F399694

General Info

Members Datasets Scaffolds Average Seq Length
308 157 616 149

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_11851745|Ga0157380_118517451
Length 149
Sequence MDDWHETEIRVRYAETDQMGIVHHANYLVWFEAGRSELCRSRGFSYKEMEDDDALMVVAESYLRYKSPAYYEDVLLIRTKVAEVRSRSIRFVYEVYRADDDELLAEGETLHLVTDTNKKVRQIPERYKQILLAGEDQQELSFPGNQAPS

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
135 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
138 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
139 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
140 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
141 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
151 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
152 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
153 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
154 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.27
Rhizosphere 96.43
Stem 0
Stem Tuber 0
Unclassified 3.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_11851745 3300014326 Bacteria 663
2 LJQas_1002206 3300000549 Bacteria 2747
3 Ga0065712_10040196 3300005290 Bacteria 1108
4 Ga0065712_10056216 3300005290 Bacteria 680
5 Ga0065715_10019163 3300005293 Bacteria 2232
6 Ga0065707_10136470 3300005295 Bacteria 1834
7 Ga0070676_10052930 3300005328 Bacteria 2389
8 Ga0070683_100077138 3300005329 Bacteria 3115
9 Ga0070690_100053266 3300005330 Bacteria 2588
10 Ga0070670_100153373 3300005331 Bacteria 1994
11 Ga0070670_100510574 3300005331 Bacteria 1070
12 Ga0070670_100623077 3300005331 Bacteria 966
13 Ga0070670_100971848 3300005331 Bacteria 772
14 Ga0070670_101028954 3300005331 Bacteria 749
15 Ga0068869_100028174 3300005334 Bacteria 3923
16 Ga0068869_100067276 3300005334 Bacteria 2643
17 Ga0070666_10064118 3300005335 Bacteria 2491
18 Ga0070680_100078801 3300005336 Bacteria 2715
19 Ga0070680_100245693 3300005336 Bacteria 1513
20 Ga0070682_100549378 3300005337 Bacteria 904
21 Ga0068868_100463975 3300005338 Bacteria 1104
22 Ga0070660_100108059 3300005339 Bacteria 2211
23 Ga0070689_100102061 3300005340 Bacteria 2272
24 Ga0070687_100405866 3300005343 Unclassified 895
25 Ga0070661_100015968 3300005344 Bacteria 5300
26 Ga0070661_100334776 3300005344 Bacteria 1185
27 Ga0070661_100588338 3300005344 Bacteria 899
28 Ga0070661_100755013 3300005344 Bacteria 796
29 Ga0070692_10101086 3300005345 Bacteria 1581
30 Ga0070668_100294285 3300005347 Bacteria 1360
31 Ga0070675_100632867 3300005354 Bacteria 972
32 Ga0070671_100009909 3300005355 Bacteria 7654
33 Ga0070671_100051613 3300005355 Bacteria 3420
34 Ga0070671_100246299 3300005355 Bacteria 1518
35 Ga0070673_100095191 3300005364 Bacteria 2443
36 Ga0070688_100253648 3300005365 Bacteria 1254
37 Ga0070688_100296768 3300005365 Bacteria 1167
38 Ga0070659_100049665 3300005366 Bacteria 3299
39 Ga0070659_100426107 3300005366 Bacteria 1123
40 Ga0070659_100607083 3300005366 Bacteria 941
41 Ga0070667_100078510 3300005367 Bacteria 2820
42 Ga0070667_100097389 3300005367 Bacteria 2537
43 Ga0070667_100170572 3300005367 Bacteria 1921
44 Ga0070705_100099334 3300005440 Bacteria 1834
45 Ga0070705_100894393 3300005440 Bacteria 714
46 Ga0070663_100034888 3300005455 Bacteria 3487
47 Ga0070678_100135575 3300005456 Bacteria 1963
48 Ga0070678_100390306 3300005456 Bacteria 1207
49 Ga0070662_100036291 3300005457 Bacteria 3486
50 Ga0070681_10113254 3300005458 Bacteria 2652
51 Ga0070681_10146266 3300005458 Bacteria 2292
52 Ga0068867_100081482 3300005459 Bacteria 2440
53 Ga0068867_100271560 3300005459 Bacteria 1387
54 Ga0070685_10360326 3300005466 Bacteria 997
55 Ga0070698_100220185 3300005471 Bacteria 1832
56 Ga0070679_100072391 3300005530 Bacteria 3439
57 Ga0070679_100106545 3300005530 Bacteria 2789
58 Ga0070684_100212377 3300005535 Bacteria 1764
59 Ga0070684_100343401 3300005535 Bacteria 1373
60 Ga0070684_100436380 3300005535 Bacteria 1210
61 Ga0070697_101001798 3300005536 Bacteria 743
62 Ga0068853_100014333 3300005539 Bacteria 6488
63 Ga0068853_100014447 3300005539 Bacteria 6465
64 Ga0068853_100126225 3300005539 Bacteria 2286
65 Ga0070672_100159263 3300005543 Bacteria 1872
66 Ga0070672_100862582 3300005543 Bacteria 799
67 Ga0070686_100053267 3300005544 Bacteria 2582
68 Ga0070665_100269495 3300005548 Bacteria 1704
69 Ga0070704_100042615 3300005549 Bacteria 3141
70 Ga0068855_100070574 3300005563 Bacteria 4063
71 Ga0068855_100397118 3300005563 Bacteria 1512
72 Ga0068855_100800802 3300005563 Bacteria 1001
73 Ga0070664_100046344 3300005564 Bacteria 3672
74 Ga0070664_100141896 3300005564 Bacteria 2116
75 Ga0068856_101056524 3300005614 Bacteria 830
76 Ga0068852_100195563 3300005616 Bacteria 1911
77 Ga0068852_100290546 3300005616 Bacteria 1579
78 Ga0068859_100013220 3300005617 Bacteria 8284
79 Ga0068859_100022035 3300005617 Bacteria 6388
80 Ga0068859_100682394 3300005617 Bacteria 1118
81 Ga0068864_100024673 3300005618 Bacteria 5058
82 Ga0068864_100075567 3300005618 Bacteria 2942
83 Ga0068864_100185432 3300005618 Bacteria 1904
84 Ga0068864_100370348 3300005618 Bacteria 1355
85 Ga0068851_10086136 3300005834 Bacteria 1648
86 Ga0068851_10168059 3300005834 Bacteria 1209
87 Ga0068851_10333653 3300005834 Bacteria 879
88 Ga0068870_10107120 3300005840 Bacteria 1590
89 Ga0068863_100063925 3300005841 Bacteria 3480
90 Ga0068863_100436075 3300005841 Bacteria 1284
91 Ga0068858_100028510 3300005842 Bacteria 5185
92 Ga0068858_100457442 3300005842 Bacteria 1230
93 Ga0068860_100032077 3300005843 Bacteria 5050
94 Ga0068860_100151869 3300005843 Bacteria 2230
95 Ga0068860_101395698 3300005843 Unclassified 722
96 Ga0068862_100017497 3300005844 Bacteria 5970
97 Ga0068862_100021294 3300005844 Bacteria 5418
98 Ga0068862_100114296 3300005844 Bacteria 2372
99 Ga0068862_100216985 3300005844 Bacteria 1731
100 Ga0097621_100444285 3300006237 Bacteria 1167
101 Ga0097621_100785227 3300006237 Bacteria 881
102 Ga0068871_100218172 3300006358 Bacteria 1652
103 Ga0068871_100357258 3300006358 Bacteria 1293
104 Ga0075428_100369771 3300006844 Bacteria 1538
105 Ga0097620_100013220 3300006931 Bacteria 8284
106 Ga0097620_100022035 3300006931 Bacteria 6388
107 Ga0097620_100682397 3300006931 Bacteria 1118
108 Ga0105240_10034258 3300009093 Bacteria 6552
109 Ga0105240_11187935 3300009093 Bacteria 808
110 Ga0111539_10322604 3300009094 Bacteria 1797
111 Ga0105247_10085625 3300009101 Bacteria 1993
112 Ga0105247_10398850 3300009101 Unclassified 980
113 Ga0105247_10467625 3300009101 Bacteria 912
114 Ga0105243_10111845 3300009148 Bacteria 2287
115 Ga0105241_10010144 3300009174 Bacteria 6917
116 Ga0105248_10193017 3300009177 Bacteria 2295
117 Ga0105248_10209135 3300009177 Bacteria 2198
118 Ga0105248_10847880 3300009177 Bacteria 1031
119 Ga0105248_12284876 3300009177 Bacteria 616
120 Ga0105248_13044802 3300009177 Bacteria 534
121 Ga0105237_10934718 3300009545 Bacteria 874
122 Ga0105249_10011770 3300009553 Bacteria 7691
123 Ga0105249_10055066 3300009553 Bacteria 3637
124 Ga0105249_10181170 3300009553 Bacteria 2050
125 Ga0105239_10030936 3300010375 Bacteria 5889
126 Ga0105239_10887185 3300010375 Bacteria 1023
127 Ga0157373_10041262 3300013100 Bacteria 3301
128 Ga0157370_10473164 3300013104 Bacteria 1151
129 Ga0157370_10810650 3300013104 Bacteria 852
130 Ga0157369_10006641 3300013105 Bacteria 13372
131 Ga0157374_10031900 3300013296 Bacteria 4793
132 Ga0157374_10084413 3300013296 Bacteria 3018
133 Ga0157374_11159032 3300013296 Bacteria 794
134 Ga0157374_11159039 3300013296 Bacteria 794
135 Ga0157378_10347372 3300013297 Bacteria 1448
136 Ga0157378_10353889 3300013297 Bacteria 1435
137 Ga0163162_10107904 3300013306 Bacteria 2880
138 Ga0163162_10137796 3300013306 Bacteria 2552
139 Ga0163162_10195387 3300013306 Bacteria 2152
140 Ga0163162_10243320 3300013306 Bacteria 1930
141 Ga0163162_10342400 3300013306 Bacteria 1628
142 Ga0163162_11295740 3300013306 Bacteria 828
143 Ga0157372_10094576 3300013307 Bacteria 3403
144 Ga0157372_10096081 3300013307 Bacteria 3376
145 Ga0157372_10190608 3300013307 Bacteria 2375
146 Ga0157372_10590818 3300013307 Bacteria 1294
147 Ga0157372_10794347 3300013307 Bacteria 1100
148 Ga0157375_10032747 3300013308 Bacteria 4932
149 Ga0157375_10034243 3300013308 Bacteria 4837
150 Ga0157375_10036569 3300013308 Bacteria 4699
151 Ga0157375_10204399 3300013308 Bacteria 2131
152 Ga0157375_10321558 3300013308 Bacteria 1712
153 Ga0157375_10420447 3300013308 Bacteria 1502
154 Ga0157375_11796025 3300013308 Bacteria 727
155 Ga0157375_12275433 3300013308 Bacteria 646
156 Ga0163163_10023489 3300014325 Bacteria 5852
157 Ga0163163_10170739 3300014325 Bacteria 2221
158 Ga0157380_10043826 3300014326 Bacteria 3504
159 Ga0157377_10067823 3300014745 Bacteria 2054
160 Ga0157379_10325387 3300014968 Bacteria 1404
161 Ga0163161_10006461 3300017792 Bacteria 8115
162 Ga0207682_10125069 3300025893 Bacteria 1144
163 Ga0207680_10177283 3300025903 Bacteria 1439
164 Ga0207680_10830843 3300025903 Bacteria 662
165 Ga0207645_10202553 3300025907 Bacteria 1306
166 Ga0207707_10462056 3300025912 Bacteria 1085
167 Ga0207660_10205749 3300025917 Bacteria 1539
168 Ga0207660_10686684 3300025917 Bacteria 835
169 Ga0207657_10040773 3300025919 Bacteria 4111
170 Ga0207649_10038082 3300025920 Bacteria 2910
171 Ga0207649_10190968 3300025920 Bacteria 1440
172 Ga0207652_10122341 3300025921 Bacteria 2316
173 Ga0207652_10796147 3300025921 Bacteria 840
174 Ga0207681_10175049 3300025923 Bacteria 1630
175 Ga0207650_10506249 3300025925 Bacteria 1009
176 Ga0207650_11044427 3300025925 Bacteria 695
177 Ga0207659_10015087 3300025926 Bacteria 4997
178 Ga0207644_10157909 3300025931 Bacteria 1760
179 Ga0207644_10244615 3300025931 Bacteria 1429
180 Ga0207644_10756114 3300025931 Bacteria 812
181 Ga0207690_10551606 3300025932 Bacteria 937
182 Ga0207706_10119004 3300025933 Bacteria 2322
183 Ga0207686_10166211 3300025934 Bacteria 1551
184 Ga0207709_10470508 3300025935 Bacteria 975
185 Ga0207670_10024334 3300025936 Bacteria 3783
186 Ga0207670_10170104 3300025936 Bacteria 1633
187 Ga0207670_10191399 3300025936 Bacteria 1548
188 Ga0207691_10180459 3300025940 Bacteria 1845
189 Ga0207691_10258610 3300025940 Unclassified 1501
190 Ga0207711_10329481 3300025941 Bacteria 1412
191 Ga0207661_10067992 3300025944 Bacteria 2900
192 Ga0207679_10246906 3300025945 Bacteria 1515
193 Ga0207679_10281524 3300025945 Bacteria 1426
194 Ga0207679_10519012 3300025945 Bacteria 1065
195 Ga0207679_10732249 3300025945 Bacteria 899
196 Ga0207667_10420104 3300025949 Bacteria 1360
197 Ga0207651_10071924 3300025960 Bacteria 2454
198 Ga0207712_10209051 3300025961 Bacteria 1553
199 Ga0207640_10167972 3300025981 Bacteria 1631
200 Ga0207640_10273949 3300025981 Bacteria 1322
201 Ga0207658_10337746 3300025986 Bacteria 1308
202 Ga0207658_10346140 3300025986 Bacteria 1293
203 Ga0207658_10833056 3300025986 Bacteria 838
204 Ga0207703_10020502 3300026035 Bacteria 5169
205 Ga0207703_10085968 3300026035 Bacteria 2633
206 Ga0207678_10032020 3300026067 Bacteria 4584
207 Ga0207678_11172045 3300026067 Bacteria 680
208 Ga0207708_10354476 3300026075 Bacteria 1204
209 Ga0207641_10081316 3300026088 Bacteria 2813
210 Ga0207641_10255109 3300026088 Bacteria 1639
211 Ga0207648_10157901 3300026089 Bacteria 2002
212 Ga0207648_10871175 3300026089 Bacteria 840
213 Ga0207648_11013624 3300026089 Bacteria 778
214 Ga0207676_10035555 3300026095 Bacteria 3782
215 Ga0207676_10136444 3300026095 Bacteria 2094
216 Ga0207676_10138730 3300026095 Bacteria 2078
217 Ga0207674_10048618 3300026116 Bacteria 4341
218 Ga0207674_10071186 3300026116 Bacteria 3494
219 Ga0207683_10376774 3300026121 Bacteria 1304
220 Ga0207698_10024689 3300026142 Bacteria 4224
221 Ga0207698_10399480 3300026142 Bacteria 1313
222 Ga0207698_10757066 3300026142 Bacteria 971
223 Ga0207698_11499720 3300026142 Bacteria 690
224 Ga0268266_10382859 3300028379 Bacteria 1327
225 Ga0268265_10027813 3300028380 Bacteria 4041
226 Ga0268265_10092649 3300028380 Bacteria 2419
227 Ga0268265_10136382 3300028380 Bacteria 2048
228 Ga0268265_10165707 3300028380 Bacteria 1883
229 Ga0268265_11025441 3300028380 Bacteria 816
230 Ga0268264_10216147 3300028381 Bacteria 1762
231 Ga0307408_100007893 3300031548 Bacteria 7038
232 Ga0307408_100084180 3300031548 Bacteria 2385
233 Ga0307408_100350769 3300031548 Bacteria 1252
234 Ga0307405_10002905 3300031731 Bacteria 7719
235 Ga0307405_10043411 3300031731 Bacteria 2743
236 Ga0307405_10105648 3300031731 Bacteria 1897
237 Ga0307405_10170965 3300031731 Bacteria 1550
238 Ga0307405_10231002 3300031731 Bacteria 1364
239 Ga0307413_10002601 3300031824 Bacteria 7378
240 Ga0307413_10018281 3300031824 Bacteria 3673
241 Ga0307413_10077893 3300031824 Bacteria 2113
242 Ga0307410_10001540 3300031852 Bacteria 10507
243 Ga0307410_10024260 3300031852 Bacteria 3787
244 Ga0307410_10080733 3300031852 Bacteria 2282
245 Ga0307410_10254861 3300031852 Unclassified 1366
246 Ga0307410_10404738 3300031852 Bacteria 1103
247 Ga0307410_10710906 3300031852 Unclassified 848
248 Ga0307406_10169073 3300031901 Bacteria 1580
249 Ga0307406_10246098 3300031901 Bacteria 1344
250 Ga0307406_10420545 3300031901 Bacteria 1064
251 Ga0307406_10444594 3300031901 Bacteria 1038
252 Ga0307406_10907862 3300031901 Bacteria 750
253 Ga0307406_11336139 3300031901 Bacteria 626
254 Ga0307407_10025804 3300031903 Bacteria 3103
255 Ga0307407_10078349 3300031903 Bacteria 1991
256 Ga0307407_10214617 3300031903 Bacteria 1297
257 Ga0307407_10310294 3300031903 Bacteria 1103
258 Ga0307407_10714450 3300031903 Unclassified 756
259 Ga0307412_10010595 3300031911 Bacteria 5313
260 Ga0307409_100000994 3300031995 Bacteria 13262
261 Ga0307409_100994577 3300031995 Bacteria 856
262 Ga0307416_100009064 3300032002 Bacteria 6477
263 Ga0307416_100039166 3300032002 Bacteria 3667
264 Ga0307416_100642125 3300032002 Bacteria 1145
265 Ga0307416_100712191 3300032002 Bacteria 1094
266 Ga0307416_100753781 3300032002 Bacteria 1066
267 Ga0307416_102120977 3300032002 Bacteria 664
268 Ga0307414_10059314 3300032004 Bacteria 2702
269 Ga0307414_10292767 3300032004 Bacteria 1373
270 Ga0307414_10485622 3300032004 Bacteria 1090
271 Ga0307414_10966912 3300032004 Bacteria 783
272 Ga0307414_11233063 3300032004 Bacteria 693
273 Ga0307411_10012532 3300032005 Bacteria 4633
274 Ga0307411_10088346 3300032005 Bacteria 2155
275 Ga0307411_10293400 3300032005 Bacteria 1300
276 Ga0307411_10757722 3300032005 Bacteria 851
277 Ga0307415_100056781 3300032126 Bacteria 2686
278 Ga0307415_100174878 3300032126 Bacteria 1678
279 Ga0373959_0074246 3300034820 Unclassified 774
280 Ga0373955_0285768 3300035172 Bacteria 993
281 Ga0395905_0115777 3300037471 Bacteria 2519
282 Ga0436365_0300624 3300039437 Unclassified 1030
283 Ga0439466_0152200 3300041411 Bacteria 708
284 Ga0451791_1446970 3300041451 Bacteria 1547
285 Ga0451807_1302089 3300041486 Unclassified 505
286 Ga0451807_2642645 3300041486 Bacteria 1348
287 Ga0451837_1656944 3300041494 Bacteria 2528
288 Ga0451845_0464675 3300041501 Bacteria 502
289 Ga0451849_1085633 3300041505 Bacteria 755
290 Ga0439432_054911 3300042006 Bacteria 1237
291 Ga0439464_0153491 3300042439 Bacteria 721
292 Ga0495645_0547895 3300046543 Bacteria 717
293 Ga0495668_0061472 3300046616 Bacteria 2071
294 Ga0495684_0122367 3300047471 Bacteria 1959
295 Ga0496104_0761888 3300048907 Bacteria 875
296 Ga0496105_0500825 3300048908 Bacteria 953
297 Ga0496109_0124893 3300048912 Bacteria 2399
298 Ga0496114_0217372 3300048917 Bacteria 1677
299 Ga0501072_0012827 3300049588 Bacteria 6407
300 Ga0501217_208887 3300049661 Unclassified 612
301 Ga0501224_029836 3300049664 Bacteria 816
302 Ga0501224_030476 3300049664 Bacteria 808
303 Ga0501239_021009 3300049672 Bacteria 801
304 Ga0501257_172859 3300049686 Bacteria 607
305 Ga0501270_010719 3300049767 Bacteria 1214
306 nmdc:mga08y16_1951429_c1 3300050511 Bacteria 537
307 Ga0495619_0082344 3300053085 Bacteria 2169
308 Ga0590071_045175 3300059421 Bacteria 1063
309 Ga0157380_11851745
310 LJQas_1002206
311 Ga0065712_10040196
312 Ga0065712_10056216
313 Ga0065715_10019163
314 Ga0065707_10136470
315 Ga0070676_10052930
316 Ga0070683_100077138
317 Ga0070690_100053266
318 Ga0070670_100153373
319 Ga0070670_100510574
320 Ga0070670_100623077
321 Ga0070670_100971848
322 Ga0070670_101028954
323 Ga0068869_100028174
324 Ga0068869_100067276
325 Ga0070666_10064118
326 Ga0070680_100078801
327 Ga0070680_100245693
328 Ga0070682_100549378
329 Ga0068868_100463975
330 Ga0070660_100108059
331 Ga0070689_100102061
332 Ga0070687_100405866
333 Ga0070661_100015968
334 Ga0070661_100334776
335 Ga0070661_100588338
336 Ga0070661_100755013
337 Ga0070692_10101086
338 Ga0070668_100294285
339 Ga0070675_100632867
340 Ga0070671_100009909
341 Ga0070671_100051613
342 Ga0070671_100246299
343 Ga0070673_100095191
344 Ga0070688_100253648
345 Ga0070688_100296768
346 Ga0070659_100049665
347 Ga0070659_100426107
348 Ga0070659_100607083
349 Ga0070667_100078510
350 Ga0070667_100097389
351 Ga0070667_100170572
352 Ga0070705_100099334
353 Ga0070705_100894393
354 Ga0070663_100034888
355 Ga0070678_100135575
356 Ga0070678_100390306
357 Ga0070662_100036291
358 Ga0070681_10113254
359 Ga0070681_10146266
360 Ga0068867_100081482
361 Ga0068867_100271560
362 Ga0070685_10360326
363 Ga0070698_100220185
364 Ga0070679_100072391
365 Ga0070679_100106545
366 Ga0070684_100212377
367 Ga0070684_100343401
368 Ga0070684_100436380
369 Ga0070697_101001798
370 Ga0068853_100014333
371 Ga0068853_100014447
372 Ga0068853_100126225
373 Ga0070672_100159263
374 Ga0070672_100862582
375 Ga0070686_100053267
376 Ga0070665_100269495
377 Ga0070704_100042615
378 Ga0068855_100070574
379 Ga0068855_100397118
380 Ga0068855_100800802
381 Ga0070664_100046344
382 Ga0070664_100141896
383 Ga0068856_101056524
384 Ga0068852_100195563
385 Ga0068852_100290546
386 Ga0068859_100013220
387 Ga0068859_100022035
388 Ga0068859_100682394
389 Ga0068864_100024673
390 Ga0068864_100075567
391 Ga0068864_100185432
392 Ga0068864_100370348
393 Ga0068851_10086136
394 Ga0068851_10168059
395 Ga0068851_10333653
396 Ga0068870_10107120
397 Ga0068863_100063925
398 Ga0068863_100436075
399 Ga0068858_100028510
400 Ga0068858_100457442
401 Ga0068860_100032077
402 Ga0068860_100151869
403 Ga0068860_101395698
404 Ga0068862_100017497
405 Ga0068862_100021294
406 Ga0068862_100114296
407 Ga0068862_100216985
408 Ga0097621_100444285
409 Ga0097621_100785227
410 Ga0068871_100218172
411 Ga0068871_100357258
412 Ga0075428_100369771
413 Ga0097620_100013220
414 Ga0097620_100022035
415 Ga0097620_100682397
416 Ga0105240_10034258
417 Ga0105240_11187935
418 Ga0111539_10322604
419 Ga0105247_10085625
420 Ga0105247_10398850
421 Ga0105247_10467625
422 Ga0105243_10111845
423 Ga0105241_10010144
424 Ga0105248_10193017
425 Ga0105248_10209135
426 Ga0105248_10847880
427 Ga0105248_12284876
428 Ga0105248_13044802
429 Ga0105237_10934718
430 Ga0105249_10011770
431 Ga0105249_10055066
432 Ga0105249_10181170
433 Ga0105239_10030936
434 Ga0105239_10887185
435 Ga0157373_10041262
436 Ga0157370_10473164
437 Ga0157370_10810650
438 Ga0157369_10006641
439 Ga0157374_10031900
440 Ga0157374_10084413
441 Ga0157374_11159032
442 Ga0157374_11159039
443 Ga0157378_10347372
444 Ga0157378_10353889
445 Ga0163162_10107904
446 Ga0163162_10137796
447 Ga0163162_10195387
448 Ga0163162_10243320
449 Ga0163162_10342400
450 Ga0163162_11295740
451 Ga0157372_10094576
452 Ga0157372_10096081
453 Ga0157372_10190608
454 Ga0157372_10590818
455 Ga0157372_10794347
456 Ga0157375_10032747
457 Ga0157375_10034243
458 Ga0157375_10036569
459 Ga0157375_10204399
460 Ga0157375_10321558
461 Ga0157375_10420447
462 Ga0157375_11796025
463 Ga0157375_12275433
464 Ga0163163_10023489
465 Ga0163163_10170739
466 Ga0157380_10043826
467 Ga0157377_10067823
468 Ga0157379_10325387
469 Ga0163161_10006461
470 Ga0207682_10125069
471 Ga0207680_10177283
472 Ga0207680_10830843
473 Ga0207645_10202553
474 Ga0207707_10462056
475 Ga0207660_10205749
476 Ga0207660_10686684
477 Ga0207657_10040773
478 Ga0207649_10038082
479 Ga0207649_10190968
480 Ga0207652_10122341
481 Ga0207652_10796147
482 Ga0207681_10175049
483 Ga0207650_10506249
484 Ga0207650_11044427
485 Ga0207659_10015087
486 Ga0207644_10157909
487 Ga0207644_10244615
488 Ga0207644_10756114
489 Ga0207690_10551606
490 Ga0207706_10119004
491 Ga0207686_10166211
492 Ga0207709_10470508
493 Ga0207670_10024334
494 Ga0207670_10170104
495 Ga0207670_10191399
496 Ga0207691_10180459
497 Ga0207691_10258610
498 Ga0207711_10329481
499 Ga0207661_10067992
500 Ga0207679_10246906
501 Ga0207679_10281524
502 Ga0207679_10519012
503 Ga0207679_10732249
504 Ga0207667_10420104
505 Ga0207651_10071924
506 Ga0207712_10209051
507 Ga0207640_10167972
508 Ga0207640_10273949
509 Ga0207658_10337746
510 Ga0207658_10346140
511 Ga0207658_10833056
512 Ga0207703_10020502
513 Ga0207703_10085968
514 Ga0207678_10032020
515 Ga0207678_11172045
516 Ga0207708_10354476
517 Ga0207641_10081316
518 Ga0207641_10255109
519 Ga0207648_10157901
520 Ga0207648_10871175
521 Ga0207648_11013624
522 Ga0207676_10035555
523 Ga0207676_10136444
524 Ga0207676_10138730
525 Ga0207674_10048618
526 Ga0207674_10071186
527 Ga0207683_10376774
528 Ga0207698_10024689
529 Ga0207698_10399480
530 Ga0207698_10757066
531 Ga0207698_11499720
532 Ga0268266_10382859
533 Ga0268265_10027813
534 Ga0268265_10092649
535 Ga0268265_10136382
536 Ga0268265_10165707
537 Ga0268265_11025441
538 Ga0268264_10216147
539 Ga0307408_100007893
540 Ga0307408_100084180
541 Ga0307408_100350769
542 Ga0307405_10002905
543 Ga0307405_10043411
544 Ga0307405_10105648
545 Ga0307405_10170965
546 Ga0307405_10231002
547 Ga0307413_10002601
548 Ga0307413_10018281
549 Ga0307413_10077893
550 Ga0307410_10001540
551 Ga0307410_10024260
552 Ga0307410_10080733
553 Ga0307410_10254861
554 Ga0307410_10404738
555 Ga0307410_10710906
556 Ga0307406_10169073
557 Ga0307406_10246098
558 Ga0307406_10420545
559 Ga0307406_10444594
560 Ga0307406_10907862
561 Ga0307406_11336139
562 Ga0307407_10025804
563 Ga0307407_10078349
564 Ga0307407_10214617
565 Ga0307407_10310294
566 Ga0307407_10714450
567 Ga0307412_10010595
568 Ga0307409_100000994
569 Ga0307409_100994577
570 Ga0307416_100009064
571 Ga0307416_100039166
572 Ga0307416_100642125
573 Ga0307416_100712191
574 Ga0307416_100753781
575 Ga0307416_102120977
576 Ga0307414_10059314
577 Ga0307414_10292767
578 Ga0307414_10485622
579 Ga0307414_10966912
580 Ga0307414_11233063
581 Ga0307411_10012532
582 Ga0307411_10088346
583 Ga0307411_10293400
584 Ga0307411_10757722
585 Ga0307415_100056781
586 Ga0307415_100174878
587 Ga0373959_0074246
588 Ga0373955_0285768
589 Ga0395905_0115777
590 Ga0436365_0300624
591 Ga0439466_0152200
592 Ga0451791_1446970
593 Ga0451807_1302089
594 Ga0451807_2642645
595 Ga0451837_1656944
596 Ga0451845_0464675
597 Ga0451849_1085633
598 Ga0439432_054911
599 Ga0439464_0153491
600 Ga0495645_0547895
601 Ga0495668_0061472
602 Ga0495684_0122367
603 Ga0496104_0761888
604 Ga0496105_0500825
605 Ga0496109_0124893
606 Ga0496114_0217372
607 Ga0501072_0012827
608 Ga0501217_208887
609 Ga0501224_029836
610 Ga0501224_030476
611 Ga0501239_021009
612 Ga0501257_172859
613 Ga0501270_010719
614 nmdc:mga08y16_1951429_c1
615 Ga0495619_0082344
616 Ga0590071_045175

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

19

104

0.98

PF13279

4HBT_2

Thioesterase-like superfamily

11

131

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.9452 4 131
5t06-assembly1.cif.gz_C crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with hexanoyl-coa 0.9442 3 130
2egi-assembly1.cif.gz_C crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9399 4 131
5kl9-assembly1.cif.gz_B crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with coa 0.939 2 129
5t07-assembly1.cif.gz_A crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with decanoyl-coa 0.9384 1 131
ID Description Score Start End Superfamily
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9452 4 131 3.10.129.10
5t06C00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9442 3 130 3.10.129.10
af_F4HX80_37_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9408 1 133 3.10.129.10
af_K7M802_8_100_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9334 55 112 3.10.129.10
3hm0D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9327 1 124 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A3B9ZEF4-F1-model_v4 Acyl-CoA thioesterase 0.9798 6 133 GO:0047617
AF-A0A1W1CIN0-F1-model_v4 4-hydroxybenzoyl-CoA thioesterase family active site 0.9786 4 131 GO:0047617
AF-A0A522WEE5-F1-model_v4 Acyl-CoA thioesterase 0.9768 6 134 GO:0047617
AF-A0A661KD56-F1-model_v4 Acyl-CoA thioesterase 0.9762 2 131 GO:0047617
AF-A0A143DE61-F1-model_v4 Acyl-CoA thioester hydrolase (Tol-pal system-associated acyl-CoA thioesterase) 0.9755 3 131 GO:0047617

Map