F400049

General Info

Members Datasets Scaffolds Average Seq Length
309 172 309 115

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100394493|Ga0068868_1003944932
Length 119
Sequence MALGIKKRVSTHVLDTTLGKPAVGITVHLERRQPSGNWSVLETARTDEDGRCSQLLPDEAALTTGFYRLVFDTHSYFADMRIANLYPVVEVTFQVRDGESHFHIPLLLSPNGYTTYRGT

Samples

Sample ID Description Type Environment
1 2088090003 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
70 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
71 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
72 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
104 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
105 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
119 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
120 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 3.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.41
Rhizosphere 90.94
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJN_F6ESG4R02H5D7C 2088090003 Bacteria 509
2 LJNas_1000787 3300000546 Bacteria 5287
3 Ga0068869_100002628 3300005334 Bacteria 10848
4 Ga0068869_100910826 3300005334 Bacteria 761
5 Ga0068868_100153533 3300005338 Bacteria 1897
6 Ga0068868_100394493 3300005338 Viruses 1193
7 Ga0070689_100139166 3300005340 Bacteria 1951
8 Ga0070667_100248075 3300005367 Bacteria 1591
9 Ga0070709_10012646 3300005434 Bacteria 4728
10 Ga0070709_10096080 3300005434 Unclassified 1964
11 Ga0070709_11084503 3300005434 Bacteria 640
12 Ga0070713_100284744 3300005436 Unclassified 1517
13 Ga0070713_100430588 3300005436 Bacteria 1236
14 Ga0070713_100570984 3300005436 Bacteria 1072
15 Ga0070713_101110808 3300005436 Bacteria 764
16 Ga0070710_11392613 3300005437 Unclassified 524
17 Ga0070711_100000387 3300005439 Bacteria 22724
18 Ga0070711_100104783 3300005439 Bacteria 2064
19 Ga0070711_101599647 3300005439 Unclassified 570
20 Ga0070708_100002259 3300005445 Bacteria 14893
21 Ga0070708_100002984 3300005445 Bacteria 13148
22 Ga0070708_100022811 3300005445 Bacteria 5314
23 Ga0070708_100461817 3300005445 Unclassified 1198
24 Ga0070708_101318585 3300005445 Unclassified 674
25 Ga0070663_100896608 3300005455 Unclassified 766
26 Ga0070662_100093498 3300005457 Bacteria 2262
27 Ga0068867_100085863 3300005459 Bacteria 2380
28 Ga0070685_10021616 3300005466 Bacteria 3499
29 Ga0070706_100000188 3300005467 Bacteria 78186
30 Ga0070706_100009269 3300005467 Bacteria 9170
31 Ga0070706_100230184 3300005467 Unclassified 1730
32 Ga0070706_100261068 3300005467 Bacteria 1617
33 Ga0070707_100001742 3300005468 Bacteria 20957
34 Ga0070707_100216976 3300005468 Bacteria 1864
35 Ga0070707_100272194 3300005468 Bacteria 1646
36 Ga0070698_100001030 3300005471 Bacteria 30633
37 Ga0070698_100089821 3300005471 Bacteria 3056
38 Ga0070698_100644976 3300005471 Unclassified 1000
39 Ga0070699_100001065 3300005518 Bacteria 25521
40 Ga0070699_100067493 3300005518 Unclassified 3106
41 Ga0070684_100708136 3300005535 Unclassified 939
42 Ga0070697_100000146 3300005536 Bacteria 57392
43 Ga0070697_100000473 3300005536 Bacteria 30639
44 Ga0070697_100001570 3300005536 Bacteria 17415
45 Ga0070697_100071841 3300005536 Unclassified 2839
46 Ga0070697_100671660 3300005536 Bacteria 913
47 Ga0070697_101676710 3300005536 Bacteria 569
48 Ga0068853_102236258 3300005539 Unclassified 530
49 Ga0070686_100516409 3300005544 Unclassified 929
50 Ga0070695_100239948 3300005545 Bacteria 1314
51 Ga0070665_100253324 3300005548 Bacteria 1761
52 Ga0068859_100011260 3300005617 Bacteria 9001
53 Ga0068866_10194248 3300005718 Bacteria 1208
54 Ga0068861_100157537 3300005719 Bacteria 1870
55 Ga0068851_10548281 3300005834 Unclassified 698
56 Ga0068863_100385974 3300005841 Bacteria 1368
57 Ga0068858_100007248 3300005842 Bacteria 10742
58 Ga0068858_100461345 3300005842 Bacteria 1225
59 Ga0068860_100089113 3300005843 Bacteria 2937
60 Ga0068862_100423432 3300005844 Bacteria 1250
61 Ga0081540_1232402 3300005983 Bacteria 650
62 Ga0070717_10001310 3300006028 Bacteria 17033
63 Ga0070717_10002087 3300006028 Bacteria 14001
64 Ga0070717_10057307 3300006028 Bacteria 3220
65 Ga0070717_10535012 3300006028 Unclassified 1061
66 Ga0070715_10024396 3300006163 Bacteria 2382
67 Ga0070715_10040314 3300006163 Bacteria 1951
68 Ga0070715_10063765 3300006163 Bacteria 1625
69 Ga0070715_10413715 3300006163 Unclassified 752
70 Ga0070716_100000121 3300006173 Bacteria 30983
71 Ga0070716_100035352 3300006173 Bacteria 2747
72 Ga0070716_100077197 3300006173 Bacteria 1976
73 Ga0070712_100002109 3300006175 Bacteria 12218
74 Ga0070712_100158813 3300006175 Bacteria 1744
75 Ga0070712_100992972 3300006175 Unclassified 726
76 Ga0070712_101355280 3300006175 Bacteria 620
77 Ga0097621_100125668 3300006237 Unclassified 2178
78 Ga0097621_100374588 3300006237 Bacteria 1270
79 Ga0097621_100615830 3300006237 Unclassified 993
80 Ga0068871_100019656 3300006358 Bacteria 5160
81 Ga0068871_100025229 3300006358 Bacteria 4621
82 Ga0068871_100239929 3300006358 Viruses 1576
83 Ga0068871_100631313 3300006358 Unclassified 976
84 Ga0075431_100315602 3300006847 Bacteria 1577
85 Ga0075434_100297461 3300006871 Bacteria 1634
86 Ga0068865_100007544 3300006881 Bacteria 6695
87 Ga0075436_100102773 3300006914 Unclassified 1991
88 Ga0097620_100011260 3300006931 Bacteria 9001
89 Ga0075435_100491763 3300007076 Bacteria 1060
90 Ga0099794_10002316 3300007265 Bacteria 6992
91 Ga0099794_10009854 3300007265 Bacteria 4038
92 Ga0099794_10058401 3300007265 Bacteria 1870
93 Ga0099794_10065599 3300007265 Unclassified 1770
94 Ga0099794_10077274 3300007265 Unclassified 1637
95 Ga0099794_10230905 3300007265 Unclassified 952
96 Ga0099794_10447852 3300007265 Unclassified 677
97 Ga0099795_10037826 3300007788 Archaea 1700
98 Ga0099795_10152980 3300007788 Bacteria 946
99 Ga0105240_10288043 3300009093 Bacteria 1884
100 Ga0105240_10423504 3300009093 Viruses 1495
101 Ga0105245_10226632 3300009098 Bacteria 1806
102 Ga0105245_10343371 3300009098 Bacteria 1477
103 Ga0105245_11560083 3300009098 Bacteria 712
104 Ga0105247_10138731 3300009101 Bacteria 1591
105 Ga0105241_10227798 3300009174 Bacteria 1570
106 Ga0105241_10531454 3300009174 Unclassified 1053
107 Ga0105241_11064885 3300009174 Unclassified 760
108 Ga0105248_10155252 3300009177 Bacteria 2582
109 Ga0105248_10238820 3300009177 Bacteria 2046
110 Ga0105248_10390096 3300009177 Bacteria 1568
111 Ga0105248_11115389 3300009177 Unclassified 892
112 Ga0105237_10126788 3300009545 Bacteria 2547
113 Ga0105237_10192094 3300009545 Bacteria 2041
114 Ga0105238_10125095 3300009551 Unclassified 2550
115 Ga0105238_10871649 3300009551 Unclassified 918
116 Ga0105249_10954347 3300009553 Bacteria 925
117 Ga0105249_11123181 3300009553 Unclassified 856
118 Ga0099796_10081712 3300010159 Bacteria 1186
119 Ga0099796_10142994 3300010159 Bacteria 936
120 Ga0099796_10144586 3300010159 Archaea 932
121 Ga0105239_10043256 3300010375 Bacteria 4936
122 Ga0105246_11509936 3300011119 Unclassified 631
123 Ga0157373_10449758 3300013100 Unclassified 927
124 Ga0157369_10940676 3300013105 Unclassified 886
125 Ga0157374_10002043 3300013296 Bacteria 16962
126 Ga0157374_10085981 3300013296 Bacteria 2991
127 Ga0157374_11011642 3300013296 Bacteria 850
128 Ga0157378_10406147 3300013297 Bacteria 1343
129 Ga0157378_10970990 3300013297 Unclassified 883
130 Ga0163162_10001103 3300013306 Bacteria 25047
131 Ga0163162_10001732 3300013306 Bacteria 20439
132 Ga0163162_13148187 3300013306 Unclassified 530
133 Ga0157375_10000276 3300013308 Bacteria 46617
134 Ga0163163_10387149 3300014325 Viruses 1456
135 Ga0157379_10010460 3300014968 Bacteria 8088
136 Ga0157379_10051992 3300014968 Bacteria 3658
137 Ga0157379_10207903 3300014968 Bacteria 1771
138 Ga0157379_11234721 3300014968 Unclassified 720
139 Ga0157376_10000468 3300014969 Bacteria 25990
140 Ga0157376_10344376 3300014969 Bacteria 1424
141 Ga0157376_10379866 3300014969 Bacteria 1361
142 Ga0157376_10394753 3300014969 Unclassified 1336
143 Ga0157376_12098547 3300014969 Unclassified 603
144 Ga0224569_100006 3300022732 Bacteria 13133
145 Ga0224571_100154 3300022734 Unclassified 3044
146 Ga0224572_1012123 3300024225 Bacteria 1635
147 Ga0228598_1000014 3300024227 Bacteria 23932
148 Ga0228598_1001186 3300024227 Bacteria 5743
149 Ga0228598_1034495 3300024227 Unclassified 998
150 Ga0207692_10999058 3300025898 Unclassified 552
151 Ga0207710_10168723 3300025900 Unclassified 1069
152 Ga0207647_10129223 3300025904 Bacteria 1485
153 Ga0207685_10399144 3300025905 Unclassified 704
154 Ga0207699_10007334 3300025906 Bacteria 5389
155 Ga0207699_10080363 3300025906 Bacteria 2020
156 Ga0207684_10000498 3300025910 Bacteria 49771
157 Ga0207684_10001145 3300025910 Bacteria 29602
158 Ga0207654_10150932 3300025911 Bacteria 1491
159 Ga0207654_11312243 3300025911 Unclassified 528
160 Ga0207695_10415759 3300025913 Viruses 1229
161 Ga0207693_10000243 3300025915 Bacteria 50405
162 Ga0207693_10443215 3300025915 Unclassified 1015
163 Ga0207693_10730058 3300025915 Bacteria 766
164 Ga0207693_11154117 3300025915 Unclassified 586
165 Ga0207663_10011181 3300025916 Bacteria 4810
166 Ga0207663_10116327 3300025916 Bacteria 1823
167 Ga0207663_10216120 3300025916 Bacteria 1392
168 Ga0207663_10611330 3300025916 Viruses 857
169 Ga0207646_10000557 3300025922 Bacteria 49083
170 Ga0207646_10587421 3300025922 Bacteria 1000
171 Ga0207694_10133482 3300025924 Viruses 1991
172 Ga0207694_11670843 3300025924 Unclassified 536
173 Ga0207700_10148038 3300025928 Bacteria 1938
174 Ga0207700_10246082 3300025928 Unclassified 1526
175 Ga0207700_10422076 3300025928 Bacteria 1172
176 Ga0207664_10426448 3300025929 Bacteria 1182
177 Ga0207706_10281695 3300025933 Bacteria 1450
178 Ga0207670_10759502 3300025936 Unclassified 806
179 Ga0207670_11531583 3300025936 Unclassified 567
180 Ga0207704_10001355 3300025938 Bacteria 10940
181 Ga0207665_10000014 3300025939 Bacteria 137803
182 Ga0207665_10065208 3300025939 Bacteria 2476
183 Ga0207665_10071805 3300025939 Bacteria 2363
184 Ga0207665_10225084 3300025939 Bacteria 1376
185 Ga0207665_10298036 3300025939 Bacteria 1204
186 Ga0207711_10790816 3300025941 Unclassified 884
187 Ga0207689_10002521 3300025942 Bacteria 17012
188 Ga0207689_10789137 3300025942 Bacteria 802
189 Ga0207712_11341768 3300025961 Unclassified 639
190 Ga0207658_10243884 3300025986 Bacteria 1524
191 Ga0207677_10299490 3300026023 Viruses 1328
192 Ga0207677_11734402 3300026023 Unclassified 579
193 Ga0207703_10442489 3300026035 Bacteria 1213
194 Ga0207678_10534118 3300026067 Unclassified 1024
195 Ga0207641_10006923 3300026088 Bacteria 9489
196 Ga0207648_10102870 3300026089 Bacteria 2504
197 Ga0207698_10682920 3300026142 Bacteria 1020
198 Ga0209179_1036599 3300027512 Bacteria 1023
199 Ga0209588_1008116 3300027671 Bacteria 3107
200 Ga0209588_1010295 3300027671 Bacteria 2810
201 Ga0209588_1026497 3300027671 Bacteria 1841
202 Ga0209588_1033683 3300027671 Bacteria 1643
203 Ga0209588_1059712 3300027671 Unclassified 1233
204 Ga0209588_1183180 3300027671 Unclassified 657
205 Ga0209588_1186832 3300027671 Unclassified 649
206 Ga0265354_1000482 3300028016 Bacteria 6926
207 Ga0265354_1000612 3300028016 Bacteria 6019
208 Ga0265356_1006001 3300028017 Bacteria 1432
209 Ga0265357_1013183 3300028023 Eukaryota 857
210 Ga0268265_10391778 3300028380 Bacteria 1281
211 Ga0268264_10114264 3300028381 Bacteria 2370
212 Ga0265762_1000045 3300030760 Bacteria 14984
213 Ga0265763_1011694 3300030763 Unclassified 828
214 Ga0265770_1004220 3300030878 Unclassified 1958
215 Ga0265770_1023705 3300030878 Unclassified 989
216 Ga0265770_1037867 3300030878 Unclassified 834
217 Ga0265765_1000148 3300030879 Bacteria 4364
218 Ga0265760_10000351 3300031090 Bacteria 12934
219 Ga0265760_10001431 3300031090 Bacteria 7025
220 Ga0265760_10031453 3300031090 Unclassified 1565
221 Ga0265760_10090250 3300031090 Unclassified 958
222 Ga0265760_10090263 3300031090 Unclassified 958
223 Ga0265325_10332405 3300031241 Bacteria 674
224 Ga0265340_10105904 3300031247 Unclassified 1304
225 Ga0265339_10143977 3300031249 Unclassified 1210
226 Ga0265316_10006361 3300031344 Bacteria 11295
227 Ga0265314_10027116 3300031711 Unclassified 4293
228 Ga0316212_1000826 3300033547 Unclassified 4004
229 Ga0316212_1006626 3300033547 Unclassified 1676
230 Ga0373934_0057103 3300035086 Unclassified 1553
231 Ga0373940_0045180 3300035088 Bacteria 1222
232 Ga0373936_0217706 3300035113 Unclassified 846
233 Ga0373955_0588701 3300035172 Unclassified 681
234 Ga0373924_0474094 3300035410 Unclassified 562
235 Ga0373931_0263180 3300035691 Unclassified 1053
236 Ga0373931_0444791 3300035691 Bacteria 828
237 Ga0373927_0620806 3300035695 Bacteria 715
238 Ga0373933_0431163 3300035724 Unclassified 861
239 Ga0373933_1013452 3300035724 Unclassified 547
240 Ga0373937_0342245 3300036401 Bacteria 1416
241 Ga0373937_1593376 3300036401 Bacteria 600
242 Ga0373925_0042468 3300037068 Bacteria 3373
243 Ga0495603_0143356 3300046455 Bacteria 1389
244 Ga0495641_0041799 3300046461 Bacteria 2128
245 Ga0495641_0196330 3300046461 Unclassified 904
246 Ga0495580_0000989 3300046472 Bacteria 24941
247 Ga0495580_0027047 3300046472 Unclassified 4177
248 Ga0495580_0085339 3300046472 Unclassified 2199
249 Ga0495580_0173498 3300046472 Bacteria 1490
250 Ga0495582_0000279 3300046473 Bacteria 28597
251 Ga0495582_0044345 3300046473 Bacteria 2449
252 Ga0495639_0022153 3300046475 Bacteria 2785
253 Ga0495662_0224808 3300046476 Bacteria 925
254 Ga0495664_0215064 3300046477 Bacteria 1164
255 Ga0495594_0077659 3300046499 Bacteria 1852
256 Ga0495608_0487637 3300046511 Bacteria 747
257 Ga0495618_0210338 3300046514 Bacteria 1229
258 Ga0495630_0928219 3300046517 Bacteria 662
259 Ga0495666_0098773 3300046526 Bacteria 1376
260 Ga0495665_0061306 3300046531 Bacteria 1986
261 Ga0495640_0044123 3300046533 Bacteria 3101
262 Ga0495586_0634074 3300046535 Bacteria 617
263 Ga0495622_0212003 3300046557 Bacteria 860
264 Ga0495622_0222996 3300046557 Bacteria 835
265 Ga0495667_0257112 3300046559 Bacteria 1111
266 Ga0495634_0096163 3300046642 Bacteria 1918
267 Ga0495634_0296906 3300046642 Unclassified 978
268 Ga0495635_0086744 3300046663 Unclassified 2142
269 Ga0495657_0827285 3300046675 Unclassified 528
270 Ga0495647_0071648 3300046681 Bacteria 1388
271 Ga0495658_0030103 3300046683 Bacteria 2945
272 Ga0495658_0415621 3300046683 Unclassified 858
273 Ga0495613_0302658 3300046689 Bacteria 1106
274 Ga0495674_0074300 3300047319 Bacteria 2928
275 Ga0495676_0017780 3300047321 Bacteria 6278
276 Ga0495680_0011742 3300047322 Bacteria 7738
277 Ga0495680_0211893 3300047322 Unclassified 1387
278 Ga0495684_0848468 3300047471 Unclassified 593
279 Ga0495686_0035623 3300047472 Bacteria 3198
280 Ga0495602_0459037 3300048088 Unclassified 898
281 Ga0496100_0083962 3300048903 Bacteria 2158
282 Ga0496100_0153836 3300048903 Bacteria 1643
283 Ga0496100_0294309 3300048903 Unclassified 1213
284 Ga0496100_1092890 3300048903 Unclassified 628
285 Ga0496101_0024605 3300048904 Unclassified 4169
286 Ga0496101_0144915 3300048904 Bacteria 1813
287 Ga0496101_0277549 3300048904 Bacteria 1309
288 Ga0496102_0000662 3300048905 Bacteria 34346
289 Ga0496103_0018238 3300048906 Bacteria 4209
290 Ga0496104_0046642 3300048907 Bacteria 4081
291 Ga0496104_0063829 3300048907 Bacteria 3494
292 Ga0496105_0252652 3300048908 Bacteria 1428
293 Ga0496105_0257008 3300048908 Bacteria 1414
294 Ga0496106_0013290 3300048909 Bacteria 6077
295 Ga0496107_0080901 3300048910 Bacteria 2370
296 Ga0496107_0453697 3300048910 Unclassified 952
297 Ga0496110_0251432 3300048913 Unclassified 1609
298 Ga0496112_0000961 3300048915 Bacteria 20945
299 Ga0496112_0134516 3300048915 Bacteria 2443
300 Ga0496112_0175036 3300048915 Unclassified 2111
301 Ga0496114_0032061 3300048917 Unclassified 4323
302 Ga0496114_0127893 3300048917 Bacteria 2192
303 Ga0496115_0021635 3300048918 Bacteria 4970
304 Ga0496115_0053356 3300048918 Unclassified 3244
305 Ga0496115_0264544 3300048918 Bacteria 1414
306 Ga0496115_0451380 3300048918 Unclassified 1038
307 nmdc:mga0n895_845895_c1 3300050512 Bacteria 903
308 nmdc:mga08x19_59351_c1 3300050514 Unclassified 2476
309 Ga0495601_0653785 3300053077 Unclassified 672

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006847 Ga0075431_100315602 Ga0075431_1003156022 109
2 3300025936 Ga0207670_11531583 Ga0207670_115315832 110
3 3300047472 Ga0495686_0035623 Ga0495686_0035623_2279_2617 112
4 3300005436 Ga0070713_100570984 Ga0070713_1005709842 113
5 3300005445 Ga0070708_100002259 Ga0070708_1000022597 113
6 3300005455 Ga0070663_100896608 Ga0070663_1008966082 113
7 3300005468 Ga0070707_100001742 Ga0070707_1000017424 113
8 3300005468 Ga0070707_100216976 Ga0070707_1002169763 113
9 3300005471 Ga0070698_100001030 Ga0070698_10000103010 113
10 3300005518 Ga0070699_100001065 Ga0070699_10000106517 113
11 3300005536 Ga0070697_100000473 Ga0070697_10000047317 113
12 3300006028 Ga0070717_10535012 Ga0070717_105350122 113
13 3300009093 Ga0105240_10288043 Ga0105240_102880432 113
14 3300009177 Ga0105248_11115389 Ga0105248_111153892 113
15 3300009551 Ga0105238_10871649 Ga0105238_108716492 113
16 3300013306 Ga0163162_13148187 Ga0163162_131481871 113
17 3300014969 Ga0157376_10344376 Ga0157376_103443762 113
18 3300025910 Ga0207684_10000498 Ga0207684_1000049834 113
19 3300025922 Ga0207646_10000557 Ga0207646_1000055732 113
20 3300025924 Ga0207694_11670843 Ga0207694_116708432 113
21 3300025928 Ga0207700_10422076 Ga0207700_104220762 113
22 3300025941 Ga0207711_10790816 Ga0207711_107908162 113
23 3300026067 Ga0207678_10534118 Ga0207678_105341182 113
24 3300026142 Ga0207698_10682920 Ga0207698_106829202 113
25 3300000546 LJNas_1000787 LJNas_10007874 114
26 3300005334 Ga0068869_100002628 Ga0068869_1000026287 114
27 3300005334 Ga0068869_100910826 Ga0068869_1009108262 114
28 3300005338 Ga0068868_100153533 Ga0068868_1001535332 114
29 3300005340 Ga0070689_100139166 Ga0070689_1001391662 114
30 3300005367 Ga0070667_100248075 Ga0070667_1002480752 114
31 3300005434 Ga0070709_10012646 Ga0070709_100126464 114
32 3300005434 Ga0070709_10096080 Ga0070709_100960803 114
33 3300005434 Ga0070709_11084503 Ga0070709_110845032 114
34 3300005436 Ga0070713_100284744 Ga0070713_1002847443 114
35 3300005436 Ga0070713_100430588 Ga0070713_1004305882 114
36 3300005436 Ga0070713_101110808 Ga0070713_1011108082 114
37 3300005437 Ga0070710_11392613 Ga0070710_113926131 114
38 3300005439 Ga0070711_100104783 Ga0070711_1001047832 114
39 3300005445 Ga0070708_100002984 Ga0070708_1000029845 114
40 3300005445 Ga0070708_100022811 Ga0070708_1000228116 114
41 3300005445 Ga0070708_100461817 Ga0070708_1004618172 114
42 3300005457 Ga0070662_100093498 Ga0070662_1000934983 114
43 3300005459 Ga0068867_100085863 Ga0068867_1000858632 114
44 3300005466 Ga0070685_10021616 Ga0070685_100216164 114
45 3300005467 Ga0070706_100000188 Ga0070706_10000018857 114
46 3300005467 Ga0070706_100230184 Ga0070706_1002301842 114
47 3300005467 Ga0070706_100261068 Ga0070706_1002610682 114
48 3300005468 Ga0070707_100272194 Ga0070707_1002721941 114
49 3300005471 Ga0070698_100089821 Ga0070698_1000898212 114
50 3300005471 Ga0070698_100644976 Ga0070698_1006449762 114
51 3300005518 Ga0070699_100067493 Ga0070699_1000674933 114
52 3300005536 Ga0070697_100000146 Ga0070697_10000014632 114
53 3300005536 Ga0070697_100001570 Ga0070697_1000015707 114
54 3300005536 Ga0070697_100671660 Ga0070697_1006716602 114
55 3300005544 Ga0070686_100516409 Ga0070686_1005164092 114
56 3300005545 Ga0070695_100239948 Ga0070695_1002399483 114
57 3300005548 Ga0070665_100253324 Ga0070665_1002533242 114
58 3300005617 Ga0068859_100011260 Ga0068859_1000112605 114
59 3300005718 Ga0068866_10194248 Ga0068866_101942482 114
60 3300005719 Ga0068861_100157537 Ga0068861_1001575372 114
61 3300005834 Ga0068851_10548281 Ga0068851_105482812 114
62 3300005841 Ga0068863_100385974 Ga0068863_1003859741 114
63 3300005842 Ga0068858_100007248 Ga0068858_1000072484 114
64 3300005842 Ga0068858_100461345 Ga0068858_1004613452 114
65 3300005844 Ga0068862_100423432 Ga0068862_1004234322 114
66 3300005983 Ga0081540_1232402 Ga0081540_12324022 114
67 3300006028 Ga0070717_10001310 Ga0070717_1000131019 114
68 3300006028 Ga0070717_10002087 Ga0070717_100020872 114
69 3300006028 Ga0070717_10057307 Ga0070717_100573073 114
70 3300006163 Ga0070715_10024396 Ga0070715_100243963 114
71 3300006163 Ga0070715_10040314 Ga0070715_100403143 114
72 3300006163 Ga0070715_10063765 Ga0070715_100637653 114
73 3300006173 Ga0070716_100000121 Ga0070716_1000001218 114
74 3300006173 Ga0070716_100077197 Ga0070716_1000771973 114
75 3300006175 Ga0070712_100002109 Ga0070712_10000210911 114
76 3300006175 Ga0070712_100158813 Ga0070712_1001588132 114
77 3300006175 Ga0070712_100992972 Ga0070712_1009929722 114
78 3300006175 Ga0070712_101355280 Ga0070712_1013552801 114
79 3300006237 Ga0097621_100374588 Ga0097621_1003745882 114
80 3300006237 Ga0097621_100615830 Ga0097621_1006158302 114
81 3300006358 Ga0068871_100019656 Ga0068871_1000196562 114
82 3300006358 Ga0068871_100025229 Ga0068871_1000252295 114
83 3300006358 Ga0068871_100631313 Ga0068871_1006313132 114
84 3300006881 Ga0068865_100007544 Ga0068865_1000075442 114
85 3300006914 Ga0075436_100102773 Ga0075436_1001027732 114
86 3300006931 Ga0097620_100011260 Ga0097620_1000112605 114
87 3300007265 Ga0099794_10002316 Ga0099794_100023166 114
88 3300007265 Ga0099794_10065599 Ga0099794_100655992 114
89 3300007265 Ga0099794_10230905 Ga0099794_102309051 114
90 3300009098 Ga0105245_11560083 Ga0105245_115600832 114
91 3300009174 Ga0105241_10227798 Ga0105241_102277983 114
92 3300009174 Ga0105241_11064885 Ga0105241_110648852 114
93 3300009177 Ga0105248_10238820 Ga0105248_102388203 114
94 3300009553 Ga0105249_10954347 Ga0105249_109543472 114
95 3300011119 Ga0105246_11509936 Ga0105246_115099361 114
96 3300013100 Ga0157373_10449758 Ga0157373_104497582 114
97 3300013296 Ga0157374_11011642 Ga0157374_110116422 114
98 3300013297 Ga0157378_10406147 Ga0157378_104061472 114
99 3300014968 Ga0157379_10010460 Ga0157379_100104605 114
100 3300014969 Ga0157376_10000468 Ga0157376_1000046811 114
101 3300022732 Ga0224569_100006 Ga0224569_1000064 114
102 3300022734 Ga0224571_100154 Ga0224571_1001543 114
103 3300024225 Ga0224572_1012123 Ga0224572_10121232 114
104 3300024227 Ga0228598_1000014 Ga0228598_100001414 114
105 3300024227 Ga0228598_1001186 Ga0228598_10011865 114
106 3300024227 Ga0228598_1034495 Ga0228598_10344952 114
107 3300025898 Ga0207692_10999058 Ga0207692_109990581 114
108 3300025904 Ga0207647_10129223 Ga0207647_101292232 114
109 3300025906 Ga0207699_10007334 Ga0207699_100073345 114
110 3300025906 Ga0207699_10080363 Ga0207699_100803634 114
111 3300025910 Ga0207684_10001145 Ga0207684_1000114510 114
112 3300025911 Ga0207654_10150932 Ga0207654_101509323 114
113 3300025911 Ga0207654_11312243 Ga0207654_113122432 114
114 3300025915 Ga0207693_10000243 Ga0207693_1000024328 114
115 3300025915 Ga0207693_11154117 Ga0207693_111541171 114
116 3300025916 Ga0207663_10011181 Ga0207663_100111814 114
117 3300025916 Ga0207663_10116327 Ga0207663_101163273 114
118 3300025916 Ga0207663_10216120 Ga0207663_102161202 114
119 3300025928 Ga0207700_10246082 Ga0207700_102460823 114
120 3300025929 Ga0207664_10426448 Ga0207664_104264482 114
121 3300025933 Ga0207706_10281695 Ga0207706_102816952 114
122 3300025936 Ga0207670_10759502 Ga0207670_107595022 114
123 3300025938 Ga0207704_10001355 Ga0207704_100013555 114
124 3300025939 Ga0207665_10000014 Ga0207665_1000001473 114
125 3300025939 Ga0207665_10065208 Ga0207665_100652082 114
126 3300025939 Ga0207665_10225084 Ga0207665_102250842 114
127 3300025939 Ga0207665_10298036 Ga0207665_102980362 114
128 3300025942 Ga0207689_10002521 Ga0207689_100025214 114
129 3300025942 Ga0207689_10789137 Ga0207689_107891372 114
130 3300025961 Ga0207712_11341768 Ga0207712_113417681 114
131 3300025986 Ga0207658_10243884 Ga0207658_102438842 114
132 3300026023 Ga0207677_11734402 Ga0207677_117344022 114
133 3300026035 Ga0207703_10442489 Ga0207703_104424892 114
134 3300026088 Ga0207641_10006923 Ga0207641_100069238 114
135 3300026089 Ga0207648_10102870 Ga0207648_101028702 114
136 3300027671 Ga0209588_1008116 Ga0209588_10081165 114
137 3300027671 Ga0209588_1010295 Ga0209588_10102952 114
138 3300027671 Ga0209588_1026497 Ga0209588_10264972 114
139 3300027671 Ga0209588_1183180 Ga0209588_11831802 114
140 3300027671 Ga0209588_1186832 Ga0209588_11868322 114
141 3300028016 Ga0265354_1000482 Ga0265354_10004824 114
142 3300028016 Ga0265354_1000612 Ga0265354_10006125 114
143 3300028017 Ga0265356_1006001 Ga0265356_10060012 114
144 3300028380 Ga0268265_10391778 Ga0268265_103917782 114
145 3300030760 Ga0265762_1000045 Ga0265762_10000456 114
146 3300030878 Ga0265770_1023705 Ga0265770_10237052 114
147 3300030878 Ga0265770_1037867 Ga0265770_10378672 114
148 3300030879 Ga0265765_1000148 Ga0265765_10001482 114
149 3300031090 Ga0265760_10000351 Ga0265760_100003517 114
150 3300031090 Ga0265760_10031453 Ga0265760_100314532 114
151 3300031090 Ga0265760_10090250 Ga0265760_100902502 114
152 3300031090 Ga0265760_10090263 Ga0265760_100902632 114
153 3300031241 Ga0265325_10332405 Ga0265325_103324051 114
154 3300031247 Ga0265340_10105904 Ga0265340_101059042 114
155 3300031249 Ga0265339_10143977 Ga0265339_101439772 114
156 3300031344 Ga0265316_10006361 Ga0265316_100063612 114
157 3300031711 Ga0265314_10027116 Ga0265314_100271164 114
158 3300033547 Ga0316212_1000826 Ga0316212_10008264 114
159 3300033547 Ga0316212_1006626 Ga0316212_10066262 114
160 3300035086 Ga0373934_0057103 Ga0373934_0057103_546_890 114
161 3300035172 Ga0373955_0588701 Ga0373955_0588701_179_523 114
162 3300035410 Ga0373924_0474094 Ga0373924_0474094_100_444 114
163 3300035695 Ga0373927_0620806 Ga0373927_0620806_22_366 114
164 3300035724 Ga0373933_0431163 Ga0373933_0431163_345_689 114
165 3300036401 Ga0373937_0342245 Ga0373937_0342245_833_1177 114
166 3300036401 Ga0373937_1593376 Ga0373937_1593376_161_505 114
167 3300046455 Ga0495603_0143356 Ga0495603_0143356_613_957 114
168 3300046461 Ga0495641_0041799 Ga0495641_0041799_755_1099 114
169 3300046461 Ga0495641_0196330 Ga0495641_0196330_233_577 114
170 3300046472 Ga0495580_0000989 Ga0495580_0000989_9196_9540 114
171 3300046472 Ga0495580_0085339 Ga0495580_0085339_28_372 114
172 3300046472 Ga0495580_0173498 Ga0495580_0173498_336_680 114
173 3300046473 Ga0495582_0000279 Ga0495582_0000279_12396_12740 114
174 3300046473 Ga0495582_0044345 Ga0495582_0044345_901_1245 114
175 3300046475 Ga0495639_0022153 Ga0495639_0022153_510_854 114
176 3300046476 Ga0495662_0224808 Ga0495662_0224808_35_379 114
177 3300046477 Ga0495664_0215064 Ga0495664_0215064_112_456 114
178 3300046499 Ga0495594_0077659 Ga0495594_0077659_1053_1397 114
179 3300046511 Ga0495608_0487637 Ga0495608_0487637_122_466 114
180 3300046514 Ga0495618_0210338 Ga0495618_0210338_464_808 114
181 3300046517 Ga0495630_0928219 Ga0495630_0928219_207_551 114
182 3300046526 Ga0495666_0098773 Ga0495666_0098773_1017_1361 114
183 3300046531 Ga0495665_0061306 Ga0495665_0061306_755_1099 114
184 3300046533 Ga0495640_0044123 Ga0495640_0044123_1016_1360 114
185 3300046535 Ga0495586_0634074 Ga0495586_0634074_30_374 114
186 3300046557 Ga0495622_0212003 Ga0495622_0212003_483_827 114
187 3300046557 Ga0495622_0222996 Ga0495622_0222996_364_708 114
188 3300046559 Ga0495667_0257112 Ga0495667_0257112_681_1025 114
189 3300046642 Ga0495634_0096163 Ga0495634_0096163_571_915 114
190 3300046675 Ga0495657_0827285 Ga0495657_0827285_92_436 114
191 3300046681 Ga0495647_0071648 Ga0495647_0071648_182_526 114
192 3300046683 Ga0495658_0030103 Ga0495658_0030103_986_1330 114
193 3300046689 Ga0495613_0302658 Ga0495613_0302658_306_650 114
194 3300047319 Ga0495674_0074300 Ga0495674_0074300_927_1271 114
195 3300047321 Ga0495676_0017780 Ga0495676_0017780_392_736 114
196 3300047322 Ga0495680_0011742 Ga0495680_0011742_112_456 114
197 3300048088 Ga0495602_0459037 Ga0495602_0459037_255_599 114
198 3300048903 Ga0496100_0083962 Ga0496100_0083962_1293_1637 114
199 3300048904 Ga0496101_0144915 Ga0496101_0144915_1343_1687 114
200 3300048904 Ga0496101_0277549 Ga0496101_0277549_734_1078 114
201 3300048908 Ga0496105_0252652 Ga0496105_0252652_474_818 114
202 3300048910 Ga0496107_0080901 Ga0496107_0080901_765_1109 114
203 3300048917 Ga0496114_0127893 Ga0496114_0127893_1427_1771 114
204 3300048918 Ga0496115_0053356 Ga0496115_0053356_1139_1483 114
205 3300048918 Ga0496115_0264544 Ga0496115_0264544_1010_1354 114
206 3300005467 Ga0070706_100009269 Ga0070706_1000092692 117
207 3300005536 Ga0070697_101676710 Ga0070697_1016767101 117
208 3300025922 Ga0207646_10587421 Ga0207646_105874212 117
209 2088090003 LJN_F6ESG4R02H5D7C LJN_00124650 118
210 3300005338 Ga0068868_100394493 Ga0068868_1003944932 118
211 3300005439 Ga0070711_100000387 Ga0070711_10000038713 118
212 3300005439 Ga0070711_101599647 Ga0070711_1015996471 118
213 3300005445 Ga0070708_101318585 Ga0070708_1013185851 118
214 3300005535 Ga0070684_100708136 Ga0070684_1007081361 118
215 3300005536 Ga0070697_100071841 Ga0070697_1000718412 118
216 3300005539 Ga0068853_102236258 Ga0068853_1022362581 118
217 3300005843 Ga0068860_100089113 Ga0068860_1000891132 118
218 3300006163 Ga0070715_10413715 Ga0070715_104137151 118
219 3300006173 Ga0070716_100035352 Ga0070716_1000353523 118
220 3300006237 Ga0097621_100125668 Ga0097621_1001256683 118
221 3300006358 Ga0068871_100239929 Ga0068871_1002399292 118
222 3300006871 Ga0075434_100297461 Ga0075434_1002974612 118
223 3300007076 Ga0075435_100491763 Ga0075435_1004917632 118
224 3300007265 Ga0099794_10009854 Ga0099794_100098545 118
225 3300007265 Ga0099794_10058401 Ga0099794_100584012 118
226 3300007265 Ga0099794_10077274 Ga0099794_100772742 118
227 3300007265 Ga0099794_10447852 Ga0099794_104478522 118
228 3300007788 Ga0099795_10037826 Ga0099795_100378263 118
229 3300007788 Ga0099795_10152980 Ga0099795_101529801 118
230 3300009093 Ga0105240_10423504 Ga0105240_104235042 118
231 3300009098 Ga0105245_10226632 Ga0105245_102266322 118
232 3300009098 Ga0105245_10343371 Ga0105245_103433712 118
233 3300009101 Ga0105247_10138731 Ga0105247_101387312 118
234 3300009174 Ga0105241_10531454 Ga0105241_105314542 118
235 3300009177 Ga0105248_10155252 Ga0105248_101552522 118
236 3300009177 Ga0105248_10390096 Ga0105248_103900961 118
237 3300009545 Ga0105237_10126788 Ga0105237_101267882 118
238 3300009545 Ga0105237_10192094 Ga0105237_101920942 118
239 3300009551 Ga0105238_10125095 Ga0105238_101250953 118
240 3300009553 Ga0105249_11123181 Ga0105249_111231812 118
241 3300010159 Ga0099796_10081712 Ga0099796_100817122 118
242 3300010159 Ga0099796_10142994 Ga0099796_101429942 118
243 3300010159 Ga0099796_10144586 Ga0099796_101445862 118
244 3300010375 Ga0105239_10043256 Ga0105239_100432563 118
245 3300013105 Ga0157369_10940676 Ga0157369_109406762 118
246 3300013296 Ga0157374_10002043 Ga0157374_1000204316 118
247 3300013296 Ga0157374_10085981 Ga0157374_100859814 118
248 3300013297 Ga0157378_10970990 Ga0157378_109709902 118
249 3300013306 Ga0163162_10001103 Ga0163162_100011037 118
250 3300013306 Ga0163162_10001732 Ga0163162_100017323 118
251 3300013308 Ga0157375_10000276 Ga0157375_100002762 118
252 3300014325 Ga0163163_10387149 Ga0163163_103871492 118
253 3300014968 Ga0157379_10051992 Ga0157379_100519923 118
254 3300014968 Ga0157379_10207903 Ga0157379_102079032 118
255 3300014968 Ga0157379_11234721 Ga0157379_112347212 118
256 3300014969 Ga0157376_10379866 Ga0157376_103798662 118
257 3300014969 Ga0157376_10394753 Ga0157376_103947532 118
258 3300014969 Ga0157376_12098547 Ga0157376_120985471 118
259 3300025900 Ga0207710_10168723 Ga0207710_101687232 118
260 3300025905 Ga0207685_10399144 Ga0207685_103991442 118
261 3300025913 Ga0207695_10415759 Ga0207695_104157592 118
262 3300025915 Ga0207693_10443215 Ga0207693_104432152 118
263 3300025915 Ga0207693_10730058 Ga0207693_107300582 118
264 3300025916 Ga0207663_10611330 Ga0207663_106113301 118
265 3300025924 Ga0207694_10133482 Ga0207694_101334822 118
266 3300025928 Ga0207700_10148038 Ga0207700_101480382 118
267 3300025939 Ga0207665_10071805 Ga0207665_100718052 118
268 3300026023 Ga0207677_10299490 Ga0207677_102994902 118
269 3300027512 Ga0209179_1036599 Ga0209179_10365992 118
270 3300027671 Ga0209588_1033683 Ga0209588_10336833 118
271 3300027671 Ga0209588_1059712 Ga0209588_10597122 118
272 3300028023 Ga0265357_1013183 Ga0265357_10131832 118
273 3300028381 Ga0268264_10114264 Ga0268264_101142643 118
274 3300030763 Ga0265763_1011694 Ga0265763_10116942 118
275 3300030878 Ga0265770_1004220 Ga0265770_10042203 118
276 3300031090 Ga0265760_10001431 Ga0265760_100014314 118
277 3300035088 Ga0373940_0045180 Ga0373940_0045180_27_383 118
278 3300035113 Ga0373936_0217706 Ga0373936_0217706_375_734 118
279 3300035691 Ga0373931_0263180 Ga0373931_0263180_650_1006 118
280 3300035691 Ga0373931_0444791 Ga0373931_0444791_92_448 118
281 3300035724 Ga0373933_1013452 Ga0373933_1013452_19_378 118
282 3300037068 Ga0373925_0042468 Ga0373925_0042468_2035_2394 118
283 3300046472 Ga0495580_0027047 Ga0495580_0027047_1603_1959 118
284 3300046642 Ga0495634_0296906 Ga0495634_0296906_11_370 118
285 3300046663 Ga0495635_0086744 Ga0495635_0086744_710_1069 118
286 3300046683 Ga0495658_0415621 Ga0495658_0415621_452_811 118
287 3300047322 Ga0495680_0211893 Ga0495680_0211893_542_901 118
288 3300047471 Ga0495684_0848468 Ga0495684_0848468_168_527 118
289 3300048903 Ga0496100_0153836 Ga0496100_0153836_368_724 118
290 3300048903 Ga0496100_0294309 Ga0496100_0294309_11_370 118
291 3300048903 Ga0496100_1092890 Ga0496100_1092890_98_454 118
292 3300048904 Ga0496101_0024605 Ga0496101_0024605_415_774 118
293 3300048905 Ga0496102_0000662 Ga0496102_0000662_10028_10384 118
294 3300048906 Ga0496103_0018238 Ga0496103_0018238_1867_2223 118
295 3300048907 Ga0496104_0046642 Ga0496104_0046642_1454_1810 118
296 3300048907 Ga0496104_0063829 Ga0496104_0063829_2111_2467 118
297 3300048908 Ga0496105_0257008 Ga0496105_0257008_223_582 118
298 3300048909 Ga0496106_0013290 Ga0496106_0013290_4115_4471 118
299 3300048910 Ga0496107_0453697 Ga0496107_0453697_415_774 118
300 3300048913 Ga0496110_0251432 Ga0496110_0251432_888_1244 118
301 3300048915 Ga0496112_0000961 Ga0496112_0000961_10947_11303 118
302 3300048915 Ga0496112_0134516 Ga0496112_0134516_666_1022 118
303 3300048915 Ga0496112_0175036 Ga0496112_0175036_612_968 118
304 3300048917 Ga0496114_0032061 Ga0496114_0032061_737_1096 118
305 3300048918 Ga0496115_0021635 Ga0496115_0021635_1615_1974 118
306 3300048918 Ga0496115_0451380 Ga0496115_0451380_139_498 118
307 3300050512 nmdc:mga0n895_845895_c1 nmdc:mga0n895_845895_c1_229_585 118
308 3300050514 nmdc:mga08x19_59351_c1 nmdc:mga08x19_59351_c1_1277_1633 118
309 3300053077 Ga0495601_0653785 Ga0495601_0653785_252_611 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00576

Transthyretin

HIUase/Transthyretin family

9

118

0.98

PF24695

8

83

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gpz-assembly1.cif.gz_A transthyretin-like protein from salmonella dublin 0.9561 7 118
6fxu-assembly1.cif.gz_B-2 crystal structure of human transthyretin mutant t119m at ph 5.5 0.9535 7 117
6xtk-assembly1.cif.gz_B-2 y114c transthyretin structure in complex with tolcalpone 0.9531 7 117
2g5u-assembly1.cif.gz_B-2 human transthyretin (ttr) complexed with hydroxylated polychlorinated biphenyl-4,4'-dihydroxy-3,3',5,5'-tetrachlorobiphenyl 0.9519 7 117
3tfb-assembly1.cif.gz_B-2 transthyretin natural mutant a25t 0.9511 7 117
ID Description Score Start End Superfamily
2gpzC00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9561 7 118 2.60.40.180
af_A1Z8C9_1_111_2.60.40.180 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9454 5 116 2.60.40.180
2gpzC00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9393 7 118 2.60.40.180
3qvaD00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.935 7 118 2.60.40.180
3iwvA00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9334 7 118 2.60.40.180
ID Description Score Start End GO Terms
AF-A0A2V9F3G1-F1-model_v4 5-hydroxyisourate hydrolase (HIU hydrolase) (HIUHase) (EC 3.5.2.17) 0.9962 5 118 GO:0006144
GO:0033971
AF-A0A7Y5RFE8-F1-model_v4 5-hydroxyisourate hydrolase (HIU hydrolase) (HIUHase) (EC 3.5.2.17) 0.9921 7 118 GO:0006144
GO:0033971
AF-A0A2V9U5H1-F1-model_v4 5-hydroxyisourate hydrolase (HIU hydrolase) (HIUHase) (EC 3.5.2.17) 0.9904 5 118 GO:0006144
GO:0033971
AF-A0A2V9F3G1-F1-model_v4 5-hydroxyisourate hydrolase (HIU hydrolase) (HIUHase) (EC 3.5.2.17) 0.9875 5 118 GO:0006144
GO:0033971
AF-A0A2J4YIF3-F1-model_v4 5-hydroxyisourate hydrolase (HIU hydrolase) (HIUHase) (EC 3.5.2.17) 0.983 9 95 GO:0006144
GO:0033971

Feature Viewer

pLDDT pTM Quality
91.65 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map