F399687

General Info

Members Datasets Scaffolds Average Seq Length
308 201 257 139

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_12062814|Ga0163162_120628141
Length 157
Sequence MDVIISHNPDCGTSRNTLGLIRNAGLEPHVIEYLKTPPTRLLLRQLLGRAGITVRDVLREKGTPYAELGLGDPSLSDDALLDAIEAHPILLNRPLVVTPRGVRLCRPSEAVLDLLPAQRGEFVKEDGERVVDEHGRRVATACSMARRSSSSPAGSNS

Samples

Sample ID Description Type Environment
1 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
2 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
3 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
4 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
5 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
6 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
7 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
8 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
9 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
10 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
11 2643221651 Afipia sp. Root123D2 Isolate Unclassified
12 2643221734 Bosea sp. Root670 Isolate Unclassified
13 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
14 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
15 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
16 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
17 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
18 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
19 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
20 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
21 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
22 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
23 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
24 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
25 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
26 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
27 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
28 2854911287 Brucella lupini LUP21 Isolate Unclassified
29 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
30 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
31 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
32 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
33 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
34 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
35 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
36 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
37 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
38 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
39 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
40 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
41 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
42 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
116 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
119 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
146 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
147 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 641522639 Methylobacterium sp. 4-46 Isolate Nodule
199 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
200 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
201 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.44
Metatranscriptomes 0
Isolates 16.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.19
Nodule 5.84
Rhizoplane 3.25
Rhizosphere 74.03
Stem 0
Stem Tuber 0
Unclassified 11.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10045428 3300001990 Bacteria 1342
2 rootH1_10060320 3300003323 Bacteria 3077
3 Ga0055524_1022296 3300003775 Bacteria 2073
4 Ga0070670_100179640 3300005331 Bacteria 1837
5 Ga0070666_10878781 3300005335 Bacteria 662
6 Ga0070680_100035397 3300005336 Bacteria 4030
7 Ga0070660_100990806 3300005339 Bacteria 710
8 Ga0070691_10477581 3300005341 Bacteria 716
9 Ga0070691_11040324 3300005341 Bacteria 513
10 Ga0070661_100420600 3300005344 Bacteria 1059
11 Ga0070668_100221822 3300005347 Bacteria 1560
12 Ga0070668_100902361 3300005347 Bacteria 790
13 Ga0070671_100052240 3300005355 Bacteria 3398
14 Ga0070667_100047945 3300005367 Bacteria 3595
15 Ga0070663_100178740 3300005455 Bacteria 1644
16 Ga0070662_100279466 3300005457 Bacteria 1351
17 Ga0070679_100537597 3300005530 Bacteria 1112
18 Ga0070684_100017131 3300005535 Bacteria 5939
19 Ga0068853_100514939 3300005539 Bacteria 1130
20 Ga0070693_100810860 3300005547 Bacteria 694
21 Ga0070665_100338490 3300005548 Bacteria 1509
22 Ga0070664_100835212 3300005564 Bacteria 862
23 Ga0068857_100164053 3300005577 Bacteria 2017
24 Ga0068856_100144192 3300005614 Bacteria 2389
25 Ga0068852_100614781 3300005616 Bacteria 1092
26 Ga0068863_100368870 3300005841 Bacteria 1401
27 Ga0081540_1019384 3300005983 Bacteria 4136
28 Ga0075365_10361311 3300006038 Bacteria 1024
29 Ga0075363_100049026 3300006048 Bacteria 2247
30 Ga0075364_10317927 3300006051 Bacteria 1060
31 Ga0075362_10624624 3300006177 Bacteria 558
32 Ga0068871_100087758 3300006358 Bacteria 2587
33 Ga0068865_100477761 3300006881 Bacteria 1035
34 Ga0105240_10106778 3300009093 Bacteria 3395
35 Ga0105240_10944202 3300009093 Bacteria 925
36 Ga0105245_10080038 3300009098 Bacteria 2984
37 Ga0105243_10312805 3300009148 Bacteria 1428
38 Ga0105241_10198810 3300009174 Bacteria 1673
39 Ga0105241_10358864 3300009174 Bacteria 1268
40 Ga0105242_10187118 3300009176 Bacteria 1830
41 Ga0105248_10244610 3300009177 Bacteria 2019
42 Ga0105248_11741923 3300009177 Bacteria 706
43 Ga0105237_10167816 3300009545 Bacteria 2194
44 Ga0105246_10040222 3300011119 Bacteria 3154
45 Ga0157369_10038996 3300013105 Bacteria 5193
46 Ga0163162_11953602 3300013306 Bacteria 672
47 Ga0163162_12062814 3300013306 Bacteria 654
48 Ga0157372_10422350 3300013307 Bacteria 1554
49 Ga0157372_10595899 3300013307 Bacteria 1288
50 Ga0157375_10613449 3300013308 Bacteria 1246
51 Ga0163163_10020055 3300014325 Bacteria 6291
52 Ga0163161_11824751 3300017792 Bacteria 541
53 Ga0213875_10248503 3300021388 Bacteria 839
54 Ga0209455_1001724 3300025272 Bacteria 9339
55 Ga0209758_1001334 3300025297 Bacteria 29905
56 Ga0209256_1000212 3300025299 Bacteria 109885
57 Ga0207697_10122152 3300025315 Bacteria 1121
58 Ga0207688_10006296 3300025901 Bacteria 6464
59 Ga0207643_10092965 3300025908 Bacteria 1760
60 Ga0207707_10001362 3300025912 Bacteria 22693
61 Ga0207707_10012630 3300025912 Bacteria 7339
62 Ga0207671_10158136 3300025914 Bacteria 1754
63 Ga0207660_10021958 3300025917 Bacteria 4297
64 Ga0207660_10092594 3300025917 Bacteria 2244
65 Ga0207649_10685786 3300025920 Bacteria 794
66 Ga0207652_10054262 3300025921 Bacteria 3445
67 Ga0207652_10157299 3300025921 Bacteria 2036
68 Ga0207681_10252706 3300025923 Bacteria 1377
69 Ga0207650_10144450 3300025925 Bacteria 1873
70 Ga0207687_10488558 3300025927 Bacteria 1026
71 Ga0207644_10338080 3300025931 Bacteria 1220
72 Ga0207706_10070104 3300025933 Bacteria 3083
73 Ga0207686_10288138 3300025934 Bacteria 1215
74 Ga0207661_10179682 3300025944 Bacteria 1847
75 Ga0207667_10476134 3300025949 Bacteria 1268
76 Ga0207668_11197245 3300025972 Bacteria 683
77 Ga0207703_10056119 3300026035 Bacteria 3207
78 Ga0207639_10433663 3300026041 Bacteria 1190
79 Ga0207639_10440445 3300026041 Bacteria 1181
80 Ga0207678_10213086 3300026067 Bacteria 1653
81 Ga0207702_11612143 3300026078 Bacteria 642
82 Ga0207641_10017320 3300026088 Bacteria 5898
83 Ga0207676_10548782 3300026095 Bacteria 1104
84 Ga0207674_10120011 3300026116 Bacteria 2598
85 Ga0209389_1000348 3300027296 Bacteria 28112
86 Ga0209489_113850 3300027361 Bacteria 6145
87 Ga0268266_10195487 3300028379 Bacteria 1849
88 Ga0265330_10017974 3300031235 Bacteria 3250
89 Ga0265330_10105664 3300031235 Bacteria 1204
90 Ga0265330_10218889 3300031235 Bacteria 804
91 Ga0265328_10051655 3300031239 Bacteria 1509
92 Ga0265325_10132576 3300031241 Bacteria 1192
93 Ga0265325_10329604 3300031241 Bacteria 677
94 Ga0265340_10144153 3300031247 Bacteria 1088
95 Ga0265339_10017910 3300031249 Bacteria 4186
96 Ga0265339_10127943 3300031249 Bacteria 1301
97 Ga0265339_10311316 3300031249 Bacteria 749
98 Ga0265316_10436406 3300031344 Bacteria 940
99 Ga0265316_10763428 3300031344 Bacteria 679
100 Ga0307508_10210449 3300031616 Bacteria 1545
101 Ga0265314_10022557 3300031711 Bacteria 4822
102 Ga0265314_10126517 3300031711 Bacteria 1600
103 Ga0265342_10006684 3300031712 Bacteria 8551
104 Ga0265342_10070681 3300031712 Bacteria 2036
105 Ga0265342_10127372 3300031712 Bacteria 1429
106 Ga0307409_100745138 3300031995 Bacteria 983
107 Ga0307415_101833045 3300032126 Bacteria 588
108 Ga0373931_0896816 3300035691 Bacteria 596
109 Ga0395899_0000058 3300037312 Bacteria 213049
110 Ga0395899_0000144 3300037312 Bacteria 108386
111 Ga0395900_0000027 3300037418 Bacteria 285957
112 Ga0395900_0000056 3300037418 Bacteria 213077
113 Ga0395900_0440972 3300037418 Bacteria 1260
114 Ga0395898_0000043 3300037466 Bacteria 301783
115 Ga0395898_0000114 3300037466 Bacteria 213068
116 Ga0395898_0216855 3300037466 Bacteria 1825
117 Ga0395905_0000032 3300037471 Bacteria 285932
118 Ga0395905_0000053 3300037471 Bacteria 213077
119 Ga0436364_1556608 3300037853 Bacteria 1428
120 Ga0395901_0000037 3300038443 Bacteria 213059
121 Ga0395901_0000056 3300038443 Bacteria 154356
122 Ga0451802_1166417 3300041460 Bacteria 1864
123 Ga0466965_0138399 3300044683 Bacteria 1266
124 Ga0466965_0387057 3300044683 Bacteria 771
125 Ga0466968_0013958 3300044735 Bacteria 3167
126 Ga0466960_0017871 3300044901 Bacteria 3100
127 Ga0466960_0585162 3300044901 Bacteria 661
128 Ga0495607_0416480 3300046501 Bacteria 609
129 Ga0495643_0051094 3300046522 Bacteria 2224
130 Ga0495648_0235587 3300046524 Bacteria 893
131 Ga0495668_0046435 3300046616 Bacteria 2413
132 Ga0495588_0615146 3300046674 Bacteria 569
133 Ga0495687_011883 3300047443 Bacteria 4649
134 Ga0495687_044838 3300047443 Bacteria 1918
135 Ga0495687_118552 3300047443 Bacteria 959
136 Ga0495681_0051462 3300047470 Bacteria 1937
137 Ga0495626_0287336 3300048091 Bacteria 652
138 Ga0496100_0133222 3300048903 Bacteria 1753
139 Ga0496100_0439916 3300048903 Bacteria 998
140 Ga0496101_0132478 3300048904 Bacteria 1894
141 Ga0496102_0234387 3300048905 Bacteria 1730
142 Ga0496103_0023649 3300048906 Bacteria 3706
143 Ga0496104_0202419 3300048907 Bacteria 1897
144 Ga0496109_0042210 3300048912 Bacteria 4131
145 Ga0496110_0051504 3300048913 Bacteria 3618
146 Ga0496115_0269472 3300048918 Bacteria 1399
147 Ga0496116_0094129 3300048919 Bacteria 1812
148 Ga0496118_0117687 3300048921 Bacteria 1742
149 Ga0496121_0284368 3300048924 Bacteria 1130
150 Ga0496121_0602269 3300048924 Bacteria 678
151 Ga0496122_0076012 3300048925 Bacteria 2366
152 Ga0496124_0704837 3300048927 Bacteria 639
153 Ga0496125_0154884 3300048928 Bacteria 1567
154 Ga0496126_0012391 3300048929 Bacteria 8740
155 Ga0501031_0014018 3300049568 Bacteria 5218
156 Ga0501031_0041973 3300049568 Bacteria 2987
157 Ga0501031_0058205 3300049568 Bacteria 2518
158 Ga0501031_0058631 3300049568 Bacteria 2509
159 Ga0501031_0447694 3300049568 Bacteria 834
160 Ga0501032_0000051 3300049569 Bacteria 101366
161 Ga0501032_0000298 3300049569 Bacteria 41726
162 Ga0501032_0001660 3300049569 Bacteria 17671
163 Ga0501032_0005043 3300049569 Bacteria 9871
164 Ga0501032_0139295 3300049569 Bacteria 1598
165 Ga0501033_0000251 3300049570 Bacteria 51944
166 Ga0501033_0000322 3300049570 Bacteria 45487
167 Ga0501033_0014839 3300049570 Bacteria 5914
168 Ga0501033_0029586 3300049570 Bacteria 4116
169 Ga0501033_0134877 3300049570 Bacteria 1786
170 Ga0501033_0204694 3300049570 Bacteria 1409
171 Ga0501033_0337448 3300049570 Bacteria 1057
172 Ga0501033_0523408 3300049570 Bacteria 819
173 Ga0501034_0000094 3300049571 Bacteria 163124
174 Ga0501034_0001379 3300049571 Bacteria 32672
175 Ga0501034_0199986 3300049571 Bacteria 1957
176 Ga0501034_0255211 3300049571 Bacteria 1697
177 Ga0501034_0375103 3300049571 Bacteria 1348
178 Ga0501034_0765450 3300049571 Bacteria 860
179 Ga0501034_0937405 3300049571 Bacteria 752
180 Ga0501036_0000083 3300049572 Bacteria 58665
181 Ga0501036_0000241 3300049572 Bacteria 36896
182 Ga0501036_0202109 3300049572 Bacteria 1671
183 Ga0501036_0256548 3300049572 Bacteria 1465
184 Ga0501036_0309181 3300049572 Bacteria 1322
185 Ga0501036_1458710 3300049572 Bacteria 554
186 Ga0501037_0000028 3300049573 Bacteria 139838
187 Ga0501037_0000057 3300049573 Bacteria 107920
188 Ga0501037_0018211 3300049573 Bacteria 5174
189 Ga0501037_0081194 3300049573 Bacteria 2351
190 Ga0501037_0096653 3300049573 Bacteria 2135
191 Ga0501037_0544306 3300049573 Bacteria 784
192 Ga0501038_0001623 3300049574 Bacteria 20923
193 Ga0501038_0002261 3300049574 Bacteria 17909
194 Ga0501038_0013669 3300049574 Bacteria 7399
195 Ga0501038_0014620 3300049574 Bacteria 7152
196 Ga0501038_0472924 3300049574 Bacteria 961
197 Ga0501038_0555852 3300049574 Bacteria 872
198 Ga0501039_0000226 3300049575 Bacteria 41251
199 Ga0501039_0026203 3300049575 Bacteria 4481
200 Ga0501039_0138112 3300049575 Bacteria 1914
201 Ga0501039_0304325 3300049575 Bacteria 1253
202 Ga0501039_1136676 3300049575 Bacteria 605
203 Ga0501039_1186719 3300049575 Bacteria 590
204 Ga0501040_0553299 3300049576 Bacteria 830
205 Ga0501043_0000028 3300049579 Bacteria 144125
206 Ga0501043_0000040 3300049579 Bacteria 117024
207 Ga0501043_0000466 3300049579 Bacteria 36144
208 Ga0501043_0689699 3300049579 Bacteria 747
209 Ga0501046_0035352 3300049580 Bacteria 4027
210 Ga0501046_0466182 3300049580 Bacteria 907
211 Ga0501046_0489015 3300049580 Bacteria 882
212 Ga0501046_0932911 3300049580 Bacteria 604
213 Ga0501047_0001360 3300049581 Bacteria 24002
214 Ga0501047_0026409 3300049581 Bacteria 5587
215 Ga0501047_0659290 3300049581 Bacteria 865
216 Ga0501047_0679809 3300049581 Bacteria 847
217 Ga0501067_0190847 3300049583 Bacteria 1141
218 Ga0501068_0052348 3300049584 Bacteria 2470
219 Ga0501069_0000014 3300049585 Bacteria 146321
220 Ga0501070_0000658 3300049586 Bacteria 31844
221 Ga0501070_0241219 3300049586 Bacteria 1479
222 Ga0501070_0296394 3300049586 Bacteria 1318
223 Ga0501070_0416074 3300049586 Bacteria 1086
224 Ga0501070_0825155 3300049586 Bacteria 727
225 Ga0501071_0036056 3300049587 Bacteria 3526
226 Ga0501073_0056982 3300049589 Bacteria 2732
227 Ga0501074_0000004 3300049590 Bacteria 114255
228 Ga0501074_0748540 3300049590 Bacteria 689
229 Ga0501080_0000728 3300049742 Bacteria 26548
230 Ga0501080_0120728 3300049742 Bacteria 2429
231 Ga0501083_0000025 3300049744 Bacteria 121349
232 Ga0501035_0000154 3300049822 Bacteria 84548
233 Ga0501035_0000277 3300049822 Bacteria 60737
234 Ga0501035_0000891 3300049822 Bacteria 31604
235 Ga0501035_0145119 3300049822 Bacteria 2062
236 Ga0501035_0167897 3300049822 Bacteria 1897
237 Ga0501035_0177023 3300049822 Bacteria 1839
238 Ga0501035_0419860 3300049822 Bacteria 1110
239 Ga0501044_0000052 3300049823 Bacteria 143626
240 Ga0501044_0001296 3300049823 Bacteria 29547
241 Ga0501044_0006091 3300049823 Bacteria 13308
242 Ga0501044_0063295 3300049823 Bacteria 3780
243 Ga0501044_0079764 3300049823 Bacteria 3316
244 Ga0501044_0095480 3300049823 Bacteria 2996
245 Ga0501044_0693604 3300049823 Bacteria 904
246 Ga0501045_0240460 3300049824 Bacteria 1348
247 nmdc:mga03683_71148_c1 3300050489 Bacteria 1487
248 nmdc:mga03n38_257621_c1 3300050490 Bacteria 924
249 nmdc:mga00v17_225688_c1 3300050491 Bacteria 1213
250 nmdc:mga0yw44_290720_c1 3300050492 Bacteria 1094
251 nmdc:mga07m45_16539_c1 3300050496 Bacteria 3949
252 nmdc:mga0sz30_354726_c1 3300050516 Bacteria 656
253 Ga0495612_0250555 3300053078 Bacteria 788
254 Ga0495655_0017966 3300053083 Bacteria 1548
255 Ga0500616_0002106 3300053153 Bacteria 17324
256 Ga0500609_006001 3300053731 Bacteria 1656
257 Ga0501082_0092273 3300060353 Bacteria 2616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100338490 Ga0070665_1003384901 117
2 3300041460 Ga0451802_1166417 Ga0451802_1166417_55_501 119
3 3300049589 Ga0501073_0056982 Ga0501073_0056982_803_1198 126
4 iso_pu_bacteria 2775506901 2776263226 128
5 3300048924 Ga0496121_0284368 Ga0496121_0284368_381_806 131
6 iso_pu_bacteria 2510917022 2511133555 132
7 iso_pu_bacteria 2513237161 2514016281 132
8 iso_pu_bacteria 2545555834 2545677181 132
9 iso_pu_bacteria 2582581307 2585273324 132
10 iso_pu_bacteria 2585427531 2585559375 132
11 iso_pu_bacteria 2585427608 2585902047 132
12 iso_pu_bacteria 2585427609 2585905248 132
13 iso_pu_bacteria 2585428125 2587979637 132
14 iso_pu_bacteria 2643221651 2644291580 132
15 iso_pu_bacteria 2643221734 2644737880 132
16 iso_pu_bacteria 2738541281 2738743854 132
17 iso_pu_bacteria 2738541281 2738746983 132
18 iso_pu_bacteria 2738543032 2739353084 132
19 iso_pu_bacteria 2738543032 2739356216 132
20 iso_pu_bacteria 2775506901 2776260241 132
21 iso_pu_bacteria 2775506901 2776264238 132
22 iso_pu_bacteria 2824671348 2824673395 132
23 iso_pu_bacteria 2824687955 2824689563 132
24 iso_pu_bacteria 2835312727 2835314140 132
25 iso_pu_bacteria 2841941048 2841942790 132
26 iso_pu_bacteria 2841957949 2841960482 132
27 iso_pu_bacteria 2841966195 2841968463 132
28 iso_pu_bacteria 2841974524 2841976337 132
29 iso_pu_bacteria 2842698319 2842700783 132
30 iso_pu_bacteria 2844533157 2844534226 132
31 iso_pu_bacteria 2847930680 2847933859 132
32 iso_pu_bacteria 2854911287 2854912853 132
33 iso_pu_bacteria 2879083081 2879087388 132
34 iso_pu_bacteria 2904690495 2904692304 132
35 iso_pu_bacteria 2906643746 2906643802 132
36 iso_pu_bacteria 2915650412 2915653982 132
37 iso_pu_bacteria 2929624759 2929625594 132
38 iso_pu_bacteria 2933577622 2933577867 132
39 iso_pu_bacteria 641522639 641640843 132
40 iso_pu_bacteria 643348564 643603308 132
41 iso_pu_bacteria 8055742211 8055748497 132
42 iso_pu_bacteria 8056967851 8056976295 132
43 3300009098 Ga0105245_10080038 Ga0105245_100800385 133
44 3300025908 Ga0207643_10092965 Ga0207643_100929652 133
45 iso_pu_bacteria 2829745981 2829749335 133
46 3300048929 Ga0496126_0012391 Ga0496126_0012391_7119_7526 135
47 3300001990 JGI24737J22298_10045428 JGI24737J22298_100454282 136
48 3300003323 rootH1_10060320 rootH1_100603203 136
49 3300003775 Ga0055524_1022296 Ga0055524_10222963 136
50 3300005331 Ga0070670_100179640 Ga0070670_1001796404 136
51 3300005335 Ga0070666_10878781 Ga0070666_108787812 136
52 3300005336 Ga0070680_100035397 Ga0070680_1000353973 136
53 3300005339 Ga0070660_100990806 Ga0070660_1009908062 136
54 3300005341 Ga0070691_10477581 Ga0070691_104775812 136
55 3300005341 Ga0070691_11040324 Ga0070691_110403241 136
56 3300005344 Ga0070661_100420600 Ga0070661_1004206002 136
57 3300005347 Ga0070668_100221822 Ga0070668_1002218222 136
58 3300005347 Ga0070668_100902361 Ga0070668_1009023611 136
59 3300005355 Ga0070671_100052240 Ga0070671_1000522403 136
60 3300005367 Ga0070667_100047945 Ga0070667_1000479452 136
61 3300005455 Ga0070663_100178740 Ga0070663_1001787403 136
62 3300005457 Ga0070662_100279466 Ga0070662_1002794661 136
63 3300005530 Ga0070679_100537597 Ga0070679_1005375972 136
64 3300005535 Ga0070684_100017131 Ga0070684_1000171317 136
65 3300005539 Ga0068853_100514939 Ga0068853_1005149392 136
66 3300005547 Ga0070693_100810860 Ga0070693_1008108601 136
67 3300005564 Ga0070664_100835212 Ga0070664_1008352121 136
68 3300005577 Ga0068857_100164053 Ga0068857_1001640534 136
69 3300005614 Ga0068856_100144192 Ga0068856_1001441922 136
70 3300005616 Ga0068852_100614781 Ga0068852_1006147812 136
71 3300005841 Ga0068863_100368870 Ga0068863_1003688703 136
72 3300005983 Ga0081540_1019384 Ga0081540_10193841 136
73 3300006038 Ga0075365_10361311 Ga0075365_103613112 136
74 3300006048 Ga0075363_100049026 Ga0075363_1000490262 136
75 3300006051 Ga0075364_10317927 Ga0075364_103179272 136
76 3300006177 Ga0075362_10624624 Ga0075362_106246241 136
77 3300006358 Ga0068871_100087758 Ga0068871_1000877583 136
78 3300006881 Ga0068865_100477761 Ga0068865_1004777611 136
79 3300009093 Ga0105240_10106778 Ga0105240_101067782 136
80 3300009093 Ga0105240_10944202 Ga0105240_109442022 136
81 3300009148 Ga0105243_10312805 Ga0105243_103128053 136
82 3300009174 Ga0105241_10198810 Ga0105241_101988102 136
83 3300009174 Ga0105241_10358864 Ga0105241_103588642 136
84 3300009176 Ga0105242_10187118 Ga0105242_101871182 136
85 3300009177 Ga0105248_10244610 Ga0105248_102446102 136
86 3300009177 Ga0105248_11741923 Ga0105248_117419231 136
87 3300009545 Ga0105237_10167816 Ga0105237_101678162 136
88 3300011119 Ga0105246_10040222 Ga0105246_100402223 136
89 3300013105 Ga0157369_10038996 Ga0157369_100389964 136
90 3300013306 Ga0163162_11953602 Ga0163162_119536021 136
91 3300013306 Ga0163162_12062814 Ga0163162_120628141 136
92 3300013307 Ga0157372_10422350 Ga0157372_104223502 136
93 3300013307 Ga0157372_10595899 Ga0157372_105958993 136
94 3300013308 Ga0157375_10613449 Ga0157375_106134492 136
95 3300014325 Ga0163163_10020055 Ga0163163_100200554 136
96 3300017792 Ga0163161_11824751 Ga0163161_118247511 136
97 3300021388 Ga0213875_10248503 Ga0213875_102485032 136
98 3300025272 Ga0209455_1001724 Ga0209455_10017249 136
99 3300025297 Ga0209758_1001334 Ga0209758_100133412 136
100 3300025299 Ga0209256_1000212 Ga0209256_100021279 136
101 3300025315 Ga0207697_10122152 Ga0207697_101221522 136
102 3300025901 Ga0207688_10006296 Ga0207688_100062964 136
103 3300025912 Ga0207707_10001362 Ga0207707_1000136219 136
104 3300025912 Ga0207707_10012630 Ga0207707_100126303 136
105 3300025914 Ga0207671_10158136 Ga0207671_101581363 136
106 3300025917 Ga0207660_10021958 Ga0207660_100219583 136
107 3300025917 Ga0207660_10092594 Ga0207660_100925942 136
108 3300025920 Ga0207649_10685786 Ga0207649_106857862 136
109 3300025921 Ga0207652_10054262 Ga0207652_100542622 136
110 3300025921 Ga0207652_10157299 Ga0207652_101572993 136
111 3300025923 Ga0207681_10252706 Ga0207681_102527063 136
112 3300025925 Ga0207650_10144450 Ga0207650_101444502 136
113 3300025927 Ga0207687_10488558 Ga0207687_104885581 136
114 3300025931 Ga0207644_10338080 Ga0207644_103380802 136
115 3300025933 Ga0207706_10070104 Ga0207706_100701044 136
116 3300025934 Ga0207686_10288138 Ga0207686_102881382 136
117 3300025944 Ga0207661_10179682 Ga0207661_101796822 136
118 3300025949 Ga0207667_10476134 Ga0207667_104761342 136
119 3300025972 Ga0207668_11197245 Ga0207668_111972451 136
120 3300026035 Ga0207703_10056119 Ga0207703_100561193 136
121 3300026041 Ga0207639_10433663 Ga0207639_104336631 136
122 3300026041 Ga0207639_10440445 Ga0207639_104404452 136
123 3300026067 Ga0207678_10213086 Ga0207678_102130862 136
124 3300026078 Ga0207702_11612143 Ga0207702_116121432 136
125 3300026088 Ga0207641_10017320 Ga0207641_100173205 136
126 3300026095 Ga0207676_10548782 Ga0207676_105487822 136
127 3300026116 Ga0207674_10120011 Ga0207674_101200112 136
128 3300027296 Ga0209389_1000348 Ga0209389_10003489 136
129 3300027361 Ga0209489_113850 Ga0209489_1138508 136
130 3300028379 Ga0268266_10195487 Ga0268266_101954872 136
131 3300031235 Ga0265330_10017974 Ga0265330_100179742 136
132 3300031235 Ga0265330_10105664 Ga0265330_101056642 136
133 3300031235 Ga0265330_10218889 Ga0265330_102188891 136
134 3300031239 Ga0265328_10051655 Ga0265328_100516553 136
135 3300031241 Ga0265325_10132576 Ga0265325_101325762 136
136 3300031241 Ga0265325_10329604 Ga0265325_103296042 136
137 3300031247 Ga0265340_10144153 Ga0265340_101441532 136
138 3300031249 Ga0265339_10017910 Ga0265339_100179106 136
139 3300031249 Ga0265339_10127943 Ga0265339_101279431 136
140 3300031249 Ga0265339_10311316 Ga0265339_103113162 136
141 3300031344 Ga0265316_10436406 Ga0265316_104364062 136
142 3300031344 Ga0265316_10763428 Ga0265316_107634282 136
143 3300031616 Ga0307508_10210449 Ga0307508_102104492 136
144 3300031711 Ga0265314_10022557 Ga0265314_100225576 136
145 3300031711 Ga0265314_10126517 Ga0265314_101265172 136
146 3300031712 Ga0265342_10006684 Ga0265342_100066841 136
147 3300031712 Ga0265342_10070681 Ga0265342_100706814 136
148 3300031712 Ga0265342_10127372 Ga0265342_101273722 136
149 3300031995 Ga0307409_100745138 Ga0307409_1007451382 136
150 3300032126 Ga0307415_101833045 Ga0307415_1018330451 136
151 3300035691 Ga0373931_0896816 Ga0373931_0896816_14_424 136
152 3300037312 Ga0395899_0000058 Ga0395899_0000058_15429_15854 136
153 3300037312 Ga0395899_0000144 Ga0395899_0000144_91104_91529 136
154 3300037418 Ga0395900_0000027 Ga0395900_0000027_13072_13497 136
155 3300037418 Ga0395900_0000056 Ga0395900_0000056_15457_15882 136
156 3300037418 Ga0395900_0440972 Ga0395900_0440972_119_559 136
157 3300037466 Ga0395898_0000043 Ga0395898_0000043_160846_161271 136
158 3300037466 Ga0395898_0000114 Ga0395898_0000114_15448_15873 136
159 3300037466 Ga0395898_0216855 Ga0395898_0216855_474_914 136
160 3300037471 Ga0395905_0000032 Ga0395905_0000032_272436_272861 136
161 3300037471 Ga0395905_0000053 Ga0395905_0000053_197196_197621 136
162 3300037853 Ga0436364_1556608 Ga0436364_1556608_804_1214 136
163 3300038443 Ga0395901_0000037 Ga0395901_0000037_15457_15882 136
164 3300038443 Ga0395901_0000056 Ga0395901_0000056_13072_13497 136
165 3300044683 Ga0466965_0138399 Ga0466965_0138399_636_1046 136
166 3300044683 Ga0466965_0387057 Ga0466965_0387057_317_757 136
167 3300044735 Ga0466968_0013958 Ga0466968_0013958_106_546 136
168 3300044901 Ga0466960_0017871 Ga0466960_0017871_1549_1959 136
169 3300044901 Ga0466960_0585162 Ga0466960_0585162_165_605 136
170 3300046501 Ga0495607_0416480 Ga0495607_0416480_51_476 136
171 3300046522 Ga0495643_0051094 Ga0495643_0051094_1242_1652 136
172 3300046524 Ga0495648_0235587 Ga0495648_0235587_88_498 136
173 3300046616 Ga0495668_0046435 Ga0495668_0046435_1666_2076 136
174 3300046674 Ga0495588_0615146 Ga0495588_0615146_111_536 136
175 3300047443 Ga0495687_011883 Ga0495687_011883_3479_3889 136
176 3300047443 Ga0495687_044838 Ga0495687_044838_1458_1883 136
177 3300047443 Ga0495687_118552 Ga0495687_118552_394_819 136
178 3300047470 Ga0495681_0051462 Ga0495681_0051462_46_471 136
179 3300048091 Ga0495626_0287336 Ga0495626_0287336_133_543 136
180 3300048903 Ga0496100_0133222 Ga0496100_0133222_593_1003 136
181 3300048903 Ga0496100_0439916 Ga0496100_0439916_521_958 136
182 3300048904 Ga0496101_0132478 Ga0496101_0132478_713_1123 136
183 3300048905 Ga0496102_0234387 Ga0496102_0234387_734_1144 136
184 3300048906 Ga0496103_0023649 Ga0496103_0023649_1536_1946 136
185 3300048907 Ga0496104_0202419 Ga0496104_0202419_934_1344 136
186 3300048912 Ga0496109_0042210 Ga0496109_0042210_2181_2591 136
187 3300048913 Ga0496110_0051504 Ga0496110_0051504_378_788 136
188 3300048918 Ga0496115_0269472 Ga0496115_0269472_489_899 136
189 3300048919 Ga0496116_0094129 Ga0496116_0094129_1205_1615 136
190 3300048921 Ga0496118_0117687 Ga0496118_0117687_689_1099 136
191 3300048924 Ga0496121_0602269 Ga0496121_0602269_195_620 136
192 3300048925 Ga0496122_0076012 Ga0496122_0076012_597_1007 136
193 3300048927 Ga0496124_0704837 Ga0496124_0704837_53_463 136
194 3300048928 Ga0496125_0154884 Ga0496125_0154884_398_808 136
195 3300049568 Ga0501031_0014018 Ga0501031_0014018_790_1215 136
196 3300049568 Ga0501031_0041973 Ga0501031_0041973_1619_2044 136
197 3300049568 Ga0501031_0058205 Ga0501031_0058205_974_1399 136
198 3300049568 Ga0501031_0058631 Ga0501031_0058631_545_970 136
199 3300049568 Ga0501031_0447694 Ga0501031_0447694_232_657 136
200 3300049569 Ga0501032_0000051 Ga0501032_0000051_70957_71382 136
201 3300049569 Ga0501032_0000298 Ga0501032_0000298_27296_27721 136
202 3300049569 Ga0501032_0001660 Ga0501032_0001660_15094_15519 136
203 3300049569 Ga0501032_0005043 Ga0501032_0005043_2189_2614 136
204 3300049569 Ga0501032_0139295 Ga0501032_0139295_730_1155 136
205 3300049570 Ga0501033_0000251 Ga0501033_0000251_28404_28829 136
206 3300049570 Ga0501033_0000322 Ga0501033_0000322_20104_20529 136
207 3300049570 Ga0501033_0014839 Ga0501033_0014839_403_828 136
208 3300049570 Ga0501033_0029586 Ga0501033_0029586_1682_2107 136
209 3300049570 Ga0501033_0134877 Ga0501033_0134877_590_1015 136
210 3300049570 Ga0501033_0204694 Ga0501033_0204694_123_548 136
211 3300049570 Ga0501033_0337448 Ga0501033_0337448_32_457 136
212 3300049570 Ga0501033_0523408 Ga0501033_0523408_217_642 136
213 3300049571 Ga0501034_0000094 Ga0501034_0000094_47907_48332 136
214 3300049571 Ga0501034_0001379 Ga0501034_0001379_3318_3743 136
215 3300049571 Ga0501034_0199986 Ga0501034_0199986_168_593 136
216 3300049571 Ga0501034_0255211 Ga0501034_0255211_464_889 136
217 3300049571 Ga0501034_0375103 Ga0501034_0375103_845_1270 136
218 3300049571 Ga0501034_0765450 Ga0501034_0765450_414_839 136
219 3300049571 Ga0501034_0937405 Ga0501034_0937405_295_720 136
220 3300049572 Ga0501036_0000083 Ga0501036_0000083_29988_30413 136
221 3300049572 Ga0501036_0000241 Ga0501036_0000241_5236_5661 136
222 3300049572 Ga0501036_0202109 Ga0501036_0202109_308_733 136
223 3300049572 Ga0501036_0256548 Ga0501036_0256548_517_942 136
224 3300049572 Ga0501036_0309181 Ga0501036_0309181_64_489 136
225 3300049572 Ga0501036_1458710 Ga0501036_1458710_95_520 136
226 3300049573 Ga0501037_0000028 Ga0501037_0000028_111261_111686 136
227 3300049573 Ga0501037_0000057 Ga0501037_0000057_64068_64493 136
228 3300049573 Ga0501037_0018211 Ga0501037_0018211_918_1343 136
229 3300049573 Ga0501037_0081194 Ga0501037_0081194_1634_2059 136
230 3300049573 Ga0501037_0096653 Ga0501037_0096653_1375_1800 136
231 3300049573 Ga0501037_0544306 Ga0501037_0544306_84_509 136
232 3300049574 Ga0501038_0001623 Ga0501038_0001623_395_820 136
233 3300049574 Ga0501038_0002261 Ga0501038_0002261_6476_6901 136
234 3300049574 Ga0501038_0013669 Ga0501038_0013669_6814_7239 136
235 3300049574 Ga0501038_0014620 Ga0501038_0014620_966_1391 136
236 3300049574 Ga0501038_0472924 Ga0501038_0472924_232_657 136
237 3300049574 Ga0501038_0555852 Ga0501038_0555852_217_642 136
238 3300049575 Ga0501039_0000226 Ga0501039_0000226_10881_11306 136
239 3300049575 Ga0501039_0026203 Ga0501039_0026203_544_969 136
240 3300049575 Ga0501039_0138112 Ga0501039_0138112_1243_1668 136
241 3300049575 Ga0501039_0304325 Ga0501039_0304325_261_686 136
242 3300049575 Ga0501039_1136676 Ga0501039_1136676_127_552 136
243 3300049575 Ga0501039_1186719 Ga0501039_1186719_105_530 136
244 3300049576 Ga0501040_0553299 Ga0501040_0553299_385_810 136
245 3300049579 Ga0501043_0000028 Ga0501043_0000028_113771_114196 136
246 3300049579 Ga0501043_0000040 Ga0501043_0000040_58376_58801 136
247 3300049579 Ga0501043_0000466 Ga0501043_0000466_20104_20529 136
248 3300049579 Ga0501043_0689699 Ga0501043_0689699_160_585 136
249 3300049580 Ga0501046_0035352 Ga0501046_0035352_269_694 136
250 3300049580 Ga0501046_0466182 Ga0501046_0466182_58_483 136
251 3300049580 Ga0501046_0489015 Ga0501046_0489015_343_768 136
252 3300049580 Ga0501046_0932911 Ga0501046_0932911_36_461 136
253 3300049581 Ga0501047_0001360 Ga0501047_0001360_23386_23811 136
254 3300049581 Ga0501047_0026409 Ga0501047_0026409_1718_2143 136
255 3300049581 Ga0501047_0659290 Ga0501047_0659290_133_558 136
256 3300049581 Ga0501047_0679809 Ga0501047_0679809_325_750 136
257 3300049583 Ga0501067_0190847 Ga0501067_0190847_397_822 136
258 3300049584 Ga0501068_0052348 Ga0501068_0052348_1745_2170 136
259 3300049585 Ga0501069_0000014 Ga0501069_0000014_31751_32176 136
260 3300049586 Ga0501070_0000658 Ga0501070_0000658_28443_28868 136
261 3300049586 Ga0501070_0241219 Ga0501070_0241219_763_1188 136
262 3300049586 Ga0501070_0296394 Ga0501070_0296394_584_1009 136
263 3300049586 Ga0501070_0416074 Ga0501070_0416074_241_666 136
264 3300049586 Ga0501070_0825155 Ga0501070_0825155_251_676 136
265 3300049587 Ga0501071_0036056 Ga0501071_0036056_309_734 136
266 3300049590 Ga0501074_0000004 Ga0501074_0000004_23717_24142 136
267 3300049590 Ga0501074_0748540 Ga0501074_0748540_201_626 136
268 3300049742 Ga0501080_0000728 Ga0501080_0000728_2942_3367 136
269 3300049742 Ga0501080_0120728 Ga0501080_0120728_1264_1689 136
270 3300049744 Ga0501083_0000025 Ga0501083_0000025_29004_29429 136
271 3300049822 Ga0501035_0000154 Ga0501035_0000154_29981_30406 136
272 3300049822 Ga0501035_0000277 Ga0501035_0000277_20104_20529 136
273 3300049822 Ga0501035_0000891 Ga0501035_0000891_28443_28868 136
274 3300049822 Ga0501035_0145119 Ga0501035_0145119_595_1020 136
275 3300049822 Ga0501035_0167897 Ga0501035_0167897_1134_1559 136
276 3300049822 Ga0501035_0177023 Ga0501035_0177023_412_837 136
277 3300049822 Ga0501035_0419860 Ga0501035_0419860_261_686 136
278 3300049823 Ga0501044_0000052 Ga0501044_0000052_109167_109592 136
279 3300049823 Ga0501044_0001296 Ga0501044_0001296_17447_17872 136
280 3300049823 Ga0501044_0006091 Ga0501044_0006091_4038_4463 136
281 3300049823 Ga0501044_0063295 Ga0501044_0063295_361_786 136
282 3300049823 Ga0501044_0079764 Ga0501044_0079764_1067_1492 136
283 3300049823 Ga0501044_0095480 Ga0501044_0095480_1779_2204 136
284 3300049823 Ga0501044_0693604 Ga0501044_0693604_334_759 136
285 3300049824 Ga0501045_0240460 Ga0501045_0240460_315_740 136
286 3300050489 nmdc:mga03683_71148_c1 nmdc:mga03683_71148_c1_151_561 136
287 3300050490 nmdc:mga03n38_257621_c1 nmdc:mga03n38_257621_c1_491_901 136
288 3300050491 nmdc:mga00v17_225688_c1 nmdc:mga00v17_225688_c1_287_697 136
289 3300050492 nmdc:mga0yw44_290720_c1 nmdc:mga0yw44_290720_c1_254_664 136
290 3300050496 nmdc:mga07m45_16539_c1 nmdc:mga07m45_16539_c1_1460_1870 136
291 3300050516 nmdc:mga0sz30_354726_c1 nmdc:mga0sz30_354726_c1_181_591 136
292 3300053078 Ga0495612_0250555 Ga0495612_0250555_124_549 136
293 3300053083 Ga0495655_0017966 Ga0495655_0017966_758_1168 136
294 3300053153 Ga0500616_0002106 Ga0500616_0002106_16554_16979 136
295 3300053731 Ga0500609_006001 Ga0500609_006001_807_1217 136
296 3300060353 Ga0501082_0092273 Ga0501082_0092273_1225_1650 136
297 iso_pu_bacteria 2524023205 2524438285 136
298 iso_pu_bacteria 2595698237 2596375508 136
299 iso_pu_bacteria 2821443989 2821450468 136
300 iso_pu_bacteria 2829745981 2829748480 136
301 iso_pu_bacteria 2842698319 2842698766 136
302 iso_pu_bacteria 2861691609 2861696504 136
303 iso_pu_bacteria 2882456835 2882459549 136
304 iso_pu_bacteria 2889306138 2889309984 136
305 iso_pu_bacteria 2902405164 2902410205 136
306 iso_pu_bacteria 2928125067 2928128293 136
307 iso_pu_bacteria 2935959822 2935963792 136
308 iso_pu_bacteria 3003665799 3003669010 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

6

114

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f0i-assembly2.cif.gz_B arsenate reductase from vibrio cholerae. 0.8462 1 113
3rdw-assembly2.cif.gz_B putative arsenate reductase from yersinia pestis 0.8418 2 111
1sd8-assembly1.cif.gz_A arsenate reductase r60k mutant from e. coli 0.8117 3 128
1s3d-assembly1.cif.gz_A arsenate reductase r60a mutant from e. coli 0.8108 3 128
1i9d-assembly1.cif.gz_A arsenate reductase from e. coli 0.8107 3 128
ID Description Score Start End Superfamily
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8463 2 111 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8135 2 111 3.40.30.10
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8066 3 128 3.40.30.10
af_Q2G1U6_1_131_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.774 3 114 3.40.30.10
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7603 3 128 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A519JM66-F1-model_v4 deleted 0.9052 38 116
AF-A0A659UVR1-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.885 1 113 GO:0008794
GO:0046685
AF-A0A376RC32-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.8768 2 101 GO:0008794
GO:0046685
AF-A0A3A5KAD8-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.8737 2 116 GO:0008794
GO:0046685
AF-A0A377ACS1-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.8736 2 116 GO:0008794
GO:0046685

Feature Viewer

pLDDT pTM Quality
79.83 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map