Ga0075436_100708592 3300006914 Unclassified 746
119 Ga0097620_100524673 3300006931 Bacteria 1279
120 Ga0097620_100654610 3300006931 Bacteria 1142
121 Ga0097620_101224462 3300006931 Bacteria 827
122 Ga0097620_101395987 3300006931 Bacteria 772
123 Ga0075435_100002536 3300007076 Bacteria 12156
124 Ga0075435_100013141 3300007076 Bacteria 6150
125 Ga0075435_100026465 3300007076 Bacteria 4526
126 Ga0075435_100106701 3300007076 Bacteria 2326
127 Ga0075435_100120334 3300007076 Bacteria 2190
128 Ga0099794_10074863 3300007265 Bacteria 1663
129 Ga0099795_10293702 3300007788 Bacteria 713
130 Ga0105240_10138519 3300009093 Bacteria 2912
131 Ga0105240_10156218 3300009093 Bacteria 2712
132 Ga0111539_10026178 3300009094 Bacteria 7138
133 Ga0105245_10113275 3300009098 Bacteria 2525
134 Ga0105247_10006247 3300009101 Bacteria 7388
135 Ga0114129_10004437 3300009147 Bacteria 19799
136 Ga0114129_10011234 3300009147 Bacteria 12767
137 Ga0114129_10041707 3300009147 Bacteria 6464
138 Ga0114129_10135656 3300009147 Bacteria 3377
139 Ga0114129_10200781 3300009147 Bacteria 2701
140 Ga0114129_10643014 3300009147 Bacteria 1370
141 Ga0114129_10799446 3300009147 Unclassified 1203
142 Ga0105243_10065341 3300009148 Bacteria 2922
143 Ga0105241_10125955 3300009174 Bacteria 2068
144 Ga0105242_10303176 3300009176 Bacteria 1459
145 Ga0105248_10023438 3300009177 Bacteria 6857
146 Ga0105248_10148189 3300009177 Bacteria 2648
147 Ga0105248_10318916 3300009177 Bacteria 1750
148 Ga0105248_10737627 3300009177 Bacteria 1111
149 Ga0105238_10127333 3300009551 Bacteria 2525
150 Ga0105239_10810289 3300010375 Bacteria 1073
151 Ga0157374_10704882 3300013296 Bacteria 1023
152 Ga0157378_11165549 3300013297 Bacteria 809
153 Ga0157375_10482869 3300013308 Unclassified 1404
154 Ga0163163_10811218 3300014325 Bacteria 999
155 Ga0163163_11858221 3300014325 Bacteria 662
156 Ga0157380_10164006 3300014326 Bacteria 1934
157 Ga0157377_10151823 3300014745 Unclassified 1433
158 Ga0157377_10739319 3300014745 Unclassified 719
159 Ga0157379_10615617 3300014968 Bacteria 1014
160 Ga0207653_10120603 3300025885 Bacteria 944
161 Ga0207680_10406862 3300025903 Unclassified 962
162 Ga0207685_10152932 3300025905 Bacteria 1046
163 Ga0207645_10055654 3300025907 Bacteria 2526
164 Ga0207645_10151125 3300025907 Bacteria 1516
165 Ga0207643_10109365 3300025908 Bacteria 1627
166 Ga0207654_10044000 3300025911 Bacteria 2533
167 Ga0207695_10182520 3300025913 Bacteria 2019
168 Ga0207695_10358737 3300025913 Bacteria 1344
169 Ga0207660_10048533 3300025917 Bacteria 3005
170 Ga0207660_10161496 3300025917 Bacteria 1729
171 Ga0207662_10008810 3300025918 Bacteria 5536
172 Ga0207662_10079506 3300025918 Bacteria 1998
173 Ga0207657_10021131 3300025919 Bacteria 6133
174 Ga0207657_10268001 3300025919 Bacteria 1358
175 Ga0207652_10125385 3300025921 Bacteria 2287
176 Ga0207652_10233657 3300025921 Bacteria 1657
177 Ga0207646_10056722 3300025922 Bacteria 3500
178 Ga0207646_10137876 3300025922 Bacteria 2197
179 Ga0207646_10157754 3300025922 Bacteria 2047
180 Ga0207646_10363244 3300025922 Unclassified 1308
181 Ga0207681_10108834 3300025923 Bacteria 2012
182 Ga0207650_10273169 3300025925 Bacteria 1374
183 Ga0207650_10413807 3300025925 Bacteria 1118
184 Ga0207659_10001674 3300025926 Bacteria 13173
185 Ga0207659_10143038 3300025926 Bacteria 1859
186 Ga0207659_11119673 3300025926 Bacteria 677
187 Ga0207687_10082945 3300025927 Bacteria 2320
188 Ga0207687_10201151 3300025927 Bacteria 1557
189 Ga0207644_10041596 3300025931 Bacteria 3252
190 Ga0207706_10219457 3300025933 Bacteria 1665
191 Ga0207670_10070752 3300025936 Bacteria 2411
192 Ga0207691_10268073 3300025940 Bacteria 1471
193 Ga0207691_10420288 3300025940 Bacteria 1139
194 Ga0207711_10616920 3300025941 Bacteria 1012
195 Ga0207711_10764214 3300025941 Bacteria 900
196 Ga0207711_10982916 3300025941 Unclassified 783
197 Ga0207689_10074042 3300025942 Bacteria 2798
198 Ga0207667_10873874 3300025949 Bacteria 892
199 Ga0207651_10595105 3300025960 Bacteria 966
200 Ga0207668_10608574 3300025972 Bacteria 952
201 Ga0207640_10044246 3300025981 Bacteria 2851
202 Ga0207640_10366788 3300025981 Bacteria 1162
203 Ga0207658_10510626 3300025986 Unclassified 1072
204 Ga0207703_10119069 3300026035 Bacteria 2264
205 Ga0207703_10296539 3300026035 Bacteria 1473
206 Ga0207703_10625095 3300026035 Unclassified 1020
207 Ga0207703_10758803 3300026035 Bacteria 925
208 Ga0207639_10473311 3300026041 Bacteria 1141
209 Ga0207639_10747043 3300026041 Bacteria 909
210 Ga0207708_10018869 3300026075 Bacteria 5194
211 Ga0207708_10640281 3300026075 Unclassified 904
212 Ga0207641_10201145 3300026088 Bacteria 1837
213 Ga0207641_10522929 3300026088 Bacteria 1154
214 Ga0207648_10167862 3300026089 Bacteria 1939
215 Ga0207648_10679523 3300026089 Unclassified 953
216 Ga0207676_10774379 3300026095 Bacteria 934
217 Ga0207675_100056601 3300026118 Bacteria 3658
218 Ga0207675_100602691 3300026118 Bacteria 1101
219 Ga0207683_10146370 3300026121 Bacteria 2130
220 Ga0207683_10301823 3300026121 Bacteria 1465
221 Ga0207698_10296474 3300026142 Bacteria 1503
222 Ga0268266_10007871 3300028379 Bacteria 9550
223 Ga0268265_10186516 3300028380 Bacteria 1787
224 Ga0268264_10115035 3300028381 Bacteria 2363
225 Ga0268264_10532713 3300028381 Bacteria 1150
226 Ga0268264_11633281 3300028381 Unclassified 655
227 Ga0373930_0014952 3300034816 Bacteria 1452
228 Ga0373950_0001278 3300034818 Bacteria 3255
229 Ga0373958_0001085 3300034819 Unclassified 3581
230 Ga0373938_0001071 3300034957 Bacteria 4406
231 Ga0373929_0002543 3300035085 Bacteria 3352
232 Ga0373940_0000884 3300035088 Bacteria 5040
233 Ga0373949_0000773 3300035090 Bacteria 10301
234 Ga0373951_0003932 3300035091 Bacteria 3570
235 Ga0373952_0017925 3300035092 Unclassified 1459
236 Ga0373939_0000278 3300035114 Bacteria 13575
237 Ga0373939_0020726 3300035114 Bacteria 1790
238 Ga0373941_0001587 3300035115 Bacteria 4833
239 Ga0373960_0008281 3300035121 Bacteria 2488
240 Ga0373943_0074453 3300035170 Bacteria 1727
241 Ga0373942_0001929 3300035207 Bacteria 5196
242 Ga0373961_0005151 3300035241 Bacteria 3144
243 Ga0373962_0002088 3300035242 Bacteria 4770
244 Ga0373931_0002373 3300035691 Bacteria 8330
245 Ga0373925_0520564 3300037068 Bacteria 977
246 Ga0451576_0069259 3300045051 Bacteria 3671
247 Ga0466967_0438226 3300045976 Unclassified 1276
248 Ga0495662_0153063 3300046476 Bacteria 1136
249 Ga0495640_0104848 3300046533 Bacteria 1853
250 Ga0495647_0003465 3300046681 Bacteria 5047
251 Ga0495647_0525091 3300046681 Bacteria 552
252 Ga0495658_0483795 3300046683 Bacteria 791
253 Ga0495669_0015946 3300046684 Bacteria 3217
254 Ga0495670_0444596 3300046691 Bacteria 702
255 Ga0495614_0358276 3300048089 Bacteria 681
256 Ga0496100_0167550 3300048903 Bacteria 1579
257 Ga0496101_0014794 3300048904 Bacteria 5248
258 Ga0496102_0546039 3300048905 Bacteria 1082
259 Ga0496103_0236695 3300048906 Bacteria 1175
260 Ga0496104_0042067 3300048907 Bacteria 4286
261 Ga0496104_0372710 3300048907 Bacteria 1340
262 Ga0496105_0136508 3300048908 Bacteria 2021
263 Ga0496106_0279229 3300048909 Unclassified 1338
264 Ga0496106_0429021 3300048909 Bacteria 1062
265 Ga0496107_0044924 3300048910 Bacteria 3177
266 Ga0496107_0194784 3300048910 Bacteria 1506
267 Ga0496108_0031357 3300048911 Bacteria 4410
268 Ga0496111_0274738 3300048914 Bacteria 1250
269 Ga0496112_0005771 3300048915 Bacteria 10767
270 Ga0496112_0198231 3300048915 Bacteria 1968
271 Ga0496112_0198786 3300048915 Bacteria 1965
272 Ga0496112_0225376 3300048915 Bacteria 1830
273 Ga0496113_0034682 3300048916 Bacteria 3684
274 Ga0496114_0001773 3300048917 Bacteria 16367
275 Ga0496114_0086978 3300048917 Bacteria 2649
276 nmdc:mga05p37_12052_c1 3300050507 Bacteria 10319
277 nmdc:mga05p37_1511174_c1 3300050507 Bacteria 668
278 nmdc:mga05p37_164318_c1 3300050507 Bacteria 2710
279 nmdc:mga05p37_1798_c1 3300050507 Bacteria 25039
280 nmdc:mga05p37_192788_c1 3300050507 Bacteria 2473
281 nmdc:mga05p37_281227_c1 3300050507 Bacteria 1984
282 nmdc:mga05p37_288705_c1 3300050507 Bacteria 1953
283 nmdc:mga05p37_421622_c1 3300050507 Bacteria 1553
284 nmdc:mga0qj67_603899_c1 3300050509 Bacteria 877
285 nmdc:mga06r32_118372_c1 3300050510 Bacteria 2611
286 nmdc:mga08y16_547274_c1 3300050511 Bacteria 1172
287 nmdc:mga0n895_110399_c1 3300050512 Bacteria 2766
288 nmdc:mga0n895_252535_c1 3300050512 Bacteria 1790
289 nmdc:mga0n895_2680_c1 3300050512 Bacteria 14053
290 nmdc:mga0n895_286838_c1 3300050512 Bacteria 1669
291 nmdc:mga0n895_31613_c1 3300050512 Bacteria 5071
292 nmdc:mga0n895_35375_c1 3300050512 Bacteria 4815
293 nmdc:mga0n895_430314_c1 3300050512 Bacteria 1334
294 nmdc:mga0rr50_10974_c1 3300050513 Bacteria 5778
295 nmdc:mga0rr50_113514_c1 3300050513 Bacteria 2147
296 nmdc:mga0rr50_195585_c1 3300050513 Bacteria 1659
297 nmdc:mga0rr50_38578_c1 3300050513 Bacteria 3459
298 nmdc:mga0rr50_500_c1 3300050513 Bacteria 20905
299 nmdc:mga0rr50_68770_c1 3300050513 Bacteria 2694
300 nmdc:mga08x19_15948_c1 3300050514 Bacteria 4578
301 nmdc:mga08x19_28563_c1 3300050514 Bacteria 1488
302 nmdc:mga08x19_68995_c1 3300050514 Bacteria 2302
303 nmdc:mga08x19_739_c1 3300050514 Bacteria 20880
304 nmdc:mga0a205_34471_c1 3300050515 Bacteria 4855
305 nmdc:mga0a205_56533_c1 3300050515 Bacteria 3788
306 nmdc:mga0a205_841287_c1 3300050515 Bacteria 765
307 nmdc:mga0a205_92680_c2 3300050515 Bacteria 2538
308 Ga0495601_0433393 3300053077 Bacteria 851
309 Ga0495595_0211006 3300053084 Bacteria 968
310 Ga0114129_10462728
311 Ga0065712_10091049
312 Ga0065707_10021791
313 Ga0070658_10339992
314 Ga0070676_10028956
315 Ga0070690_100057181
316 Ga0070670_100151462
317 Ga0070670_100194562
318 Ga0070670_100567340
319 Ga0068869_100207926
320 Ga0070666_10006154
321 Ga0070680_100036932
322 Ga0070680_100226910
323 Ga0068868_100490294
324 Ga0068868_100534833
325 Ga0070660_100020483
326 Ga0070660_100233416
327 Ga0070689_100065837
328 Ga0070689_100268391
329 Ga0070689_100778752
330 Ga0070691_10017904
331 Ga0070687_100133711
332 Ga0070668_100363638
333 Ga0070669_100155395
334 Ga0070675_100003223
335 Ga0070675_100163705
336 Ga0070674_100145664
337 Ga0070673_100931245
338 Ga0070688_100189223
339 Ga0070688_100447534
340 Ga0070688_100813048
341 Ga0070688_100933613
342 Ga0070703_10119513
343 Ga0070701_10015198
344 Ga0070705_100092033
345 Ga0070700_100400610
346 Ga0070694_100006907
347 Ga0070694_100021436
348 Ga0070694_100244821
349 Ga0070708_100691991
350 Ga0070678_100496511
351 Ga0070662_100054625
352 Ga0070681_10106447
353 Ga0070681_10133112
354 Ga0068867_100022772
355 Ga0070685_10183689
356 Ga0070707_100150031
357 Ga0070707_100278714
358 Ga0070707_100975026
359 Ga0070698_100100821
360 Ga0070698_100128212
361 Ga0070698_100342799
362 Ga0070698_100395700
363 Ga0070698_100692649
364 Ga0070698_100836640
365 Ga0070699_100202186
366 Ga0070699_100268043
367 Ga0070699_100502979
368 Ga0070679_100110730
369 Ga0070679_100251202
370 Ga0070684_100676069
371 Ga0070697_100049495
372 Ga0070697_100717255
373 Ga0068853_100588637
374 Ga0068853_100739740
375 Ga0070672_100291530
376 Ga0070672_100481484
377 Ga0070686_100019422
378 Ga0070686_100492079
379 Ga0070695_100314221
380 Ga0070695_100425267
381 Ga0070665_100164579
382 Ga0070704_100027089
383 Ga0070704_100031294
384 Ga0070704_100113976
385 Ga0070704_100727627
386 Ga0068855_100068396
387 Ga0068855_100343705
388 Ga0068854_100015949
389 Ga0068854_100076283
390 Ga0068852_100392312
391 Ga0068859_100524665
392 Ga0068859_100654665
393 Ga0068859_101224676
394 Ga0068859_101396086
395 Ga0068864_100058932
396 Ga0068861_100014767
397 Ga0068861_100703342
398 Ga0068863_100222386
399 Ga0068863_100533717
400 Ga0068863_100692602
401 Ga0068858_100555510
402 Ga0068862_100098393
403 Ga0068862_100912817
404 Ga0068862_101429627
405 Ga0081539_10034901
406 Ga0075432_10184340
407 Ga0070715_10082591
408 Ga0097621_100111462
409 Ga0068871_100215079
410 Ga0075428_100800870
411 Ga0075431_100129554
412 Ga0075433_10104570
413 Ga0075433_10295314
414 Ga0075433_10968203
415 Ga0075434_100004883
416 Ga0075434_100031212
417 Ga0075434_100041061
418 Ga0075434_100052908
419 Ga0075434_100133301
420 Ga0075434_100272116
421 Ga0075429_100152347
422 Ga0068865_100723601
423 Ga0075436_100005353
424 Ga0075436_100031878
425 Ga0075436_100104236
426 Ga0075436_100209232
427 Ga0075436_100708592
428 Ga0097620_100524673
429 Ga0097620_100654610
430 Ga0097620_101224462
431 Ga0097620_101395987
432 Ga0075435_100002536
433 Ga0075435_100013141
434 Ga0075435_100026465
435 Ga0075435_100106701
436 Ga0075435_100120334
437 Ga0099794_10074863
438 Ga0099795_10293702
439 Ga0105240_10138519
440 Ga0105240_10156218
441 Ga0111539_10026178
442 Ga0105245_10113275
443 Ga0105247_10006247
444 Ga0114129_10004437
445 Ga0114129_10011234
446 Ga0114129_10041707
447 Ga0114129_10135656
448 Ga0114129_10200781
449 Ga0114129_10643014
450 Ga0114129_10799446
451 Ga0105243_10065341
452 Ga0105241_10125955
453 Ga0105242_10303176
454 Ga0105248_10023438
455 Ga0105248_10148189
456 Ga0105248_10318916
457 Ga0105248_10737627
458 Ga0105238_10127333
459 Ga0105239_10810289
460 Ga0157374_10704882
461 Ga0157378_11165549
462 Ga0157375_10482869
463 Ga0163163_10811218
464 Ga0163163_11858221
465 Ga0157380_10164006
466 Ga0157377_10151823
467 Ga0157377_10739319
468 Ga0157379_10615617
469 Ga0207653_10120603
470 Ga0207680_10406862
471 Ga0207685_10152932
472 Ga0207645_10055654
473 Ga0207645_10151125
474 Ga0207643_10109365
475 Ga0207654_10044000
476 Ga0207695_10182520
477 Ga0207695_10358737
478 Ga0207660_10048533
479 Ga0207660_10161496
480 Ga0207662_10008810
481 Ga0207662_10079506
482 Ga0207657_10021131
483 Ga0207657_10268001
484 Ga0207652_10125385
485 Ga0207652_10233657
486 Ga0207646_10056722
487 Ga0207646_10137876
488 Ga0207646_10157754
489 Ga0207646_10363244
490 Ga0207681_10108834
491 Ga0207650_10273169
492 Ga0207650_10413807
493 Ga0207659_10001674
494 Ga0207659_10143038
495 Ga0207659_11119673
496 Ga0207687_10082945
497 Ga0207687_10201151
498 Ga0207644_10041596
499 Ga0207706_10219457
500 Ga0207670_10070752
501 Ga0207691_10268073
502 Ga0207691_10420288
503 Ga0207711_10616920
504 Ga0207711_10764214
505 Ga0207711_10982916
506 Ga0207689_10074042
507 Ga0207667_10873874
508 Ga0207651_10595105
509 Ga0207668_10608574
510 Ga0207640_10044246
511 Ga0207640_10366788
512 Ga0207658_10510626
513 Ga0207703_10119069
514 Ga0207703_10296539
515 Ga0207703_10625095
516 Ga0207703_10758803
517 Ga0207639_10473311
518 Ga0207639_10747043
519 Ga0207708_10018869
520 Ga0207708_10640281
521 Ga0207641_10201145
522 Ga0207641_10522929
523 Ga0207648_10167862
524 Ga0207648_10679523
525 Ga0207676_10774379
526 Ga0207675_100056601
527 Ga0207675_100602691
528 Ga0207683_10146370
529 Ga0207683_10301823
530 Ga0207698_10296474
531 Ga0268266_10007871
532 Ga0268265_10186516
533 Ga0268264_10115035
534 Ga0268264_10532713
535 Ga0268264_11633281
536 Ga0373930_0014952
537 Ga0373950_0001278
538 Ga0373958_0001085
539 Ga0373938_0001071
540 Ga0373929_0002543
541 Ga0373940_0000884
542 Ga0373949_0000773
543 Ga0373951_0003932
544 Ga0373952_0017925
545 Ga0373939_0000278
546 Ga0373939_0020726
547 Ga0373941_0001587
548 Ga0373960_0008281
549 Ga0373943_0074453
550 Ga0373942_0001929
551 Ga0373961_0005151
552 Ga0373962_0002088
553 Ga0373931_0002373
554 Ga0373925_0520564
555 Ga0451576_0069259
556 Ga0466967_0438226
557 Ga0495662_0153063
558 Ga0495640_0104848
559 Ga0495647_0003465
560 Ga0495647_0525091
561 Ga0495658_0483795
562 Ga0495669_0015946
563 Ga0495670_0444596
564 Ga0495614_0358276
565 Ga0496100_0167550
566 Ga0496101_0014794
567 Ga0496102_0546039
568 Ga0496103_0236695
569 Ga0496104_0042067
570 Ga0496104_0372710
571 Ga0496105_0136508
572 Ga0496106_0279229
573 Ga0496106_0429021
574 Ga0496107_0044924
575 Ga0496107_0194784
576 Ga0496108_0031357
577 Ga0496111_0274738
578 Ga0496112_0005771
579 Ga0496112_0198231
580 Ga0496112_0198786
581 Ga0496112_0225376
582 Ga0496113_0034682
583 Ga0496114_0001773
584 Ga0496114_0086978
585 nmdc:mga05p37_12052_c1
586 nmdc:mga05p37_1511174_c1
587 nmdc:mga05p37_164318_c1
588 nmdc:mga05p37_1798_c1
589 nmdc:mga05p37_192788_c1
590 nmdc:mga05p37_281227_c1
591 nmdc:mga05p37_288705_c1
592 nmdc:mga05p37_421622_c1
593 nmdc:mga0qj67_603899_c1
594 nmdc:mga06r32_118372_c1
595 nmdc:mga08y16_547274_c1
596 nmdc:mga0n895_110399_c1
597 nmdc:mga0n895_252535_c1
598 nmdc:mga0n895_2680_c1
599 nmdc:mga0n895_286838_c1
600 nmdc:mga0n895_31613_c1
601 nmdc:mga0n895_35375_c1
602 nmdc:mga0n895_430314_c1
603 nmdc:mga0rr50_10974_c1
604 nmdc:mga0rr50_113514_c1
605 nmdc:mga0rr50_195585_c1
606 nmdc:mga0rr50_38578_c1
607 nmdc:mga0rr50_500_c1
608 nmdc:mga0rr50_68770_c1
609 nmdc:mga08x19_15948_c1
610 nmdc:mga08x19_28563_c1
611 nmdc:mga08x19_68995_c1
612 nmdc:mga08x19_739_c1
613 nmdc:mga0a205_34471_c1
614 nmdc:mga0a205_56533_c1
615 nmdc:mga0a205_841287_c1
616 nmdc:mga0a205_92680_c2
617 Ga0495601_0433393
618 Ga0495595_0211006

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13886

DUF4203

Domain of unknown function (DUF4203)

9

197

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6y79-assembly1.cif.gz_J cryo-em structure of a respiratory complex i f89a mutant 0.2885 77 201
3g6i-assembly1.cif.gz_A-2 crystal structure of an outer membrane protein, part of a putative carbohydrate binding complex (bt_1022) from bacteroides thetaiotaomicron vpi-5482 at 1.93 a resolution 0.2747 35 190
7xy7-assembly1.cif.gz_R adenosine receptor bound to a non-selective agonist in complex with a g protein obtained by cryo-em 0.2734 75 198
8scx-assembly1.cif.gz_B cryo-em structure of the core tim23 complex from s. cerevisiae 0.2707 77 198
4xk8-assembly2.cif.gz_l crystal structure of plant photosystem i-lhci super-complex at 2.8 angstrom resolution 0.2632 26 124
ID Description Score Start End Superfamily
af_Q9FWD5_67_178_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4146 29 119 1.10.10.1740
af_O44477_13_121_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4133 30 119 1.10.10.1740
af_Q7TSH8_1_1073_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.3949 73 191 3.40.1110.10
af_O44477_13_121_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.356 30 119 1.10.10.1740
af_A0A1D6E953_60_452_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.354 46 192 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A6L8DUU3-F1-model_v4 DUF4203 domain-containing protein 0.8723 5 200 GO:0016020
AF-A0A7C7NQ12-F1-model_v4 TMEM198/TM7SF3 family protein 0.8477 1 201 GO:0005886
AF-A0A7C7NQ12-F1-model_v4 TMEM198/TM7SF3 family protein 0.8439 1 201 GO:0005886
AF-A0A6L8DUU3-F1-model_v4 DUF4203 domain-containing protein 0.8395 5 200 GO:0016020
AF-A0A3N5NHU1-F1-model_v4 DUF4203 domain-containing protein 0.8392 1 198 GO:0005886

Map