F399809

General Info

Members Datasets Scaffolds Average Seq Length
308 141 616 538

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0000441|Ga0466963_0000441_8611_10341
Length 576
Sequence LSAPRIAHREDRPAAAKEGYEMRRGLLVVLLAGIVAAVWTAAGNTSGDKTSAATDHAAAGTSVTISNEQGATWTCGFNPMSADLVDWSFGPVYEPLVFVDELKSGAATPWLASKYAWSNHNKTITFTIRPGVKWSDGKPLTAADVVYTFQLIKKNSALDLQAVWSVLKSVTRSGNKVTFKFKTAAVPYFYYIAGQQPIVPEHIWKSIKNPVNFKDPHPVGSGPFTLSSCSPQVMKYTKNPNYWQKGLPKIDTVYYPAYTSNDPANQDLASGKAQWGSQFIPSINNFYLSRSKDNHYWFPPVSNVSVFINLKDPILKDVAIRRAMAYAIDRSRVSKIGEYGYEPPGNQTGIVTPTFKSWLNKKLANQFSYNPAKAKQILTKAGYKFSGGVFHTKSGKPLSFTMINIGGYSDWVASAQIVISNLKAIGIKVTPSNLSSTTYNNDNYNGKFQLSYNGNEAGGPAPYYELRQELYSPNSAPIGKLASSNWERYYNKKVDSLIDAYAATTSSAKQHSIINQIEAAMVRDVPIIPITEGVDWYQYNTKSIAGWVTQQNPYAKPAAYEVPDWGVLLLHLKPKG

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
64 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
65 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
66 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
67 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
68 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
69 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
70 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
71 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
72 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
73 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
74 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
85 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
86 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
99 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
103 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
138 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
139 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 22.08
Rhizosphere 77.27
Stem 0
Stem Tuber 0
Unclassified 5.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0000441 3300044694 Bacteria 19205
2 rootH1_10303273 3300003323 Bacteria 2539
3 Ga0070683_100007075 3300005329 Bacteria 9448
4 Ga0070682_100040867 3300005337 Bacteria 2855
5 Ga0070709_10003217 3300005434 Bacteria 8772
6 Ga0070709_10090261 3300005434 Unclassified 2019
7 Ga0070709_10117784 3300005434 Bacteria 1795
8 Ga0070714_100002678 3300005435 Bacteria 13120
9 Ga0070714_100006765 3300005435 Bacteria 8887
10 Ga0070714_100026939 3300005435 Bacteria 4755
11 Ga0070714_100033771 3300005435 Bacteria 4280
12 Ga0070714_100100608 3300005435 Bacteria 2546
13 Ga0070714_100106115 3300005435 Bacteria 2481
14 Ga0070714_100108117 3300005435 Bacteria 2458
15 Ga0070713_100001075 3300005436 Bacteria 17478
16 Ga0070713_100182632 3300005436 Bacteria 1886
17 Ga0070710_10012068 3300005437 Bacteria 4284
18 Ga0070711_100004232 3300005439 Bacteria 8435
19 Ga0070711_100021992 3300005439 Bacteria 4128
20 Ga0070711_100087040 3300005439 Unclassified 2242
21 Ga0070711_100161003 3300005439 Unclassified 1701
22 Ga0070705_100023809 3300005440 Bacteria 3294
23 Ga0070705_100024235 3300005440 Bacteria 3272
24 Ga0070694_100037422 3300005444 Bacteria 3218
25 Ga0070708_100038955 3300005445 Bacteria 4156
26 Ga0070708_100047876 3300005445 Bacteria 3777
27 Ga0070708_100215438 3300005445 Bacteria 1800
28 Ga0070681_10041148 3300005458 Bacteria 4630
29 Ga0070706_100020127 3300005467 Bacteria 6149
30 Ga0070706_100056882 3300005467 Bacteria 3609
31 Ga0070706_100133744 3300005467 Bacteria 2315
32 Ga0070706_100175589 3300005467 Unclassified 2000
33 Ga0070707_100000457 3300005468 Bacteria 40464
34 Ga0070707_100007870 3300005468 Bacteria 9896
35 Ga0070707_100024348 3300005468 Bacteria 5733
36 Ga0070698_100004350 3300005471 Bacteria 15572
37 Ga0070698_100215613 3300005471 Bacteria 1854
38 Ga0070699_100027054 3300005518 Bacteria 4946
39 Ga0070699_100132577 3300005518 Bacteria 2197
40 Ga0070679_100038695 3300005530 Bacteria 4741
41 Ga0070684_100028337 3300005535 Bacteria 4737
42 Ga0070695_100000074 3300005545 Bacteria 40508
43 Ga0070695_100040421 3300005545 Bacteria 2952
44 Ga0070695_100066157 3300005545 Bacteria 2355
45 Ga0070696_100071930 3300005546 Bacteria 2434
46 Ga0070704_100036751 3300005549 Bacteria 3339
47 Ga0068856_100064676 3300005614 Bacteria 3614
48 Ga0070717_10127038 3300006028 Bacteria 2190
49 Ga0070715_10000923 3300006163 Bacteria 8176
50 Ga0070716_100003843 3300006173 Bacteria 7128
51 Ga0070716_100070476 3300006173 Bacteria 2053
52 Ga0075433_10001182 3300006852 Bacteria 18987
53 Ga0075433_10059302 3300006852 Bacteria 3348
54 Ga0075434_100004475 3300006871 Bacteria 12610
55 Ga0075434_100264441 3300006871 Unclassified 1739
56 Ga0075436_100016207 3300006914 Bacteria 5102
57 Ga0075436_100026188 3300006914 Bacteria 4015
58 Ga0075435_100048606 3300007076 Bacteria 3408
59 Ga0075435_100097640 3300007076 Unclassified 2431
60 Ga0105240_10089451 3300009093 Bacteria 3765
61 Ga0105245_10059296 3300009098 Bacteria 3446
62 Ga0105245_10100620 3300009098 Bacteria 2674
63 Ga0105243_10067860 3300009148 Bacteria 2873
64 Ga0105242_10042637 3300009176 Bacteria 3666
65 Ga0105248_10160251 3300009177 Bacteria 2538
66 Ga0105238_10082703 3300009551 Bacteria 3200
67 Ga0105239_10157995 3300010375 Bacteria 2533
68 Ga0105239_10168798 3300010375 Bacteria 2447
69 Ga0105239_10185167 3300010375 Bacteria 2330
70 Ga0105246_10153979 3300011119 Bacteria 1743
71 Ga0157373_10041703 3300013100 Bacteria 3282
72 Ga0157369_10071962 3300013105 Bacteria 3711
73 Ga0157369_10144304 3300013105 Bacteria 2517
74 Ga0157378_10153863 3300013297 Bacteria 2145
75 Ga0163162_10037765 3300013306 Bacteria 4820
76 Ga0157372_10244345 3300013307 Bacteria 2083
77 Ga0163163_10003049 3300014325 Bacteria 14173
78 Ga0157376_10036136 3300014969 Bacteria 4000
79 Ga0157376_10048110 3300014969 Bacteria 3524
80 Ga0224712_10013410 3300022467 Bacteria 2608
81 Ga0207692_10004388 3300025898 Bacteria 5584
82 Ga0207685_10009554 3300025905 Bacteria 2823
83 Ga0207699_10084206 3300025906 Unclassified 1980
84 Ga0207705_10065056 3300025909 Bacteria 2635
85 Ga0207684_10027649 3300025910 Bacteria 4830
86 Ga0207684_10050818 3300025910 Bacteria 3517
87 Ga0207693_10003211 3300025915 Bacteria 14029
88 Ga0207693_10033874 3300025915 Bacteria 4029
89 Ga0207663_10002277 3300025916 Bacteria 9188
90 Ga0207663_10003654 3300025916 Bacteria 7560
91 Ga0207663_10049986 3300025916 Bacteria 2596
92 Ga0207663_10067147 3300025916 Unclassified 2299
93 Ga0207646_10006565 3300025922 Bacteria 12004
94 Ga0207646_10012214 3300025922 Bacteria 8263
95 Ga0207687_10037379 3300025927 Bacteria 3312
96 Ga0207700_10009694 3300025928 Bacteria 6032
97 Ga0207664_10014061 3300025929 Bacteria 5771
98 Ga0207664_10017014 3300025929 Bacteria 5318
99 Ga0207664_10032381 3300025929 Bacteria 4006
100 Ga0207644_10071688 3300025931 Bacteria 2535
101 Ga0207665_10001406 3300025939 Bacteria 16192
102 Ga0207665_10013325 3300025939 Bacteria 5404
103 Ga0207665_10032021 3300025939 Bacteria 3481
104 Ga0207711_10187582 3300025941 Bacteria 1883
105 Ga0207702_10008207 3300026078 Bacteria 8827
106 Ga0207702_10087914 3300026078 Bacteria 2714
107 Ga0207683_10005139 3300026121 Bacteria 11236
108 Ga0373948_0002846 3300034817 Bacteria 2598
109 Ga0373958_0003454 3300034819 Bacteria 2279
110 Ga0373959_0003493 3300034820 Bacteria 2505
111 Ga0373959_0006265 3300034820 Unclassified 1969
112 Ga0373928_0008652 3300035084 Bacteria 1979
113 Ga0373940_0002810 3300035088 Bacteria 3456
114 Ga0373949_0004457 3300035090 Bacteria 3211
115 Ga0373949_0010371 3300035090 Unclassified 2042
116 Ga0373951_0005670 3300035091 Bacteria 2891
117 Ga0373932_0003711 3300035112 Bacteria 3649
118 Ga0373941_0022951 3300035115 Unclassified 1776
119 Ga0373960_0008168 3300035121 Bacteria 2501
120 Ga0373962_0009204 3300035242 Unclassified 2442
121 Ga0373935_0059783 3300035692 Bacteria 2437
122 Ga0373947_0032255 3300035725 Bacteria 3086
123 Ga0373925_0108347 3300037068 Bacteria 2143
124 Ga0395900_0099424 3300037418 Bacteria 2988
125 Ga0395898_0024357 3300037466 Bacteria 6104
126 Ga0395905_0048537 3300037471 Bacteria 3979
127 Ga0395905_0202661 3300037471 Bacteria 1860
128 Ga0436365_1537649 3300039437 Bacteria 2359
129 Ga0466969_0000542 3300044656 Bacteria 20684
130 Ga0466966_0012238 3300044684 Bacteria 5683
131 Ga0466966_0014074 3300044684 Bacteria 5296
132 Ga0466966_0065878 3300044684 Bacteria 2277
133 Ga0466961_0013925 3300044693 Bacteria 5154
134 Ga0466961_0035635 3300044693 Bacteria 3194
135 Ga0466963_0000371 3300044694 Bacteria 20420
136 Ga0466963_0003029 3300044694 Bacteria 9512
137 Ga0466963_0006223 3300044694 Bacteria 7048
138 Ga0466963_0006779 3300044694 Bacteria 6810
139 Ga0466963_0007033 3300044694 Bacteria 6700
140 Ga0466963_0007218 3300044694 Bacteria 6625
141 Ga0466963_0012972 3300044694 Bacteria 5108
142 Ga0466963_0029824 3300044694 Bacteria 3514
143 Ga0466963_0034774 3300044694 Bacteria 3280
144 Ga0466963_0035705 3300044694 Bacteria 3239
145 Ga0466963_0037540 3300044694 Bacteria 3164
146 Ga0466964_0016075 3300044706 Bacteria 2851
147 Ga0466964_0017691 3300044706 Bacteria 2729
148 Ga0466971_0002974 3300044719 Bacteria 7199
149 Ga0466971_0005794 3300044719 Bacteria 5376
150 Ga0466968_0000590 3300044735 Bacteria 12374
151 Ga0466970_0000979 3300044765 Bacteria 13756
152 Ga0466957_0001177 3300044842 Bacteria 13587
153 Ga0466957_0007876 3300044842 Bacteria 6042
154 Ga0466957_0011369 3300044842 Bacteria 5133
155 Ga0466957_0026245 3300044842 Bacteria 3455
156 Ga0466957_0035021 3300044842 Bacteria 3012
157 Ga0466957_0076397 3300044842 Bacteria 2079
158 Ga0466959_0019506 3300045049 Bacteria 4986
159 Ga0466959_0024186 3300045049 Bacteria 4498
160 Ga0466959_0044327 3300045049 Bacteria 3278
161 Ga0451576_0132048 3300045051 Bacteria 2603
162 Ga0466958_0000140 3300045836 Bacteria 24688
163 Ga0466958_0001684 3300045836 Bacteria 10659
164 Ga0466958_0002953 3300045836 Bacteria 8704
165 Ga0466958_0004047 3300045836 Bacteria 7684
166 Ga0466958_0011476 3300045836 Unclassified 4989
167 Ga0466958_0012459 3300045836 Bacteria 4820
168 Ga0466958_0016201 3300045836 Bacteria 4287
169 Ga0466958_0035028 3300045836 Bacteria 2998
170 Ga0466967_0000051 3300045976 Bacteria 42390
171 Ga0466967_0005457 3300045976 Bacteria 8819
172 Ga0466967_0009053 3300045976 Bacteria 7360
173 Ga0466967_0014988 3300045976 Bacteria 6062
174 Ga0466967_0031913 3300045976 Bacteria 4441
175 Ga0466967_0034379 3300045976 Bacteria 4302
176 Ga0466967_0038001 3300045976 Bacteria 4125
177 Ga0466967_0059525 3300045976 Bacteria 3381
178 Ga0466967_0064952 3300045976 Bacteria 3247
179 Ga0466967_0069911 3300045976 Bacteria 3139
180 Ga0466967_0069983 3300045976 Bacteria 3138
181 Ga0466967_0078803 3300045976 Bacteria 2968
182 Ga0466967_0081640 3300045976 Bacteria 2920
183 Ga0466967_0209048 3300045976 Unclassified 1850
184 Ga0466967_0237263 3300045976 Bacteria 1738
185 Ga0495592_0006630 3300046454 Bacteria 8633
186 Ga0495603_0000833 3300046455 Bacteria 17713
187 Ga0495603_0001806 3300046455 Bacteria 12630
188 Ga0495641_0009154 3300046461 Bacteria 5924
189 Ga0495641_0013185 3300046461 Bacteria 4563
190 Ga0495651_0007483 3300046462 Bacteria 8352
191 Ga0495653_0017772 3300046463 Bacteria 5783
192 Ga0495584_0007062 3300046491 Bacteria 5869
193 Ga0495607_0019751 3300046501 Bacteria 4274
194 Ga0495608_0005819 3300046511 Bacteria 8784
195 Ga0495608_0023889 3300046511 Bacteria 4182
196 Ga0495630_0007239 3300046517 Bacteria 7917
197 Ga0495631_0047603 3300046518 Bacteria 1882
198 Ga0495644_0012536 3300046523 Bacteria 3259
199 Ga0495640_0023212 3300046533 Bacteria 4527
200 Ga0495640_0038325 3300046533 Bacteria 3372
201 Ga0495587_0007084 3300046536 Bacteria 7271
202 Ga0495587_0008991 3300046536 Bacteria 6412
203 Ga0495645_0010583 3300046543 Bacteria 6474
204 Ga0495656_0004831 3300046615 Bacteria 4637
205 Ga0495635_0005056 3300046663 Bacteria 9171
206 Ga0495635_0053726 3300046663 Bacteria 2775
207 Ga0495599_0002855 3300046678 Bacteria 10069
208 Ga0495599_0004807 3300046678 Bacteria 8031
209 Ga0495581_0005323 3300047315 Bacteria 7441
210 Ga0495674_0022787 3300047319 Bacteria 5772
211 Ga0495674_0022963 3300047319 Bacteria 5747
212 Ga0495674_0163112 3300047319 Bacteria 1863
213 Ga0495680_0009186 3300047322 Bacteria 8916
214 Ga0495677_0018563 3300047445 Bacteria 2520
215 Ga0495684_0006691 3300047471 Bacteria 8944
216 Ga0495684_0061207 3300047471 Bacteria 2864
217 Ga0496100_0050123 3300048903 Bacteria 2703
218 Ga0496101_0010929 3300048904 Bacteria 6009
219 Ga0496101_0030750 3300048904 Bacteria 3768
220 Ga0496101_0040589 3300048904 Bacteria 3314
221 Ga0496101_0052655 3300048904 Bacteria 2935
222 Ga0496102_0001817 3300048905 Bacteria 18424
223 Ga0496102_0019257 3300048905 Bacteria 6012
224 Ga0496102_0023615 3300048905 Bacteria 5464
225 Ga0496102_0064675 3300048905 Bacteria 3350
226 Ga0496102_0075793 3300048905 Bacteria 3092
227 Ga0496102_0116228 3300048905 Bacteria 2496
228 Ga0496103_0017157 3300048906 Bacteria 4328
229 Ga0496103_0038948 3300048906 Bacteria 2919
230 Ga0496104_0000941 3300048907 Bacteria 25013
231 Ga0496104_0009917 3300048907 Bacteria 8504
232 Ga0496104_0103654 3300048907 Bacteria 2725
233 Ga0496104_0142980 3300048907 Bacteria 2298
234 Ga0496105_0000337 3300048908 Bacteria 30737
235 Ga0496105_0001896 3300048908 Bacteria 15007
236 Ga0496105_0056418 3300048908 Bacteria 3242
237 Ga0496105_0126146 3300048908 Bacteria 2110
238 Ga0496106_0001221 3300048909 Bacteria 19231
239 Ga0496106_0038490 3300048909 Bacteria 3579
240 Ga0496107_0001299 3300048910 Bacteria 15300
241 Ga0496107_0004175 3300048910 Bacteria 9755
242 Ga0496107_0015560 3300048910 Bacteria 5333
243 Ga0496107_0045521 3300048910 Bacteria 3156
244 Ga0496108_0009865 3300048911 Bacteria 7739
245 Ga0496108_0015135 3300048911 Bacteria 6294
246 Ga0496108_0018330 3300048911 Bacteria 5732
247 Ga0496108_0019548 3300048911 Bacteria 5563
248 Ga0496108_0065086 3300048911 Bacteria 3072
249 Ga0496109_0000505 3300048912 Bacteria 33331
250 Ga0496109_0003419 3300048912 Bacteria 13281
251 Ga0496109_0007180 3300048912 Bacteria 9414
252 Ga0496109_0037750 3300048912 Bacteria 4365
253 Ga0496109_0069614 3300048912 Bacteria 3227
254 Ga0496109_0074687 3300048912 Bacteria 3117
255 Ga0496109_0098012 3300048912 Bacteria 2718
256 Ga0496109_0126845 3300048912 Bacteria 2379
257 Ga0496109_0187975 3300048912 Unclassified 1940
258 Ga0496110_0003131 3300048913 Bacteria 12568
259 Ga0496111_0000636 3300048914 Bacteria 18491
260 Ga0496111_0004539 3300048914 Bacteria 8786
261 Ga0496111_0012319 3300048914 Bacteria 5785
262 Ga0496111_0076534 3300048914 Bacteria 2439
263 Ga0496111_0096633 3300048914 Bacteria 2168
264 Ga0496112_0058469 3300048915 Bacteria 3797
265 Ga0496112_0125688 3300048915 Unclassified 2535
266 Ga0496112_0175419 3300048915 Bacteria 2108
267 Ga0496113_0010715 3300048916 Bacteria 6074
268 Ga0496113_0019072 3300048916 Bacteria 4791
269 Ga0496113_0020046 3300048916 Bacteria 4693
270 Ga0496113_0032134 3300048916 Bacteria 3813
271 Ga0496113_0050950 3300048916 Bacteria 3088
272 Ga0496113_0064447 3300048916 Bacteria 2771
273 Ga0496113_0082614 3300048916 Bacteria 2464
274 Ga0496114_0004023 3300048917 Bacteria 11357
275 Ga0496114_0005280 3300048917 Bacteria 10092
276 Ga0496114_0014352 3300048917 Bacteria 6355
277 Ga0496114_0017224 3300048917 Bacteria 5829
278 Ga0496114_0099149 3300048917 Bacteria 2485
279 Ga0496115_0001552 3300048918 Bacteria 16501
280 Ga0496115_0002732 3300048918 Bacteria 12672
281 Ga0496115_0020787 3300048918 Bacteria 5064
282 Ga0496115_0022019 3300048918 Bacteria 4930
283 Ga0496115_0027453 3300048918 Bacteria 4452
284 Ga0496115_0124089 3300048918 Bacteria 2126
285 Ga0501042_0142412 3300049578 Bacteria 1728
286 Ga0501069_0007023 3300049585 Bacteria 5894
287 nmdc:mga0n895_13418_c1 3300050512 Bacteria 7390
288 nmdc:mga0n895_20411_c1 3300050512 Bacteria 6180
289 nmdc:mga0n895_258699_c1 3300050512 Bacteria 1767
290 nmdc:mga0rr50_11144_c1 3300050513 Bacteria 5737
291 nmdc:mga0rr50_11710_c1 3300050513 Bacteria 5630
292 nmdc:mga0rr50_127558_c1 3300050513 Bacteria 2033
293 nmdc:mga08x19_112001_c1 3300050514 Bacteria 1821
294 nmdc:mga08x19_26482_c1 3300050514 Bacteria 3619
295 nmdc:mga08x19_84463_c1 3300050514 Bacteria 2088
296 nmdc:mga0a205_15146_c1 3300050515 Bacteria 7204
297 nmdc:mga0a205_16098_c1 3300050515 Bacteria 7001
298 nmdc:mga0a205_59462_c1 3300050515 Bacteria 3691
299 Ga0495601_0003342 3300053077 Bacteria 9184
300 Ga0495612_0017707 3300053078 Bacteria 2852
301 Ga0495595_0002525 3300053084 Bacteria 7182
302 Ga0495595_0038213 3300053084 Bacteria 2186
303 Ga0495619_0008681 3300053085 Bacteria 6427
304 Ga0466962_0002045 3300061719 Bacteria 9540
305 Ga0466962_0003930 3300061719 Bacteria 7112
306 Ga0466962_0008673 3300061719 Bacteria 4875
307 Ga0466962_0022072 3300061719 Bacteria 3058
308 Ga0466962_0024020 3300061719 Bacteria 2929
309 Ga0466963_0000441
310 rootH1_10303273
311 Ga0070683_100007075
312 Ga0070682_100040867
313 Ga0070709_10003217
314 Ga0070709_10090261
315 Ga0070709_10117784
316 Ga0070714_100002678
317 Ga0070714_100006765
318 Ga0070714_100026939
319 Ga0070714_100033771
320 Ga0070714_100100608
321 Ga0070714_100106115
322 Ga0070714_100108117
323 Ga0070713_100001075
324 Ga0070713_100182632
325 Ga0070710_10012068
326 Ga0070711_100004232
327 Ga0070711_100021992
328 Ga0070711_100087040
329 Ga0070711_100161003
330 Ga0070705_100023809
331 Ga0070705_100024235
332 Ga0070694_100037422
333 Ga0070708_100038955
334 Ga0070708_100047876
335 Ga0070708_100215438
336 Ga0070681_10041148
337 Ga0070706_100020127
338 Ga0070706_100056882
339 Ga0070706_100133744
340 Ga0070706_100175589
341 Ga0070707_100000457
342 Ga0070707_100007870
343 Ga0070707_100024348
344 Ga0070698_100004350
345 Ga0070698_100215613
346 Ga0070699_100027054
347 Ga0070699_100132577
348 Ga0070679_100038695
349 Ga0070684_100028337
350 Ga0070695_100000074
351 Ga0070695_100040421
352 Ga0070695_100066157
353 Ga0070696_100071930
354 Ga0070704_100036751
355 Ga0068856_100064676
356 Ga0070717_10127038
357 Ga0070715_10000923
358 Ga0070716_100003843
359 Ga0070716_100070476
360 Ga0075433_10001182
361 Ga0075433_10059302
362 Ga0075434_100004475
363 Ga0075434_100264441
364 Ga0075436_100016207
365 Ga0075436_100026188
366 Ga0075435_100048606
367 Ga0075435_100097640
368 Ga0105240_10089451
369 Ga0105245_10059296
370 Ga0105245_10100620
371 Ga0105243_10067860
372 Ga0105242_10042637
373 Ga0105248_10160251
374 Ga0105238_10082703
375 Ga0105239_10157995
376 Ga0105239_10168798
377 Ga0105239_10185167
378 Ga0105246_10153979
379 Ga0157373_10041703
380 Ga0157369_10071962
381 Ga0157369_10144304
382 Ga0157378_10153863
383 Ga0163162_10037765
384 Ga0157372_10244345
385 Ga0163163_10003049
386 Ga0157376_10036136
387 Ga0157376_10048110
388 Ga0224712_10013410
389 Ga0207692_10004388
390 Ga0207685_10009554
391 Ga0207699_10084206
392 Ga0207705_10065056
393 Ga0207684_10027649
394 Ga0207684_10050818
395 Ga0207693_10003211
396 Ga0207693_10033874
397 Ga0207663_10002277
398 Ga0207663_10003654
399 Ga0207663_10049986
400 Ga0207663_10067147
401 Ga0207646_10006565
402 Ga0207646_10012214
403 Ga0207687_10037379
404 Ga0207700_10009694
405 Ga0207664_10014061
406 Ga0207664_10017014
407 Ga0207664_10032381
408 Ga0207644_10071688
409 Ga0207665_10001406
410 Ga0207665_10013325
411 Ga0207665_10032021
412 Ga0207711_10187582
413 Ga0207702_10008207
414 Ga0207702_10087914
415 Ga0207683_10005139
416 Ga0373948_0002846
417 Ga0373958_0003454
418 Ga0373959_0003493
419 Ga0373959_0006265
420 Ga0373928_0008652
421 Ga0373940_0002810
422 Ga0373949_0004457
423 Ga0373949_0010371
424 Ga0373951_0005670
425 Ga0373932_0003711
426 Ga0373941_0022951
427 Ga0373960_0008168
428 Ga0373962_0009204
429 Ga0373935_0059783
430 Ga0373947_0032255
431 Ga0373925_0108347
432 Ga0395900_0099424
433 Ga0395898_0024357
434 Ga0395905_0048537
435 Ga0395905_0202661
436 Ga0436365_1537649
437 Ga0466969_0000542
438 Ga0466966_0012238
439 Ga0466966_0014074
440 Ga0466966_0065878
441 Ga0466961_0013925
442 Ga0466961_0035635
443 Ga0466963_0000371
444 Ga0466963_0003029
445 Ga0466963_0006223
446 Ga0466963_0006779
447 Ga0466963_0007033
448 Ga0466963_0007218
449 Ga0466963_0012972
450 Ga0466963_0029824
451 Ga0466963_0034774
452 Ga0466963_0035705
453 Ga0466963_0037540
454 Ga0466964_0016075
455 Ga0466964_0017691
456 Ga0466971_0002974
457 Ga0466971_0005794
458 Ga0466968_0000590
459 Ga0466970_0000979
460 Ga0466957_0001177
461 Ga0466957_0007876
462 Ga0466957_0011369
463 Ga0466957_0026245
464 Ga0466957_0035021
465 Ga0466957_0076397
466 Ga0466959_0019506
467 Ga0466959_0024186
468 Ga0466959_0044327
469 Ga0451576_0132048
470 Ga0466958_0000140
471 Ga0466958_0001684
472 Ga0466958_0002953
473 Ga0466958_0004047
474 Ga0466958_0011476
475 Ga0466958_0012459
476 Ga0466958_0016201
477 Ga0466958_0035028
478 Ga0466967_0000051
479 Ga0466967_0005457
480 Ga0466967_0009053
481 Ga0466967_0014988
482 Ga0466967_0031913
483 Ga0466967_0034379
484 Ga0466967_0038001
485 Ga0466967_0059525
486 Ga0466967_0064952
487 Ga0466967_0069911
488 Ga0466967_0069983
489 Ga0466967_0078803
490 Ga0466967_0081640
491 Ga0466967_0209048
492 Ga0466967_0237263
493 Ga0495592_0006630
494 Ga0495603_0000833
495 Ga0495603_0001806
496 Ga0495641_0009154
497 Ga0495641_0013185
498 Ga0495651_0007483
499 Ga0495653_0017772
500 Ga0495584_0007062
501 Ga0495607_0019751
502 Ga0495608_0005819
503 Ga0495608_0023889
504 Ga0495630_0007239
505 Ga0495631_0047603
506 Ga0495644_0012536
507 Ga0495640_0023212
508 Ga0495640_0038325
509 Ga0495587_0007084
510 Ga0495587_0008991
511 Ga0495645_0010583
512 Ga0495656_0004831
513 Ga0495635_0005056
514 Ga0495635_0053726
515 Ga0495599_0002855
516 Ga0495599_0004807
517 Ga0495581_0005323
518 Ga0495674_0022787
519 Ga0495674_0022963
520 Ga0495674_0163112
521 Ga0495680_0009186
522 Ga0495677_0018563
523 Ga0495684_0006691
524 Ga0495684_0061207
525 Ga0496100_0050123
526 Ga0496101_0010929
527 Ga0496101_0030750
528 Ga0496101_0040589
529 Ga0496101_0052655
530 Ga0496102_0001817
531 Ga0496102_0019257
532 Ga0496102_0023615
533 Ga0496102_0064675
534 Ga0496102_0075793
535 Ga0496102_0116228
536 Ga0496103_0017157
537 Ga0496103_0038948
538 Ga0496104_0000941
539 Ga0496104_0009917
540 Ga0496104_0103654
541 Ga0496104_0142980
542 Ga0496105_0000337
543 Ga0496105_0001896
544 Ga0496105_0056418
545 Ga0496105_0126146
546 Ga0496106_0001221
547 Ga0496106_0038490
548 Ga0496107_0001299
549 Ga0496107_0004175
550 Ga0496107_0015560
551 Ga0496107_0045521
552 Ga0496108_0009865
553 Ga0496108_0015135
554 Ga0496108_0018330
555 Ga0496108_0019548
556 Ga0496108_0065086
557 Ga0496109_0000505
558 Ga0496109_0003419
559 Ga0496109_0007180
560 Ga0496109_0037750
561 Ga0496109_0069614
562 Ga0496109_0074687
563 Ga0496109_0098012
564 Ga0496109_0126845
565 Ga0496109_0187975
566 Ga0496110_0003131
567 Ga0496111_0000636
568 Ga0496111_0004539
569 Ga0496111_0012319
570 Ga0496111_0076534
571 Ga0496111_0096633
572 Ga0496112_0058469
573 Ga0496112_0125688
574 Ga0496112_0175419
575 Ga0496113_0010715
576 Ga0496113_0019072
577 Ga0496113_0020046
578 Ga0496113_0032134
579 Ga0496113_0050950
580 Ga0496113_0064447
581 Ga0496113_0082614
582 Ga0496114_0004023
583 Ga0496114_0005280
584 Ga0496114_0014352
585 Ga0496114_0017224
586 Ga0496114_0099149
587 Ga0496115_0001552
588 Ga0496115_0002732
589 Ga0496115_0020787
590 Ga0496115_0022019
591 Ga0496115_0027453
592 Ga0496115_0124089
593 Ga0501042_0142412
594 Ga0501069_0007023
595 nmdc:mga0n895_13418_c1
596 nmdc:mga0n895_20411_c1
597 nmdc:mga0n895_258699_c1
598 nmdc:mga0rr50_11144_c1
599 nmdc:mga0rr50_11710_c1
600 nmdc:mga0rr50_127558_c1
601 nmdc:mga08x19_112001_c1
602 nmdc:mga08x19_26482_c1
603 nmdc:mga08x19_84463_c1
604 nmdc:mga0a205_15146_c1
605 nmdc:mga0a205_16098_c1
606 nmdc:mga0a205_59462_c1
607 Ga0495601_0003342
608 Ga0495612_0017707
609 Ga0495595_0002525
610 Ga0495595_0038213
611 Ga0495619_0008681
612 Ga0466962_0002045
613 Ga0466962_0003930
614 Ga0466962_0008673
615 Ga0466962_0022072
616 Ga0466962_0024020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00496

SBP_bac_5

Bacterial extracellular solute-binding proteins, family 5 Middle

106

476

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vr5-assembly1.cif.gz_A crystal structure of oligopeptide abc transporter, periplasmic oligopeptide-binding (tm1223) from thermotoga maritima at 1.73 a resolution 0.8594 26 543
6i3g-assembly1.cif.gz_A crystal structure of a putative peptide binding protein appa from clostridium difficile 0.8546 29 543
6i3g-assembly1.cif.gz_A crystal structure of a putative peptide binding protein appa from clostridium difficile 0.8496 29 543
6lzu-assembly1.cif.gz_A f411a mutant of chitin-specific solute binding protein from vibrio harveyi co-crystalized with chitobiose. 0.8413 27 543
7ebm-assembly1.cif.gz_A w363a mutant of chitin-specific solute binding protein from vibrio harveyi in complex with chitobiose. 0.8338 26 542
ID Description Score Start End Superfamily
1zu0A02 Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 0.9395 63 168 3.90.76.10
1zu0A02 Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 0.9228 63 168 3.90.76.10
4pftA02 Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 0.8844 41 178 3.90.76.10
1zu0A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8832 167 266 3.40.190.10
1xocA02 Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 0.8646 62 175 3.90.76.10
ID Description Score Start End GO Terms
AF-A0A538F0N6-F1-model_v4 ABC transporter substrate-binding protein 0.8798 1 544 GO:0015833
GO:0042597
GO:0043190
GO:1904680
AF-A0A402BAM4-F1-model_v4 Peptide ABC transporter substrate-binding protein 0.8775 1 543 GO:0015833
GO:0042597
GO:0043190
GO:1904680
AF-A0A538F0N6-F1-model_v4 ABC transporter substrate-binding protein 0.8752 1 544 GO:0015833
GO:0042597
GO:0043190
GO:1904680
AF-A0A7T5ESG9-F1-model_v4 ABC transporter substrate-binding protein 0.8746 1 544 GO:0015833
GO:0042597
GO:0043190
GO:1904680
AF-A0A402BAM4-F1-model_v4 Peptide ABC transporter substrate-binding protein 0.8744 1 543 GO:0015833
GO:0042597
GO:0043190
GO:1904680

Map