F400049
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 309 | 172 | 309 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100394493|Ga0068868_1003944932 |
| Length | 119 |
| Sequence | MALGIKKRVSTHVLDTTLGKPAVGITVHLERRQPSGNWSVLETARTDEDGRCSQLLPDEAALTTGFYRLVFDTHSYFADMRIANLYPVVEVTFQVRDGESHFHIPLLLSPNGYTTYRGT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090003 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 15 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 27 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 28 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 29 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 34 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 47 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 48 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 70 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 71 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 72 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 73 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 104 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 105 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 106 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 114 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 115 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 117 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 119 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 120 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 121 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 122 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 123 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 124 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 125 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 126 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 127 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 161 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 162 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 163 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 164 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 165 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 166 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 169 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 170 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.44 |
| Metatranscriptomes | 3.56 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.41 |
| Rhizosphere | 90.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJN_F6ESG4R02H5D7C | 2088090003 | Bacteria | 509 |
| 2 | LJNas_1000787 | 3300000546 | Bacteria | 5287 |
| 3 | Ga0068869_100002628 | 3300005334 | Bacteria | 10848 |
| 4 | Ga0068869_100910826 | 3300005334 | Bacteria | 761 |
| 5 | Ga0068868_100153533 | 3300005338 | Bacteria | 1897 |
| 6 | Ga0068868_100394493 | 3300005338 | Viruses | 1193 |
| 7 | Ga0070689_100139166 | 3300005340 | Bacteria | 1951 |
| 8 | Ga0070667_100248075 | 3300005367 | Bacteria | 1591 |
| 9 | Ga0070709_10012646 | 3300005434 | Bacteria | 4728 |
| 10 | Ga0070709_10096080 | 3300005434 | Unclassified | 1964 |
| 11 | Ga0070709_11084503 | 3300005434 | Bacteria | 640 |
| 12 | Ga0070713_100284744 | 3300005436 | Unclassified | 1517 |
| 13 | Ga0070713_100430588 | 3300005436 | Bacteria | 1236 |
| 14 | Ga0070713_100570984 | 3300005436 | Bacteria | 1072 |
| 15 | Ga0070713_101110808 | 3300005436 | Bacteria | 764 |
| 16 | Ga0070710_11392613 | 3300005437 | Unclassified | 524 |
| 17 | Ga0070711_100000387 | 3300005439 | Bacteria | 22724 |
| 18 | Ga0070711_100104783 | 3300005439 | Bacteria | 2064 |
| 19 | Ga0070711_101599647 | 3300005439 | Unclassified | 570 |
| 20 | Ga0070708_100002259 | 3300005445 | Bacteria | 14893 |
| 21 | Ga0070708_100002984 | 3300005445 | Bacteria | 13148 |
| 22 | Ga0070708_100022811 | 3300005445 | Bacteria | 5314 |
| 23 | Ga0070708_100461817 | 3300005445 | Unclassified | 1198 |
| 24 | Ga0070708_101318585 | 3300005445 | Unclassified | 674 |
| 25 | Ga0070663_100896608 | 3300005455 | Unclassified | 766 |
| 26 | Ga0070662_100093498 | 3300005457 | Bacteria | 2262 |
| 27 | Ga0068867_100085863 | 3300005459 | Bacteria | 2380 |
| 28 | Ga0070685_10021616 | 3300005466 | Bacteria | 3499 |
| 29 | Ga0070706_100000188 | 3300005467 | Bacteria | 78186 |
| 30 | Ga0070706_100009269 | 3300005467 | Bacteria | 9170 |
| 31 | Ga0070706_100230184 | 3300005467 | Unclassified | 1730 |
| 32 | Ga0070706_100261068 | 3300005467 | Bacteria | 1617 |
| 33 | Ga0070707_100001742 | 3300005468 | Bacteria | 20957 |
| 34 | Ga0070707_100216976 | 3300005468 | Bacteria | 1864 |
| 35 | Ga0070707_100272194 | 3300005468 | Bacteria | 1646 |
| 36 | Ga0070698_100001030 | 3300005471 | Bacteria | 30633 |
| 37 | Ga0070698_100089821 | 3300005471 | Bacteria | 3056 |
| 38 | Ga0070698_100644976 | 3300005471 | Unclassified | 1000 |
| 39 | Ga0070699_100001065 | 3300005518 | Bacteria | 25521 |
| 40 | Ga0070699_100067493 | 3300005518 | Unclassified | 3106 |
| 41 | Ga0070684_100708136 | 3300005535 | Unclassified | 939 |
| 42 | Ga0070697_100000146 | 3300005536 | Bacteria | 57392 |
| 43 | Ga0070697_100000473 | 3300005536 | Bacteria | 30639 |
| 44 | Ga0070697_100001570 | 3300005536 | Bacteria | 17415 |
| 45 | Ga0070697_100071841 | 3300005536 | Unclassified | 2839 |
| 46 | Ga0070697_100671660 | 3300005536 | Bacteria | 913 |
| 47 | Ga0070697_101676710 | 3300005536 | Bacteria | 569 |
| 48 | Ga0068853_102236258 | 3300005539 | Unclassified | 530 |
| 49 | Ga0070686_100516409 | 3300005544 | Unclassified | 929 |
| 50 | Ga0070695_100239948 | 3300005545 | Bacteria | 1314 |
| 51 | Ga0070665_100253324 | 3300005548 | Bacteria | 1761 |
| 52 | Ga0068859_100011260 | 3300005617 | Bacteria | 9001 |
| 53 | Ga0068866_10194248 | 3300005718 | Bacteria | 1208 |
| 54 | Ga0068861_100157537 | 3300005719 | Bacteria | 1870 |
| 55 | Ga0068851_10548281 | 3300005834 | Unclassified | 698 |
| 56 | Ga0068863_100385974 | 3300005841 | Bacteria | 1368 |
| 57 | Ga0068858_100007248 | 3300005842 | Bacteria | 10742 |
| 58 | Ga0068858_100461345 | 3300005842 | Bacteria | 1225 |
| 59 | Ga0068860_100089113 | 3300005843 | Bacteria | 2937 |
| 60 | Ga0068862_100423432 | 3300005844 | Bacteria | 1250 |
| 61 | Ga0081540_1232402 | 3300005983 | Bacteria | 650 |
| 62 | Ga0070717_10001310 | 3300006028 | Bacteria | 17033 |
| 63 | Ga0070717_10002087 | 3300006028 | Bacteria | 14001 |
| 64 | Ga0070717_10057307 | 3300006028 | Bacteria | 3220 |
| 65 | Ga0070717_10535012 | 3300006028 | Unclassified | 1061 |
| 66 | Ga0070715_10024396 | 3300006163 | Bacteria | 2382 |
| 67 | Ga0070715_10040314 | 3300006163 | Bacteria | 1951 |
| 68 | Ga0070715_10063765 | 3300006163 | Bacteria | 1625 |
| 69 | Ga0070715_10413715 | 3300006163 | Unclassified | 752 |
| 70 | Ga0070716_100000121 | 3300006173 | Bacteria | 30983 |
| 71 | Ga0070716_100035352 | 3300006173 | Bacteria | 2747 |
| 72 | Ga0070716_100077197 | 3300006173 | Bacteria | 1976 |
| 73 | Ga0070712_100002109 | 3300006175 | Bacteria | 12218 |
| 74 | Ga0070712_100158813 | 3300006175 | Bacteria | 1744 |
| 75 | Ga0070712_100992972 | 3300006175 | Unclassified | 726 |
| 76 | Ga0070712_101355280 | 3300006175 | Bacteria | 620 |
| 77 | Ga0097621_100125668 | 3300006237 | Unclassified | 2178 |
| 78 | Ga0097621_100374588 | 3300006237 | Bacteria | 1270 |
| 79 | Ga0097621_100615830 | 3300006237 | Unclassified | 993 |
| 80 | Ga0068871_100019656 | 3300006358 | Bacteria | 5160 |
| 81 | Ga0068871_100025229 | 3300006358 | Bacteria | 4621 |
| 82 | Ga0068871_100239929 | 3300006358 | Viruses | 1576 |
| 83 | Ga0068871_100631313 | 3300006358 | Unclassified | 976 |
| 84 | Ga0075431_100315602 | 3300006847 | Bacteria | 1577 |
| 85 | Ga0075434_100297461 | 3300006871 | Bacteria | 1634 |
| 86 | Ga0068865_100007544 | 3300006881 | Bacteria | 6695 |
| 87 | Ga0075436_100102773 | 3300006914 | Unclassified | 1991 |
| 88 | Ga0097620_100011260 | 3300006931 | Bacteria | 9001 |
| 89 | Ga0075435_100491763 | 3300007076 | Bacteria | 1060 |
| 90 | Ga0099794_10002316 | 3300007265 | Bacteria | 6992 |
| 91 | Ga0099794_10009854 | 3300007265 | Bacteria | 4038 |
| 92 | Ga0099794_10058401 | 3300007265 | Bacteria | 1870 |
| 93 | Ga0099794_10065599 | 3300007265 | Unclassified | 1770 |
| 94 | Ga0099794_10077274 | 3300007265 | Unclassified | 1637 |
| 95 | Ga0099794_10230905 | 3300007265 | Unclassified | 952 |
| 96 | Ga0099794_10447852 | 3300007265 | Unclassified | 677 |
| 97 | Ga0099795_10037826 | 3300007788 | Archaea | 1700 |
| 98 | Ga0099795_10152980 | 3300007788 | Bacteria | 946 |
| 99 | Ga0105240_10288043 | 3300009093 | Bacteria | 1884 |
| 100 | Ga0105240_10423504 | 3300009093 | Viruses | 1495 |
| 101 | Ga0105245_10226632 | 3300009098 | Bacteria | 1806 |
| 102 | Ga0105245_10343371 | 3300009098 | Bacteria | 1477 |
| 103 | Ga0105245_11560083 | 3300009098 | Bacteria | 712 |
| 104 | Ga0105247_10138731 | 3300009101 | Bacteria | 1591 |
| 105 | Ga0105241_10227798 | 3300009174 | Bacteria | 1570 |
| 106 | Ga0105241_10531454 | 3300009174 | Unclassified | 1053 |
| 107 | Ga0105241_11064885 | 3300009174 | Unclassified | 760 |
| 108 | Ga0105248_10155252 | 3300009177 | Bacteria | 2582 |
| 109 | Ga0105248_10238820 | 3300009177 | Bacteria | 2046 |
| 110 | Ga0105248_10390096 | 3300009177 | Bacteria | 1568 |
| 111 | Ga0105248_11115389 | 3300009177 | Unclassified | 892 |
| 112 | Ga0105237_10126788 | 3300009545 | Bacteria | 2547 |
| 113 | Ga0105237_10192094 | 3300009545 | Bacteria | 2041 |
| 114 | Ga0105238_10125095 | 3300009551 | Unclassified | 2550 |
| 115 | Ga0105238_10871649 | 3300009551 | Unclassified | 918 |
| 116 | Ga0105249_10954347 | 3300009553 | Bacteria | 925 |
| 117 | Ga0105249_11123181 | 3300009553 | Unclassified | 856 |
| 118 | Ga0099796_10081712 | 3300010159 | Bacteria | 1186 |
| 119 | Ga0099796_10142994 | 3300010159 | Bacteria | 936 |
| 120 | Ga0099796_10144586 | 3300010159 | Archaea | 932 |
| 121 | Ga0105239_10043256 | 3300010375 | Bacteria | 4936 |
| 122 | Ga0105246_11509936 | 3300011119 | Unclassified | 631 |
| 123 | Ga0157373_10449758 | 3300013100 | Unclassified | 927 |
| 124 | Ga0157369_10940676 | 3300013105 | Unclassified | 886 |
| 125 | Ga0157374_10002043 | 3300013296 | Bacteria | 16962 |
| 126 | Ga0157374_10085981 | 3300013296 | Bacteria | 2991 |
| 127 | Ga0157374_11011642 | 3300013296 | Bacteria | 850 |
| 128 | Ga0157378_10406147 | 3300013297 | Bacteria | 1343 |
| 129 | Ga0157378_10970990 | 3300013297 | Unclassified | 883 |
| 130 | Ga0163162_10001103 | 3300013306 | Bacteria | 25047 |
| 131 | Ga0163162_10001732 | 3300013306 | Bacteria | 20439 |
| 132 | Ga0163162_13148187 | 3300013306 | Unclassified | 530 |
| 133 | Ga0157375_10000276 | 3300013308 | Bacteria | 46617 |
| 134 | Ga0163163_10387149 | 3300014325 | Viruses | 1456 |
| 135 | Ga0157379_10010460 | 3300014968 | Bacteria | 8088 |
| 136 | Ga0157379_10051992 | 3300014968 | Bacteria | 3658 |
| 137 | Ga0157379_10207903 | 3300014968 | Bacteria | 1771 |
| 138 | Ga0157379_11234721 | 3300014968 | Unclassified | 720 |
| 139 | Ga0157376_10000468 | 3300014969 | Bacteria | 25990 |
| 140 | Ga0157376_10344376 | 3300014969 | Bacteria | 1424 |
| 141 | Ga0157376_10379866 | 3300014969 | Bacteria | 1361 |
| 142 | Ga0157376_10394753 | 3300014969 | Unclassified | 1336 |
| 143 | Ga0157376_12098547 | 3300014969 | Unclassified | 603 |
| 144 | Ga0224569_100006 | 3300022732 | Bacteria | 13133 |
| 145 | Ga0224571_100154 | 3300022734 | Unclassified | 3044 |
| 146 | Ga0224572_1012123 | 3300024225 | Bacteria | 1635 |
| 147 | Ga0228598_1000014 | 3300024227 | Bacteria | 23932 |
| 148 | Ga0228598_1001186 | 3300024227 | Bacteria | 5743 |
| 149 | Ga0228598_1034495 | 3300024227 | Unclassified | 998 |
| 150 | Ga0207692_10999058 | 3300025898 | Unclassified | 552 |
| 151 | Ga0207710_10168723 | 3300025900 | Unclassified | 1069 |
| 152 | Ga0207647_10129223 | 3300025904 | Bacteria | 1485 |
| 153 | Ga0207685_10399144 | 3300025905 | Unclassified | 704 |
| 154 | Ga0207699_10007334 | 3300025906 | Bacteria | 5389 |
| 155 | Ga0207699_10080363 | 3300025906 | Bacteria | 2020 |
| 156 | Ga0207684_10000498 | 3300025910 | Bacteria | 49771 |
| 157 | Ga0207684_10001145 | 3300025910 | Bacteria | 29602 |
| 158 | Ga0207654_10150932 | 3300025911 | Bacteria | 1491 |
| 159 | Ga0207654_11312243 | 3300025911 | Unclassified | 528 |
| 160 | Ga0207695_10415759 | 3300025913 | Viruses | 1229 |
| 161 | Ga0207693_10000243 | 3300025915 | Bacteria | 50405 |
| 162 | Ga0207693_10443215 | 3300025915 | Unclassified | 1015 |
| 163 | Ga0207693_10730058 | 3300025915 | Bacteria | 766 |
| 164 | Ga0207693_11154117 | 3300025915 | Unclassified | 586 |
| 165 | Ga0207663_10011181 | 3300025916 | Bacteria | 4810 |
| 166 | Ga0207663_10116327 | 3300025916 | Bacteria | 1823 |
| 167 | Ga0207663_10216120 | 3300025916 | Bacteria | 1392 |
| 168 | Ga0207663_10611330 | 3300025916 | Viruses | 857 |
| 169 | Ga0207646_10000557 | 3300025922 | Bacteria | 49083 |
| 170 | Ga0207646_10587421 | 3300025922 | Bacteria | 1000 |
| 171 | Ga0207694_10133482 | 3300025924 | Viruses | 1991 |
| 172 | Ga0207694_11670843 | 3300025924 | Unclassified | 536 |
| 173 | Ga0207700_10148038 | 3300025928 | Bacteria | 1938 |
| 174 | Ga0207700_10246082 | 3300025928 | Unclassified | 1526 |
| 175 | Ga0207700_10422076 | 3300025928 | Bacteria | 1172 |
| 176 | Ga0207664_10426448 | 3300025929 | Bacteria | 1182 |
| 177 | Ga0207706_10281695 | 3300025933 | Bacteria | 1450 |
| 178 | Ga0207670_10759502 | 3300025936 | Unclassified | 806 |
| 179 | Ga0207670_11531583 | 3300025936 | Unclassified | 567 |
| 180 | Ga0207704_10001355 | 3300025938 | Bacteria | 10940 |
| 181 | Ga0207665_10000014 | 3300025939 | Bacteria | 137803 |
| 182 | Ga0207665_10065208 | 3300025939 | Bacteria | 2476 |
| 183 | Ga0207665_10071805 | 3300025939 | Bacteria | 2363 |
| 184 | Ga0207665_10225084 | 3300025939 | Bacteria | 1376 |
| 185 | Ga0207665_10298036 | 3300025939 | Bacteria | 1204 |
| 186 | Ga0207711_10790816 | 3300025941 | Unclassified | 884 |
| 187 | Ga0207689_10002521 | 3300025942 | Bacteria | 17012 |
| 188 | Ga0207689_10789137 | 3300025942 | Bacteria | 802 |
| 189 | Ga0207712_11341768 | 3300025961 | Unclassified | 639 |
| 190 | Ga0207658_10243884 | 3300025986 | Bacteria | 1524 |
| 191 | Ga0207677_10299490 | 3300026023 | Viruses | 1328 |
| 192 | Ga0207677_11734402 | 3300026023 | Unclassified | 579 |
| 193 | Ga0207703_10442489 | 3300026035 | Bacteria | 1213 |
| 194 | Ga0207678_10534118 | 3300026067 | Unclassified | 1024 |
| 195 | Ga0207641_10006923 | 3300026088 | Bacteria | 9489 |
| 196 | Ga0207648_10102870 | 3300026089 | Bacteria | 2504 |
| 197 | Ga0207698_10682920 | 3300026142 | Bacteria | 1020 |
| 198 | Ga0209179_1036599 | 3300027512 | Bacteria | 1023 |
| 199 | Ga0209588_1008116 | 3300027671 | Bacteria | 3107 |
| 200 | Ga0209588_1010295 | 3300027671 | Bacteria | 2810 |
| 201 | Ga0209588_1026497 | 3300027671 | Bacteria | 1841 |
| 202 | Ga0209588_1033683 | 3300027671 | Bacteria | 1643 |
| 203 | Ga0209588_1059712 | 3300027671 | Unclassified | 1233 |
| 204 | Ga0209588_1183180 | 3300027671 | Unclassified | 657 |
| 205 | Ga0209588_1186832 | 3300027671 | Unclassified | 649 |
| 206 | Ga0265354_1000482 | 3300028016 | Bacteria | 6926 |
| 207 | Ga0265354_1000612 | 3300028016 | Bacteria | 6019 |
| 208 | Ga0265356_1006001 | 3300028017 | Bacteria | 1432 |
| 209 | Ga0265357_1013183 | 3300028023 | Eukaryota | 857 |
| 210 | Ga0268265_10391778 | 3300028380 | Bacteria | 1281 |
| 211 | Ga0268264_10114264 | 3300028381 | Bacteria | 2370 |
| 212 | Ga0265762_1000045 | 3300030760 | Bacteria | 14984 |
| 213 | Ga0265763_1011694 | 3300030763 | Unclassified | 828 |
| 214 | Ga0265770_1004220 | 3300030878 | Unclassified | 1958 |
| 215 | Ga0265770_1023705 | 3300030878 | Unclassified | 989 |
| 216 | Ga0265770_1037867 | 3300030878 | Unclassified | 834 |
| 217 | Ga0265765_1000148 | 3300030879 | Bacteria | 4364 |
| 218 | Ga0265760_10000351 | 3300031090 | Bacteria | 12934 |
| 219 | Ga0265760_10001431 | 3300031090 | Bacteria | 7025 |
| 220 | Ga0265760_10031453 | 3300031090 | Unclassified | 1565 |
| 221 | Ga0265760_10090250 | 3300031090 | Unclassified | 958 |
| 222 | Ga0265760_10090263 | 3300031090 | Unclassified | 958 |
| 223 | Ga0265325_10332405 | 3300031241 | Bacteria | 674 |
| 224 | Ga0265340_10105904 | 3300031247 | Unclassified | 1304 |
| 225 | Ga0265339_10143977 | 3300031249 | Unclassified | 1210 |
| 226 | Ga0265316_10006361 | 3300031344 | Bacteria | 11295 |
| 227 | Ga0265314_10027116 | 3300031711 | Unclassified | 4293 |
| 228 | Ga0316212_1000826 | 3300033547 | Unclassified | 4004 |
| 229 | Ga0316212_1006626 | 3300033547 | Unclassified | 1676 |
| 230 | Ga0373934_0057103 | 3300035086 | Unclassified | 1553 |
| 231 | Ga0373940_0045180 | 3300035088 | Bacteria | 1222 |
| 232 | Ga0373936_0217706 | 3300035113 | Unclassified | 846 |
| 233 | Ga0373955_0588701 | 3300035172 | Unclassified | 681 |
| 234 | Ga0373924_0474094 | 3300035410 | Unclassified | 562 |
| 235 | Ga0373931_0263180 | 3300035691 | Unclassified | 1053 |
| 236 | Ga0373931_0444791 | 3300035691 | Bacteria | 828 |
| 237 | Ga0373927_0620806 | 3300035695 | Bacteria | 715 |
| 238 | Ga0373933_0431163 | 3300035724 | Unclassified | 861 |
| 239 | Ga0373933_1013452 | 3300035724 | Unclassified | 547 |
| 240 | Ga0373937_0342245 | 3300036401 | Bacteria | 1416 |
| 241 | Ga0373937_1593376 | 3300036401 | Bacteria | 600 |
| 242 | Ga0373925_0042468 | 3300037068 | Bacteria | 3373 |
| 243 | Ga0495603_0143356 | 3300046455 | Bacteria | 1389 |
| 244 | Ga0495641_0041799 | 3300046461 | Bacteria | 2128 |
| 245 | Ga0495641_0196330 | 3300046461 | Unclassified | 904 |
| 246 | Ga0495580_0000989 | 3300046472 | Bacteria | 24941 |
| 247 | Ga0495580_0027047 | 3300046472 | Unclassified | 4177 |
| 248 | Ga0495580_0085339 | 3300046472 | Unclassified | 2199 |
| 249 | Ga0495580_0173498 | 3300046472 | Bacteria | 1490 |
| 250 | Ga0495582_0000279 | 3300046473 | Bacteria | 28597 |
| 251 | Ga0495582_0044345 | 3300046473 | Bacteria | 2449 |
| 252 | Ga0495639_0022153 | 3300046475 | Bacteria | 2785 |
| 253 | Ga0495662_0224808 | 3300046476 | Bacteria | 925 |
| 254 | Ga0495664_0215064 | 3300046477 | Bacteria | 1164 |
| 255 | Ga0495594_0077659 | 3300046499 | Bacteria | 1852 |
| 256 | Ga0495608_0487637 | 3300046511 | Bacteria | 747 |
| 257 | Ga0495618_0210338 | 3300046514 | Bacteria | 1229 |
| 258 | Ga0495630_0928219 | 3300046517 | Bacteria | 662 |
| 259 | Ga0495666_0098773 | 3300046526 | Bacteria | 1376 |
| 260 | Ga0495665_0061306 | 3300046531 | Bacteria | 1986 |
| 261 | Ga0495640_0044123 | 3300046533 | Bacteria | 3101 |
| 262 | Ga0495586_0634074 | 3300046535 | Bacteria | 617 |
| 263 | Ga0495622_0212003 | 3300046557 | Bacteria | 860 |
| 264 | Ga0495622_0222996 | 3300046557 | Bacteria | 835 |
| 265 | Ga0495667_0257112 | 3300046559 | Bacteria | 1111 |
| 266 | Ga0495634_0096163 | 3300046642 | Bacteria | 1918 |
| 267 | Ga0495634_0296906 | 3300046642 | Unclassified | 978 |
| 268 | Ga0495635_0086744 | 3300046663 | Unclassified | 2142 |
| 269 | Ga0495657_0827285 | 3300046675 | Unclassified | 528 |
| 270 | Ga0495647_0071648 | 3300046681 | Bacteria | 1388 |
| 271 | Ga0495658_0030103 | 3300046683 | Bacteria | 2945 |
| 272 | Ga0495658_0415621 | 3300046683 | Unclassified | 858 |
| 273 | Ga0495613_0302658 | 3300046689 | Bacteria | 1106 |
| 274 | Ga0495674_0074300 | 3300047319 | Bacteria | 2928 |
| 275 | Ga0495676_0017780 | 3300047321 | Bacteria | 6278 |
| 276 | Ga0495680_0011742 | 3300047322 | Bacteria | 7738 |
| 277 | Ga0495680_0211893 | 3300047322 | Unclassified | 1387 |
| 278 | Ga0495684_0848468 | 3300047471 | Unclassified | 593 |
| 279 | Ga0495686_0035623 | 3300047472 | Bacteria | 3198 |
| 280 | Ga0495602_0459037 | 3300048088 | Unclassified | 898 |
| 281 | Ga0496100_0083962 | 3300048903 | Bacteria | 2158 |
| 282 | Ga0496100_0153836 | 3300048903 | Bacteria | 1643 |
| 283 | Ga0496100_0294309 | 3300048903 | Unclassified | 1213 |
| 284 | Ga0496100_1092890 | 3300048903 | Unclassified | 628 |
| 285 | Ga0496101_0024605 | 3300048904 | Unclassified | 4169 |
| 286 | Ga0496101_0144915 | 3300048904 | Bacteria | 1813 |
| 287 | Ga0496101_0277549 | 3300048904 | Bacteria | 1309 |
| 288 | Ga0496102_0000662 | 3300048905 | Bacteria | 34346 |
| 289 | Ga0496103_0018238 | 3300048906 | Bacteria | 4209 |
| 290 | Ga0496104_0046642 | 3300048907 | Bacteria | 4081 |
| 291 | Ga0496104_0063829 | 3300048907 | Bacteria | 3494 |
| 292 | Ga0496105_0252652 | 3300048908 | Bacteria | 1428 |
| 293 | Ga0496105_0257008 | 3300048908 | Bacteria | 1414 |
| 294 | Ga0496106_0013290 | 3300048909 | Bacteria | 6077 |
| 295 | Ga0496107_0080901 | 3300048910 | Bacteria | 2370 |
| 296 | Ga0496107_0453697 | 3300048910 | Unclassified | 952 |
| 297 | Ga0496110_0251432 | 3300048913 | Unclassified | 1609 |
| 298 | Ga0496112_0000961 | 3300048915 | Bacteria | 20945 |
| 299 | Ga0496112_0134516 | 3300048915 | Bacteria | 2443 |
| 300 | Ga0496112_0175036 | 3300048915 | Unclassified | 2111 |
| 301 | Ga0496114_0032061 | 3300048917 | Unclassified | 4323 |
| 302 | Ga0496114_0127893 | 3300048917 | Bacteria | 2192 |
| 303 | Ga0496115_0021635 | 3300048918 | Bacteria | 4970 |
| 304 | Ga0496115_0053356 | 3300048918 | Unclassified | 3244 |
| 305 | Ga0496115_0264544 | 3300048918 | Bacteria | 1414 |
| 306 | Ga0496115_0451380 | 3300048918 | Unclassified | 1038 |
| 307 | nmdc:mga0n895_845895_c1 | 3300050512 | Bacteria | 903 |
| 308 | nmdc:mga08x19_59351_c1 | 3300050514 | Unclassified | 2476 |
| 309 | Ga0495601_0653785 | 3300053077 | Unclassified | 672 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006847 | Ga0075431_100315602 | Ga0075431_1003156022 | 109 |
| 2 | 3300025936 | Ga0207670_11531583 | Ga0207670_115315832 | 110 |
| 3 | 3300047472 | Ga0495686_0035623 | Ga0495686_0035623_2279_2617 | 112 |
| 4 | 3300005436 | Ga0070713_100570984 | Ga0070713_1005709842 | 113 |
| 5 | 3300005445 | Ga0070708_100002259 | Ga0070708_1000022597 | 113 |
| 6 | 3300005455 | Ga0070663_100896608 | Ga0070663_1008966082 | 113 |
| 7 | 3300005468 | Ga0070707_100001742 | Ga0070707_1000017424 | 113 |
| 8 | 3300005468 | Ga0070707_100216976 | Ga0070707_1002169763 | 113 |
| 9 | 3300005471 | Ga0070698_100001030 | Ga0070698_10000103010 | 113 |
| 10 | 3300005518 | Ga0070699_100001065 | Ga0070699_10000106517 | 113 |
| 11 | 3300005536 | Ga0070697_100000473 | Ga0070697_10000047317 | 113 |
| 12 | 3300006028 | Ga0070717_10535012 | Ga0070717_105350122 | 113 |
| 13 | 3300009093 | Ga0105240_10288043 | Ga0105240_102880432 | 113 |
| 14 | 3300009177 | Ga0105248_11115389 | Ga0105248_111153892 | 113 |
| 15 | 3300009551 | Ga0105238_10871649 | Ga0105238_108716492 | 113 |
| 16 | 3300013306 | Ga0163162_13148187 | Ga0163162_131481871 | 113 |
| 17 | 3300014969 | Ga0157376_10344376 | Ga0157376_103443762 | 113 |
| 18 | 3300025910 | Ga0207684_10000498 | Ga0207684_1000049834 | 113 |
| 19 | 3300025922 | Ga0207646_10000557 | Ga0207646_1000055732 | 113 |
| 20 | 3300025924 | Ga0207694_11670843 | Ga0207694_116708432 | 113 |
| 21 | 3300025928 | Ga0207700_10422076 | Ga0207700_104220762 | 113 |
| 22 | 3300025941 | Ga0207711_10790816 | Ga0207711_107908162 | 113 |
| 23 | 3300026067 | Ga0207678_10534118 | Ga0207678_105341182 | 113 |
| 24 | 3300026142 | Ga0207698_10682920 | Ga0207698_106829202 | 113 |
| 25 | 3300000546 | LJNas_1000787 | LJNas_10007874 | 114 |
| 26 | 3300005334 | Ga0068869_100002628 | Ga0068869_1000026287 | 114 |
| 27 | 3300005334 | Ga0068869_100910826 | Ga0068869_1009108262 | 114 |
| 28 | 3300005338 | Ga0068868_100153533 | Ga0068868_1001535332 | 114 |
| 29 | 3300005340 | Ga0070689_100139166 | Ga0070689_1001391662 | 114 |
| 30 | 3300005367 | Ga0070667_100248075 | Ga0070667_1002480752 | 114 |
| 31 | 3300005434 | Ga0070709_10012646 | Ga0070709_100126464 | 114 |
| 32 | 3300005434 | Ga0070709_10096080 | Ga0070709_100960803 | 114 |
| 33 | 3300005434 | Ga0070709_11084503 | Ga0070709_110845032 | 114 |
| 34 | 3300005436 | Ga0070713_100284744 | Ga0070713_1002847443 | 114 |
| 35 | 3300005436 | Ga0070713_100430588 | Ga0070713_1004305882 | 114 |
| 36 | 3300005436 | Ga0070713_101110808 | Ga0070713_1011108082 | 114 |
| 37 | 3300005437 | Ga0070710_11392613 | Ga0070710_113926131 | 114 |
| 38 | 3300005439 | Ga0070711_100104783 | Ga0070711_1001047832 | 114 |
| 39 | 3300005445 | Ga0070708_100002984 | Ga0070708_1000029845 | 114 |
| 40 | 3300005445 | Ga0070708_100022811 | Ga0070708_1000228116 | 114 |
| 41 | 3300005445 | Ga0070708_100461817 | Ga0070708_1004618172 | 114 |
| 42 | 3300005457 | Ga0070662_100093498 | Ga0070662_1000934983 | 114 |
| 43 | 3300005459 | Ga0068867_100085863 | Ga0068867_1000858632 | 114 |
| 44 | 3300005466 | Ga0070685_10021616 | Ga0070685_100216164 | 114 |
| 45 | 3300005467 | Ga0070706_100000188 | Ga0070706_10000018857 | 114 |
| 46 | 3300005467 | Ga0070706_100230184 | Ga0070706_1002301842 | 114 |
| 47 | 3300005467 | Ga0070706_100261068 | Ga0070706_1002610682 | 114 |
| 48 | 3300005468 | Ga0070707_100272194 | Ga0070707_1002721941 | 114 |
| 49 | 3300005471 | Ga0070698_100089821 | Ga0070698_1000898212 | 114 |
| 50 | 3300005471 | Ga0070698_100644976 | Ga0070698_1006449762 | 114 |
| 51 | 3300005518 | Ga0070699_100067493 | Ga0070699_1000674933 | 114 |
| 52 | 3300005536 | Ga0070697_100000146 | Ga0070697_10000014632 | 114 |
| 53 | 3300005536 | Ga0070697_100001570 | Ga0070697_1000015707 | 114 |
| 54 | 3300005536 | Ga0070697_100671660 | Ga0070697_1006716602 | 114 |
| 55 | 3300005544 | Ga0070686_100516409 | Ga0070686_1005164092 | 114 |
| 56 | 3300005545 | Ga0070695_100239948 | Ga0070695_1002399483 | 114 |
| 57 | 3300005548 | Ga0070665_100253324 | Ga0070665_1002533242 | 114 |
| 58 | 3300005617 | Ga0068859_100011260 | Ga0068859_1000112605 | 114 |
| 59 | 3300005718 | Ga0068866_10194248 | Ga0068866_101942482 | 114 |
| 60 | 3300005719 | Ga0068861_100157537 | Ga0068861_1001575372 | 114 |
| 61 | 3300005834 | Ga0068851_10548281 | Ga0068851_105482812 | 114 |
| 62 | 3300005841 | Ga0068863_100385974 | Ga0068863_1003859741 | 114 |
| 63 | 3300005842 | Ga0068858_100007248 | Ga0068858_1000072484 | 114 |
| 64 | 3300005842 | Ga0068858_100461345 | Ga0068858_1004613452 | 114 |
| 65 | 3300005844 | Ga0068862_100423432 | Ga0068862_1004234322 | 114 |
| 66 | 3300005983 | Ga0081540_1232402 | Ga0081540_12324022 | 114 |
| 67 | 3300006028 | Ga0070717_10001310 | Ga0070717_1000131019 | 114 |
| 68 | 3300006028 | Ga0070717_10002087 | Ga0070717_100020872 | 114 |
| 69 | 3300006028 | Ga0070717_10057307 | Ga0070717_100573073 | 114 |
| 70 | 3300006163 | Ga0070715_10024396 | Ga0070715_100243963 | 114 |
| 71 | 3300006163 | Ga0070715_10040314 | Ga0070715_100403143 | 114 |
| 72 | 3300006163 | Ga0070715_10063765 | Ga0070715_100637653 | 114 |
| 73 | 3300006173 | Ga0070716_100000121 | Ga0070716_1000001218 | 114 |
| 74 | 3300006173 | Ga0070716_100077197 | Ga0070716_1000771973 | 114 |
| 75 | 3300006175 | Ga0070712_100002109 | Ga0070712_10000210911 | 114 |
| 76 | 3300006175 | Ga0070712_100158813 | Ga0070712_1001588132 | 114 |
| 77 | 3300006175 | Ga0070712_100992972 | Ga0070712_1009929722 | 114 |
| 78 | 3300006175 | Ga0070712_101355280 | Ga0070712_1013552801 | 114 |
| 79 | 3300006237 | Ga0097621_100374588 | Ga0097621_1003745882 | 114 |
| 80 | 3300006237 | Ga0097621_100615830 | Ga0097621_1006158302 | 114 |
| 81 | 3300006358 | Ga0068871_100019656 | Ga0068871_1000196562 | 114 |
| 82 | 3300006358 | Ga0068871_100025229 | Ga0068871_1000252295 | 114 |
| 83 | 3300006358 | Ga0068871_100631313 | Ga0068871_1006313132 | 114 |
| 84 | 3300006881 | Ga0068865_100007544 | Ga0068865_1000075442 | 114 |
| 85 | 3300006914 | Ga0075436_100102773 | Ga0075436_1001027732 | 114 |
| 86 | 3300006931 | Ga0097620_100011260 | Ga0097620_1000112605 | 114 |
| 87 | 3300007265 | Ga0099794_10002316 | Ga0099794_100023166 | 114 |
| 88 | 3300007265 | Ga0099794_10065599 | Ga0099794_100655992 | 114 |
| 89 | 3300007265 | Ga0099794_10230905 | Ga0099794_102309051 | 114 |
| 90 | 3300009098 | Ga0105245_11560083 | Ga0105245_115600832 | 114 |
| 91 | 3300009174 | Ga0105241_10227798 | Ga0105241_102277983 | 114 |
| 92 | 3300009174 | Ga0105241_11064885 | Ga0105241_110648852 | 114 |
| 93 | 3300009177 | Ga0105248_10238820 | Ga0105248_102388203 | 114 |
| 94 | 3300009553 | Ga0105249_10954347 | Ga0105249_109543472 | 114 |
| 95 | 3300011119 | Ga0105246_11509936 | Ga0105246_115099361 | 114 |
| 96 | 3300013100 | Ga0157373_10449758 | Ga0157373_104497582 | 114 |
| 97 | 3300013296 | Ga0157374_11011642 | Ga0157374_110116422 | 114 |
| 98 | 3300013297 | Ga0157378_10406147 | Ga0157378_104061472 | 114 |
| 99 | 3300014968 | Ga0157379_10010460 | Ga0157379_100104605 | 114 |
| 100 | 3300014969 | Ga0157376_10000468 | Ga0157376_1000046811 | 114 |
| 101 | 3300022732 | Ga0224569_100006 | Ga0224569_1000064 | 114 |
| 102 | 3300022734 | Ga0224571_100154 | Ga0224571_1001543 | 114 |
| 103 | 3300024225 | Ga0224572_1012123 | Ga0224572_10121232 | 114 |
| 104 | 3300024227 | Ga0228598_1000014 | Ga0228598_100001414 | 114 |
| 105 | 3300024227 | Ga0228598_1001186 | Ga0228598_10011865 | 114 |
| 106 | 3300024227 | Ga0228598_1034495 | Ga0228598_10344952 | 114 |
| 107 | 3300025898 | Ga0207692_10999058 | Ga0207692_109990581 | 114 |
| 108 | 3300025904 | Ga0207647_10129223 | Ga0207647_101292232 | 114 |
| 109 | 3300025906 | Ga0207699_10007334 | Ga0207699_100073345 | 114 |
| 110 | 3300025906 | Ga0207699_10080363 | Ga0207699_100803634 | 114 |
| 111 | 3300025910 | Ga0207684_10001145 | Ga0207684_1000114510 | 114 |
| 112 | 3300025911 | Ga0207654_10150932 | Ga0207654_101509323 | 114 |
| 113 | 3300025911 | Ga0207654_11312243 | Ga0207654_113122432 | 114 |
| 114 | 3300025915 | Ga0207693_10000243 | Ga0207693_1000024328 | 114 |
| 115 | 3300025915 | Ga0207693_11154117 | Ga0207693_111541171 | 114 |
| 116 | 3300025916 | Ga0207663_10011181 | Ga0207663_100111814 | 114 |
| 117 | 3300025916 | Ga0207663_10116327 | Ga0207663_101163273 | 114 |
| 118 | 3300025916 | Ga0207663_10216120 | Ga0207663_102161202 | 114 |
| 119 | 3300025928 | Ga0207700_10246082 | Ga0207700_102460823 | 114 |
| 120 | 3300025929 | Ga0207664_10426448 | Ga0207664_104264482 | 114 |
| 121 | 3300025933 | Ga0207706_10281695 | Ga0207706_102816952 | 114 |
| 122 | 3300025936 | Ga0207670_10759502 | Ga0207670_107595022 | 114 |
| 123 | 3300025938 | Ga0207704_10001355 | Ga0207704_100013555 | 114 |
| 124 | 3300025939 | Ga0207665_10000014 | Ga0207665_1000001473 | 114 |
| 125 | 3300025939 | Ga0207665_10065208 | Ga0207665_100652082 | 114 |
| 126 | 3300025939 | Ga0207665_10225084 | Ga0207665_102250842 | 114 |
| 127 | 3300025939 | Ga0207665_10298036 | Ga0207665_102980362 | 114 |
| 128 | 3300025942 | Ga0207689_10002521 | Ga0207689_100025214 | 114 |
| 129 | 3300025942 | Ga0207689_10789137 | Ga0207689_107891372 | 114 |
| 130 | 3300025961 | Ga0207712_11341768 | Ga0207712_113417681 | 114 |
| 131 | 3300025986 | Ga0207658_10243884 | Ga0207658_102438842 | 114 |
| 132 | 3300026023 | Ga0207677_11734402 | Ga0207677_117344022 | 114 |
| 133 | 3300026035 | Ga0207703_10442489 | Ga0207703_104424892 | 114 |
| 134 | 3300026088 | Ga0207641_10006923 | Ga0207641_100069238 | 114 |
| 135 | 3300026089 | Ga0207648_10102870 | Ga0207648_101028702 | 114 |
| 136 | 3300027671 | Ga0209588_1008116 | Ga0209588_10081165 | 114 |
| 137 | 3300027671 | Ga0209588_1010295 | Ga0209588_10102952 | 114 |
| 138 | 3300027671 | Ga0209588_1026497 | Ga0209588_10264972 | 114 |
| 139 | 3300027671 | Ga0209588_1183180 | Ga0209588_11831802 | 114 |
| 140 | 3300027671 | Ga0209588_1186832 | Ga0209588_11868322 | 114 |
| 141 | 3300028016 | Ga0265354_1000482 | Ga0265354_10004824 | 114 |
| 142 | 3300028016 | Ga0265354_1000612 | Ga0265354_10006125 | 114 |
| 143 | 3300028017 | Ga0265356_1006001 | Ga0265356_10060012 | 114 |
| 144 | 3300028380 | Ga0268265_10391778 | Ga0268265_103917782 | 114 |
| 145 | 3300030760 | Ga0265762_1000045 | Ga0265762_10000456 | 114 |
| 146 | 3300030878 | Ga0265770_1023705 | Ga0265770_10237052 | 114 |
| 147 | 3300030878 | Ga0265770_1037867 | Ga0265770_10378672 | 114 |
| 148 | 3300030879 | Ga0265765_1000148 | Ga0265765_10001482 | 114 |
| 149 | 3300031090 | Ga0265760_10000351 | Ga0265760_100003517 | 114 |
| 150 | 3300031090 | Ga0265760_10031453 | Ga0265760_100314532 | 114 |
| 151 | 3300031090 | Ga0265760_10090250 | Ga0265760_100902502 | 114 |
| 152 | 3300031090 | Ga0265760_10090263 | Ga0265760_100902632 | 114 |
| 153 | 3300031241 | Ga0265325_10332405 | Ga0265325_103324051 | 114 |
| 154 | 3300031247 | Ga0265340_10105904 | Ga0265340_101059042 | 114 |
| 155 | 3300031249 | Ga0265339_10143977 | Ga0265339_101439772 | 114 |
| 156 | 3300031344 | Ga0265316_10006361 | Ga0265316_100063612 | 114 |
| 157 | 3300031711 | Ga0265314_10027116 | Ga0265314_100271164 | 114 |
| 158 | 3300033547 | Ga0316212_1000826 | Ga0316212_10008264 | 114 |
| 159 | 3300033547 | Ga0316212_1006626 | Ga0316212_10066262 | 114 |
| 160 | 3300035086 | Ga0373934_0057103 | Ga0373934_0057103_546_890 | 114 |
| 161 | 3300035172 | Ga0373955_0588701 | Ga0373955_0588701_179_523 | 114 |
| 162 | 3300035410 | Ga0373924_0474094 | Ga0373924_0474094_100_444 | 114 |
| 163 | 3300035695 | Ga0373927_0620806 | Ga0373927_0620806_22_366 | 114 |
| 164 | 3300035724 | Ga0373933_0431163 | Ga0373933_0431163_345_689 | 114 |
| 165 | 3300036401 | Ga0373937_0342245 | Ga0373937_0342245_833_1177 | 114 |
| 166 | 3300036401 | Ga0373937_1593376 | Ga0373937_1593376_161_505 | 114 |
| 167 | 3300046455 | Ga0495603_0143356 | Ga0495603_0143356_613_957 | 114 |
| 168 | 3300046461 | Ga0495641_0041799 | Ga0495641_0041799_755_1099 | 114 |
| 169 | 3300046461 | Ga0495641_0196330 | Ga0495641_0196330_233_577 | 114 |
| 170 | 3300046472 | Ga0495580_0000989 | Ga0495580_0000989_9196_9540 | 114 |
| 171 | 3300046472 | Ga0495580_0085339 | Ga0495580_0085339_28_372 | 114 |
| 172 | 3300046472 | Ga0495580_0173498 | Ga0495580_0173498_336_680 | 114 |
| 173 | 3300046473 | Ga0495582_0000279 | Ga0495582_0000279_12396_12740 | 114 |
| 174 | 3300046473 | Ga0495582_0044345 | Ga0495582_0044345_901_1245 | 114 |
| 175 | 3300046475 | Ga0495639_0022153 | Ga0495639_0022153_510_854 | 114 |
| 176 | 3300046476 | Ga0495662_0224808 | Ga0495662_0224808_35_379 | 114 |
| 177 | 3300046477 | Ga0495664_0215064 | Ga0495664_0215064_112_456 | 114 |
| 178 | 3300046499 | Ga0495594_0077659 | Ga0495594_0077659_1053_1397 | 114 |
| 179 | 3300046511 | Ga0495608_0487637 | Ga0495608_0487637_122_466 | 114 |
| 180 | 3300046514 | Ga0495618_0210338 | Ga0495618_0210338_464_808 | 114 |
| 181 | 3300046517 | Ga0495630_0928219 | Ga0495630_0928219_207_551 | 114 |
| 182 | 3300046526 | Ga0495666_0098773 | Ga0495666_0098773_1017_1361 | 114 |
| 183 | 3300046531 | Ga0495665_0061306 | Ga0495665_0061306_755_1099 | 114 |
| 184 | 3300046533 | Ga0495640_0044123 | Ga0495640_0044123_1016_1360 | 114 |
| 185 | 3300046535 | Ga0495586_0634074 | Ga0495586_0634074_30_374 | 114 |
| 186 | 3300046557 | Ga0495622_0212003 | Ga0495622_0212003_483_827 | 114 |
| 187 | 3300046557 | Ga0495622_0222996 | Ga0495622_0222996_364_708 | 114 |
| 188 | 3300046559 | Ga0495667_0257112 | Ga0495667_0257112_681_1025 | 114 |
| 189 | 3300046642 | Ga0495634_0096163 | Ga0495634_0096163_571_915 | 114 |
| 190 | 3300046675 | Ga0495657_0827285 | Ga0495657_0827285_92_436 | 114 |
| 191 | 3300046681 | Ga0495647_0071648 | Ga0495647_0071648_182_526 | 114 |
| 192 | 3300046683 | Ga0495658_0030103 | Ga0495658_0030103_986_1330 | 114 |
| 193 | 3300046689 | Ga0495613_0302658 | Ga0495613_0302658_306_650 | 114 |
| 194 | 3300047319 | Ga0495674_0074300 | Ga0495674_0074300_927_1271 | 114 |
| 195 | 3300047321 | Ga0495676_0017780 | Ga0495676_0017780_392_736 | 114 |
| 196 | 3300047322 | Ga0495680_0011742 | Ga0495680_0011742_112_456 | 114 |
| 197 | 3300048088 | Ga0495602_0459037 | Ga0495602_0459037_255_599 | 114 |
| 198 | 3300048903 | Ga0496100_0083962 | Ga0496100_0083962_1293_1637 | 114 |
| 199 | 3300048904 | Ga0496101_0144915 | Ga0496101_0144915_1343_1687 | 114 |
| 200 | 3300048904 | Ga0496101_0277549 | Ga0496101_0277549_734_1078 | 114 |
| 201 | 3300048908 | Ga0496105_0252652 | Ga0496105_0252652_474_818 | 114 |
| 202 | 3300048910 | Ga0496107_0080901 | Ga0496107_0080901_765_1109 | 114 |
| 203 | 3300048917 | Ga0496114_0127893 | Ga0496114_0127893_1427_1771 | 114 |
| 204 | 3300048918 | Ga0496115_0053356 | Ga0496115_0053356_1139_1483 | 114 |
| 205 | 3300048918 | Ga0496115_0264544 | Ga0496115_0264544_1010_1354 | 114 |
| 206 | 3300005467 | Ga0070706_100009269 | Ga0070706_1000092692 | 117 |
| 207 | 3300005536 | Ga0070697_101676710 | Ga0070697_1016767101 | 117 |
| 208 | 3300025922 | Ga0207646_10587421 | Ga0207646_105874212 | 117 |
| 209 | 2088090003 | LJN_F6ESG4R02H5D7C | LJN_00124650 | 118 |
| 210 | 3300005338 | Ga0068868_100394493 | Ga0068868_1003944932 | 118 |
| 211 | 3300005439 | Ga0070711_100000387 | Ga0070711_10000038713 | 118 |
| 212 | 3300005439 | Ga0070711_101599647 | Ga0070711_1015996471 | 118 |
| 213 | 3300005445 | Ga0070708_101318585 | Ga0070708_1013185851 | 118 |
| 214 | 3300005535 | Ga0070684_100708136 | Ga0070684_1007081361 | 118 |
| 215 | 3300005536 | Ga0070697_100071841 | Ga0070697_1000718412 | 118 |
| 216 | 3300005539 | Ga0068853_102236258 | Ga0068853_1022362581 | 118 |
| 217 | 3300005843 | Ga0068860_100089113 | Ga0068860_1000891132 | 118 |
| 218 | 3300006163 | Ga0070715_10413715 | Ga0070715_104137151 | 118 |
| 219 | 3300006173 | Ga0070716_100035352 | Ga0070716_1000353523 | 118 |
| 220 | 3300006237 | Ga0097621_100125668 | Ga0097621_1001256683 | 118 |
| 221 | 3300006358 | Ga0068871_100239929 | Ga0068871_1002399292 | 118 |
| 222 | 3300006871 | Ga0075434_100297461 | Ga0075434_1002974612 | 118 |
| 223 | 3300007076 | Ga0075435_100491763 | Ga0075435_1004917632 | 118 |
| 224 | 3300007265 | Ga0099794_10009854 | Ga0099794_100098545 | 118 |
| 225 | 3300007265 | Ga0099794_10058401 | Ga0099794_100584012 | 118 |
| 226 | 3300007265 | Ga0099794_10077274 | Ga0099794_100772742 | 118 |
| 227 | 3300007265 | Ga0099794_10447852 | Ga0099794_104478522 | 118 |
| 228 | 3300007788 | Ga0099795_10037826 | Ga0099795_100378263 | 118 |
| 229 | 3300007788 | Ga0099795_10152980 | Ga0099795_101529801 | 118 |
| 230 | 3300009093 | Ga0105240_10423504 | Ga0105240_104235042 | 118 |
| 231 | 3300009098 | Ga0105245_10226632 | Ga0105245_102266322 | 118 |
| 232 | 3300009098 | Ga0105245_10343371 | Ga0105245_103433712 | 118 |
| 233 | 3300009101 | Ga0105247_10138731 | Ga0105247_101387312 | 118 |
| 234 | 3300009174 | Ga0105241_10531454 | Ga0105241_105314542 | 118 |
| 235 | 3300009177 | Ga0105248_10155252 | Ga0105248_101552522 | 118 |
| 236 | 3300009177 | Ga0105248_10390096 | Ga0105248_103900961 | 118 |
| 237 | 3300009545 | Ga0105237_10126788 | Ga0105237_101267882 | 118 |
| 238 | 3300009545 | Ga0105237_10192094 | Ga0105237_101920942 | 118 |
| 239 | 3300009551 | Ga0105238_10125095 | Ga0105238_101250953 | 118 |
| 240 | 3300009553 | Ga0105249_11123181 | Ga0105249_111231812 | 118 |
| 241 | 3300010159 | Ga0099796_10081712 | Ga0099796_100817122 | 118 |
| 242 | 3300010159 | Ga0099796_10142994 | Ga0099796_101429942 | 118 |
| 243 | 3300010159 | Ga0099796_10144586 | Ga0099796_101445862 | 118 |
| 244 | 3300010375 | Ga0105239_10043256 | Ga0105239_100432563 | 118 |
| 245 | 3300013105 | Ga0157369_10940676 | Ga0157369_109406762 | 118 |
| 246 | 3300013296 | Ga0157374_10002043 | Ga0157374_1000204316 | 118 |
| 247 | 3300013296 | Ga0157374_10085981 | Ga0157374_100859814 | 118 |
| 248 | 3300013297 | Ga0157378_10970990 | Ga0157378_109709902 | 118 |
| 249 | 3300013306 | Ga0163162_10001103 | Ga0163162_100011037 | 118 |
| 250 | 3300013306 | Ga0163162_10001732 | Ga0163162_100017323 | 118 |
| 251 | 3300013308 | Ga0157375_10000276 | Ga0157375_100002762 | 118 |
| 252 | 3300014325 | Ga0163163_10387149 | Ga0163163_103871492 | 118 |
| 253 | 3300014968 | Ga0157379_10051992 | Ga0157379_100519923 | 118 |
| 254 | 3300014968 | Ga0157379_10207903 | Ga0157379_102079032 | 118 |
| 255 | 3300014968 | Ga0157379_11234721 | Ga0157379_112347212 | 118 |
| 256 | 3300014969 | Ga0157376_10379866 | Ga0157376_103798662 | 118 |
| 257 | 3300014969 | Ga0157376_10394753 | Ga0157376_103947532 | 118 |
| 258 | 3300014969 | Ga0157376_12098547 | Ga0157376_120985471 | 118 |
| 259 | 3300025900 | Ga0207710_10168723 | Ga0207710_101687232 | 118 |
| 260 | 3300025905 | Ga0207685_10399144 | Ga0207685_103991442 | 118 |
| 261 | 3300025913 | Ga0207695_10415759 | Ga0207695_104157592 | 118 |
| 262 | 3300025915 | Ga0207693_10443215 | Ga0207693_104432152 | 118 |
| 263 | 3300025915 | Ga0207693_10730058 | Ga0207693_107300582 | 118 |
| 264 | 3300025916 | Ga0207663_10611330 | Ga0207663_106113301 | 118 |
| 265 | 3300025924 | Ga0207694_10133482 | Ga0207694_101334822 | 118 |
| 266 | 3300025928 | Ga0207700_10148038 | Ga0207700_101480382 | 118 |
| 267 | 3300025939 | Ga0207665_10071805 | Ga0207665_100718052 | 118 |
| 268 | 3300026023 | Ga0207677_10299490 | Ga0207677_102994902 | 118 |
| 269 | 3300027512 | Ga0209179_1036599 | Ga0209179_10365992 | 118 |
| 270 | 3300027671 | Ga0209588_1033683 | Ga0209588_10336833 | 118 |
| 271 | 3300027671 | Ga0209588_1059712 | Ga0209588_10597122 | 118 |
| 272 | 3300028023 | Ga0265357_1013183 | Ga0265357_10131832 | 118 |
| 273 | 3300028381 | Ga0268264_10114264 | Ga0268264_101142643 | 118 |
| 274 | 3300030763 | Ga0265763_1011694 | Ga0265763_10116942 | 118 |
| 275 | 3300030878 | Ga0265770_1004220 | Ga0265770_10042203 | 118 |
| 276 | 3300031090 | Ga0265760_10001431 | Ga0265760_100014314 | 118 |
| 277 | 3300035088 | Ga0373940_0045180 | Ga0373940_0045180_27_383 | 118 |
| 278 | 3300035113 | Ga0373936_0217706 | Ga0373936_0217706_375_734 | 118 |
| 279 | 3300035691 | Ga0373931_0263180 | Ga0373931_0263180_650_1006 | 118 |
| 280 | 3300035691 | Ga0373931_0444791 | Ga0373931_0444791_92_448 | 118 |
| 281 | 3300035724 | Ga0373933_1013452 | Ga0373933_1013452_19_378 | 118 |
| 282 | 3300037068 | Ga0373925_0042468 | Ga0373925_0042468_2035_2394 | 118 |
| 283 | 3300046472 | Ga0495580_0027047 | Ga0495580_0027047_1603_1959 | 118 |
| 284 | 3300046642 | Ga0495634_0296906 | Ga0495634_0296906_11_370 | 118 |
| 285 | 3300046663 | Ga0495635_0086744 | Ga0495635_0086744_710_1069 | 118 |
| 286 | 3300046683 | Ga0495658_0415621 | Ga0495658_0415621_452_811 | 118 |
| 287 | 3300047322 | Ga0495680_0211893 | Ga0495680_0211893_542_901 | 118 |
| 288 | 3300047471 | Ga0495684_0848468 | Ga0495684_0848468_168_527 | 118 |
| 289 | 3300048903 | Ga0496100_0153836 | Ga0496100_0153836_368_724 | 118 |
| 290 | 3300048903 | Ga0496100_0294309 | Ga0496100_0294309_11_370 | 118 |
| 291 | 3300048903 | Ga0496100_1092890 | Ga0496100_1092890_98_454 | 118 |
| 292 | 3300048904 | Ga0496101_0024605 | Ga0496101_0024605_415_774 | 118 |
| 293 | 3300048905 | Ga0496102_0000662 | Ga0496102_0000662_10028_10384 | 118 |
| 294 | 3300048906 | Ga0496103_0018238 | Ga0496103_0018238_1867_2223 | 118 |
| 295 | 3300048907 | Ga0496104_0046642 | Ga0496104_0046642_1454_1810 | 118 |
| 296 | 3300048907 | Ga0496104_0063829 | Ga0496104_0063829_2111_2467 | 118 |
| 297 | 3300048908 | Ga0496105_0257008 | Ga0496105_0257008_223_582 | 118 |
| 298 | 3300048909 | Ga0496106_0013290 | Ga0496106_0013290_4115_4471 | 118 |
| 299 | 3300048910 | Ga0496107_0453697 | Ga0496107_0453697_415_774 | 118 |
| 300 | 3300048913 | Ga0496110_0251432 | Ga0496110_0251432_888_1244 | 118 |
| 301 | 3300048915 | Ga0496112_0000961 | Ga0496112_0000961_10947_11303 | 118 |
| 302 | 3300048915 | Ga0496112_0134516 | Ga0496112_0134516_666_1022 | 118 |
| 303 | 3300048915 | Ga0496112_0175036 | Ga0496112_0175036_612_968 | 118 |
| 304 | 3300048917 | Ga0496114_0032061 | Ga0496114_0032061_737_1096 | 118 |
| 305 | 3300048918 | Ga0496115_0021635 | Ga0496115_0021635_1615_1974 | 118 |
| 306 | 3300048918 | Ga0496115_0451380 | Ga0496115_0451380_139_498 | 118 |
| 307 | 3300050512 | nmdc:mga0n895_845895_c1 | nmdc:mga0n895_845895_c1_229_585 | 118 |
| 308 | 3300050514 | nmdc:mga08x19_59351_c1 | nmdc:mga08x19_59351_c1_1277_1633 | 118 |
| 309 | 3300053077 | Ga0495601_0653785 | Ga0495601_0653785_252_611 | 118 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gpz-assembly1.cif.gz_A | transthyretin-like protein from salmonella dublin | 0.9561 | 7 | 118 |
| 6fxu-assembly1.cif.gz_B-2 | crystal structure of human transthyretin mutant t119m at ph 5.5 | 0.9535 | 7 | 117 |
| 6xtk-assembly1.cif.gz_B-2 | y114c transthyretin structure in complex with tolcalpone | 0.9531 | 7 | 117 |
| 2g5u-assembly1.cif.gz_B-2 | human transthyretin (ttr) complexed with hydroxylated polychlorinated biphenyl-4,4'-dihydroxy-3,3',5,5'-tetrachlorobiphenyl | 0.9519 | 7 | 117 |
| 3tfb-assembly1.cif.gz_B-2 | transthyretin natural mutant a25t | 0.9511 | 7 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gpzC00 | Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain | 0.9561 | 7 | 118 | 2.60.40.180 |
| af_A1Z8C9_1_111_2.60.40.180 | Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain | 0.9454 | 5 | 116 | 2.60.40.180 |
| 2gpzC00 | Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain | 0.9393 | 7 | 118 | 2.60.40.180 |
| 3qvaD00 | Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain | 0.935 | 7 | 118 | 2.60.40.180 |
| 3iwvA00 | Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain | 0.9334 | 7 | 118 | 2.60.40.180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9F3G1-F1-model_v4 | 5-hydroxyisourate hydrolase (HIU hydrolase) (HIUHase) (EC 3.5.2.17) | 0.9962 | 5 | 118 |
GO:0006144
GO:0033971 |
| AF-A0A7Y5RFE8-F1-model_v4 | 5-hydroxyisourate hydrolase (HIU hydrolase) (HIUHase) (EC 3.5.2.17) | 0.9921 | 7 | 118 |
GO:0006144
GO:0033971 |
| AF-A0A2V9U5H1-F1-model_v4 | 5-hydroxyisourate hydrolase (HIU hydrolase) (HIUHase) (EC 3.5.2.17) | 0.9904 | 5 | 118 |
GO:0006144
GO:0033971 |
| AF-A0A2V9F3G1-F1-model_v4 | 5-hydroxyisourate hydrolase (HIU hydrolase) (HIUHase) (EC 3.5.2.17) | 0.9875 | 5 | 118 |
GO:0006144
GO:0033971 |
| AF-A0A2J4YIF3-F1-model_v4 | 5-hydroxyisourate hydrolase (HIU hydrolase) (HIUHase) (EC 3.5.2.17) | 0.983 | 9 | 95 |
GO:0006144
GO:0033971 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar