F399580

General Info

Members Datasets Scaffolds Average Seq Length
308 167 308 282

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100001433|Ga0070706_10000143327
Length 322
Sequence MLISRRMTSSRKWVPTGVYMTRRFDHRAMPLSICLLAMLAAPAFGDTIYNNLTPNNLMAIATRPDSPGVFEIEAGDDFLLGSQTIINKASFVGLIVPGVTGGTPSISEVVAEMYRVFPKDSNTNRTSGPPTFSTPEVPTRVNSPSDVAFVSRDSAASELTFSTSVLAATFTALNSVKPGGIHMSPLQTTGGNGPLTGQEIQLNLTFTTPFNLPADHYFFVPQVALTNGGQFYWLSASRPISGASTTPFPAGVTDLQAWTRDANLDPDWLRVGMDIVGGTTPPTFNTAFSLDGTAVPEPSTLLLLGSGLAGVWAWRRKRESAN

Samples

Sample ID Description Type Environment
1 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
109 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 2.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.62
Rhizosphere 98.05
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11786207 3300004798 Bacteria 1332
2 Ga0058863_11918874 3300004799 Bacteria 914
3 Ga0058861_10691150 3300004800 Bacteria 901
4 Ga0058862_12082813 3300004803 Bacteria 1111
5 Ga0070658_10427563 3300005327 Unclassified 1139
6 Ga0070683_100027689 3300005329 Bacteria 5114
7 Ga0070683_100070667 3300005329 Bacteria 3256
8 Ga0070683_100289365 3300005329 Bacteria 1558
9 Ga0070683_100394635 3300005329 Unclassified 1319
10 Ga0068868_100026640 3300005338 Bacteria 4408
11 Ga0070660_100027432 3300005339 Bacteria 4250
12 Ga0070692_10009978 3300005345 Bacteria 4305
13 Ga0070675_100341440 3300005354 Unclassified 1326
14 Ga0070671_100309194 3300005355 Bacteria 1346
15 Ga0070673_100137445 3300005364 Bacteria 2058
16 Ga0070673_100410101 3300005364 Bacteria 1213
17 Ga0070667_100455175 3300005367 Bacteria 1170
18 Ga0070714_100000257 3300005435 Bacteria 41363
19 Ga0070714_100003579 3300005435 Bacteria 11622
20 Ga0070714_100553726 3300005435 Unclassified 1101
21 Ga0070713_100003140 3300005436 Bacteria 10875
22 Ga0070713_100018598 3300005436 Bacteria 5282
23 Ga0070713_100121962 3300005436 Bacteria 2287
24 Ga0070713_100182654 3300005436 Bacteria 1886
25 Ga0070713_100249090 3300005436 Bacteria 1620
26 Ga0070711_100024360 3300005439 Unclassified 3947
27 Ga0070711_100281153 3300005439 Unclassified 1316
28 Ga0070705_100014432 3300005440 Bacteria 4063
29 Ga0070694_100160160 3300005444 Bacteria 1651
30 Ga0070708_100102316 3300005445 Unclassified 2624
31 Ga0070708_100215966 3300005445 Bacteria 1797
32 Ga0070681_10047436 3300005458 Bacteria 4294
33 Ga0070681_10474691 3300005458 Bacteria 1163
34 Ga0070706_100001433 3300005467 Bacteria 25205
35 Ga0070706_100023384 3300005467 Bacteria 5691
36 Ga0070706_100030104 3300005467 Bacteria 5000
37 Ga0070706_100052273 3300005467 Unclassified 3771
38 Ga0070706_100095732 3300005467 Bacteria 2756
39 Ga0070706_100345899 3300005467 Bacteria 1386
40 Ga0070706_100382105 3300005467 Bacteria 1311
41 Ga0070706_100528061 3300005467 Bacteria 1098
42 Ga0070706_100557029 3300005467 Bacteria 1066
43 Ga0070707_100015361 3300005468 Bacteria 7184
44 Ga0070707_100107583 3300005468 Unclassified 2705
45 Ga0070707_100119602 3300005468 Bacteria 2557
46 Ga0070707_100358894 3300005468 Bacteria 1416
47 Ga0070698_100068419 3300005471 Bacteria 3568
48 Ga0070698_100738577 3300005471 Unclassified 927
49 Ga0070699_100107894 3300005518 Unclassified 2443
50 Ga0070699_100207920 3300005518 Bacteria 1741
51 Ga0070699_100348804 3300005518 Unclassified 1333
52 Ga0070699_100555738 3300005518 Bacteria 1045
53 Ga0070684_100075591 3300005535 Bacteria 2971
54 Ga0070684_100091217 3300005535 Bacteria 2710
55 Ga0070684_100142270 3300005535 Bacteria 2169
56 Ga0070697_100001261 3300005536 Bacteria 19124
57 Ga0070697_100181024 3300005536 Unclassified 1786
58 Ga0070697_100190482 3300005536 Unclassified 1741
59 Ga0070697_100252152 3300005536 Bacteria 1509
60 Ga0068853_100343478 3300005539 Bacteria 1387
61 Ga0070672_100201247 3300005543 Unclassified 1665
62 Ga0070672_100303853 3300005543 Bacteria 1353
63 Ga0070696_100041318 3300005546 Bacteria 3186
64 Ga0070693_100031866 3300005547 Bacteria 2894
65 Ga0070704_100154487 3300005549 Unclassified 1808
66 Ga0068855_100317677 3300005563 Bacteria 1722
67 Ga0068857_100012408 3300005577 Bacteria 7418
68 Ga0068854_100031407 3300005578 Bacteria 3690
69 Ga0068854_100049872 3300005578 Bacteria 2993
70 Ga0068856_100055874 3300005614 Bacteria 3895
71 Ga0068856_100218840 3300005614 Bacteria 1919
72 Ga0068856_100459915 3300005614 Bacteria 1293
73 Ga0068852_100549318 3300005616 Bacteria 1155
74 Ga0068864_100285542 3300005618 Bacteria 1541
75 Ga0068861_100255678 3300005719 Bacteria 1497
76 Ga0068851_10145164 3300005834 Bacteria 1293
77 Ga0068863_100156921 3300005841 Unclassified 2179
78 Ga0068863_100337557 3300005841 Unclassified 1465
79 Ga0068858_100005915 3300005842 Bacteria 11939
80 Ga0068860_100444671 3300005843 Bacteria 1288
81 Ga0070717_10028961 3300006028 Unclassified 4438
82 Ga0070717_10150499 3300006028 Bacteria 2013
83 Ga0070717_10291577 3300006028 Bacteria 1449
84 Ga0070717_10373492 3300006028 Unclassified 1278
85 Ga0070715_10219092 3300006163 Unclassified 977
86 Ga0070712_100061184 3300006175 Bacteria 2659
87 Ga0070712_100109991 3300006175 Bacteria 2054
88 Ga0070712_100140025 3300006175 Unclassified 1845
89 Ga0097621_100024399 3300006237 Bacteria 4722
90 Ga0097621_100114536 3300006237 Bacteria 2281
91 Ga0097621_100172421 3300006237 Bacteria 1865
92 Ga0068871_100013032 3300006358 Bacteria 6161
93 Ga0068871_100089546 3300006358 Unclassified 2561
94 Ga0068871_100178922 3300006358 Bacteria 1822
95 Ga0068871_100387065 3300006358 Unclassified 1243
96 Ga0075428_100019022 3300006844 Bacteria 7596
97 Ga0075431_100510632 3300006847 Unclassified 1192
98 Ga0075433_10130985 3300006852 Bacteria 2228
99 Ga0075433_10504803 3300006852 Unclassified 1064
100 Ga0075434_100581693 3300006871 Unclassified 1139
101 Ga0075429_100034828 3300006880 Bacteria 4376
102 Ga0068865_100018087 3300006881 Unclassified 4543
103 Ga0075436_100027764 3300006914 Bacteria 3896
104 Ga0075436_100147488 3300006914 Bacteria 1654
105 Ga0075435_100048600 3300007076 Unclassified 3409
106 Ga0075435_100209451 3300007076 Bacteria 1653
107 Ga0105240_10000167 3300009093 Bacteria 133279
108 Ga0105240_10049574 3300009093 Bacteria 5299
109 Ga0105240_10111731 3300009093 Unclassified 3304
110 Ga0105240_10212173 3300009093 Bacteria 2261
111 Ga0111539_10442672 3300009094 Unclassified 1513
112 Ga0111539_10942083 3300009094 Bacteria 1004
113 Ga0105245_10037810 3300009098 Unclassified 4292
114 Ga0105245_10041303 3300009098 Bacteria 4111
115 Ga0105245_10366376 3300009098 Bacteria 1431
116 Ga0105247_10045579 3300009101 Bacteria 2691
117 Ga0114129_10064062 3300009147 Bacteria 5130
118 Ga0114129_10389704 3300009147 Bacteria 1838
119 Ga0105241_10013848 3300009174 Bacteria 5907
120 Ga0105241_10049787 3300009174 Bacteria 3192
121 Ga0105248_10023983 3300009177 Bacteria 6782
122 Ga0105248_10049136 3300009177 Bacteria 4731
123 Ga0105248_10689255 3300009177 Bacteria 1153
124 Ga0105248_10820653 3300009177 Unclassified 1050
125 Ga0105248_10859514 3300009177 Bacteria 1024
126 Ga0105237_10004092 3300009545 Bacteria 17008
127 Ga0105237_10054147 3300009545 Bacteria 4020
128 Ga0105237_10172896 3300009545 Bacteria 2160
129 Ga0105238_10001942 3300009551 Bacteria 20789
130 Ga0105238_10018770 3300009551 Bacteria 7042
131 Ga0105238_10104968 3300009551 Unclassified 2807
132 Ga0105249_10074912 3300009553 Bacteria 3134
133 Ga0157370_10610799 3300013104 Unclassified 998
134 Ga0157374_10021251 3300013296 Bacteria 5771
135 Ga0157374_10132766 3300013296 Bacteria 2411
136 Ga0157378_10008985 3300013297 Bacteria 8699
137 Ga0163162_10008190 3300013306 Bacteria 10198
138 Ga0163162_10065605 3300013306 Bacteria 3678
139 Ga0157372_10009333 3300013307 Bacteria 10439
140 Ga0157372_10017493 3300013307 Bacteria 7692
141 Ga0157375_10003364 3300013308 Bacteria 13862
142 Ga0157375_10599521 3300013308 Unclassified 1261
143 Ga0157375_10842893 3300013308 Unclassified 1064
144 Ga0163163_10028280 3300014325 Bacteria 5381
145 Ga0163163_10053514 3300014325 Bacteria 3985
146 Ga0163163_10106215 3300014325 Plasmid 2834
147 Ga0163163_10135229 3300014325 Unclassified 2506
148 Ga0163163_10164500 3300014325 Bacteria 2264
149 Ga0206352_10119627 3300020078 Bacteria 1167
150 Ga0207684_10000354 3300025910 Bacteria 62819
151 Ga0207684_10015732 3300025910 Bacteria 6509
152 Ga0207684_10025700 3300025910 Bacteria 5017
153 Ga0207684_10030365 3300025910 Bacteria 4600
154 Ga0207684_10034651 3300025910 Unclassified 4289
155 Ga0207684_10046869 3300025910 Bacteria 3666
156 Ga0207684_10491528 3300025910 Unclassified 1052
157 Ga0207707_10124467 3300025912 Bacteria 2254
158 Ga0207695_10002047 3300025913 Bacteria 30915
159 Ga0207695_10062531 3300025913 Bacteria 3842
160 Ga0207695_10090234 3300025913 Unclassified 3080
161 Ga0207671_10005439 3300025914 Bacteria 11725
162 Ga0207671_10036712 3300025914 Bacteria 3635
163 Ga0207693_10031221 3300025915 Plasmid 4208
164 Ga0207693_10068619 3300025915 Bacteria 2775
165 Ga0207663_10109166 3300025916 Bacteria 1875
166 Ga0207663_10267659 3300025916 Unclassified 1265
167 Ga0207652_10287320 3300025921 Bacteria 1484
168 Ga0207646_10066095 3300025922 Bacteria 3228
169 Ga0207646_10151552 3300025922 Unclassified 2091
170 Ga0207646_10172144 3300025922 Unclassified 1955
171 Ga0207646_10320827 3300025922 Bacteria 1400
172 Ga0207694_10001557 3300025924 Bacteria 19467
173 Ga0207694_10010202 3300025924 Bacteria 7081
174 Ga0207694_10097898 3300025924 Bacteria 2322
175 Ga0207650_10177051 3300025925 Bacteria 1698
176 Ga0207687_10000237 3300025927 Bacteria 37671
177 Ga0207687_10072108 3300025927 Bacteria 2469
178 Ga0207687_10192533 3300025927 Bacteria 1588
179 Ga0207700_10020108 3300025928 Unclassified 4526
180 Ga0207700_10025821 3300025928 Unclassified 4087
181 Ga0207700_10349617 3300025928 Bacteria 1287
182 Ga0207664_10009150 3300025929 Bacteria 6942
183 Ga0207664_10010524 3300025929 Bacteria 6533
184 Ga0207664_10474965 3300025929 Unclassified 1118
185 Ga0207664_10578174 3300025929 Unclassified 1009
186 Ga0207686_10134703 3300025934 Bacteria 1699
187 Ga0207665_10160780 3300025939 Bacteria 1615
188 Ga0207691_10437477 3300025940 Bacteria 1114
189 Ga0207711_10002756 3300025941 Bacteria 15477
190 Ga0207661_10033590 3300025944 Bacteria 3983
191 Ga0207661_10398252 3300025944 Bacteria 1248
192 Ga0207667_10434614 3300025949 Unclassified 1335
193 Ga0207712_10102944 3300025961 Unclassified 2127
194 Ga0207640_10106532 3300025981 Bacteria 1978
195 Ga0207658_10209097 3300025986 Bacteria 1634
196 Ga0207703_10070084 3300026035 Bacteria 2893
197 Ga0207703_10102535 3300026035 Unclassified 2428
198 Ga0207702_10269792 3300026078 Bacteria 1604
199 Ga0207702_10470813 3300026078 Bacteria 1221
200 Ga0207641_10134834 3300026088 Unclassified 2221
201 Ga0207676_10408103 3300026095 Unclassified 1271
202 Ga0207674_10000852 3300026116 Bacteria 39796
203 Ga0207674_10165627 3300026116 Bacteria 2165
204 Ga0207683_10303267 3300026121 Bacteria 1461
205 Ga0207698_10493591 3300026142 Bacteria 1190
206 Ga0268264_10140939 3300028381 Bacteria 2150
207 Ga0373934_0001634 3300035086 Bacteria 8223
208 Ga0373934_0147594 3300035086 Bacteria 962
209 Ga0373923_0067055 3300035111 Bacteria 1534
210 Ga0373953_0011840 3300035117 Bacteria 3074
211 Ga0373953_0062913 3300035117 Bacteria 1520
212 Ga0373954_0005364 3300035118 Bacteria 5539
213 Ga0373954_0036574 3300035118 Bacteria 2279
214 Ga0373956_0089647 3300035119 Bacteria 1418
215 Ga0373957_0062933 3300035120 Bacteria 1440
216 Ga0373943_0254239 3300035170 Unclassified 988
217 Ga0373955_0007095 3300035172 Bacteria 5134
218 Ga0373924_0071634 3300035410 Bacteria 1463
219 Ga0373935_0110433 3300035692 Bacteria 1825
220 Ga0373927_0001819 3300035695 Bacteria 15845
221 Ga0373927_0011082 3300035695 Bacteria 6005
222 Ga0373927_0022438 3300035695 Bacteria 4135
223 Ga0373933_0161884 3300035724 Bacteria 1421
224 Ga0373933_0268218 3300035724 Bacteria 1101
225 Ga0373947_0001079 3300035725 Bacteria 16722
226 Ga0373947_0021579 3300035725 Unclassified 3728
227 Ga0373947_0227345 3300035725 Bacteria 1228
228 Ga0373937_0003789 3300036401 Bacteria 12785
229 Ga0373937_0048310 3300036401 Unclassified 3895
230 Ga0373937_0069046 3300036401 Unclassified 3258
231 Ga0373937_0453384 3300036401 Bacteria 1218
232 Ga0373925_0003461 3300037068 Bacteria 12203
233 Ga0373925_0115891 3300037068 Bacteria 2075
234 Ga0395905_0160782 3300037471 Bacteria 2111
235 Ga0436360_0996247 3300039438 Unclassified 1930
236 Ga0451576_0012268 3300045051 Bacteria 9645
237 Ga0466967_0693629 3300045976 Bacteria 1008
238 Ga0495592_0025190 3300046454 Bacteria 4517
239 Ga0495651_0030040 3300046462 Bacteria 4237
240 Ga0495651_0156022 3300046462 Bacteria 1640
241 Ga0495651_0176702 3300046462 Bacteria 1515
242 Ga0495653_0062447 3300046463 Unclassified 2815
243 Ga0495653_0122497 3300046463 Bacteria 1851
244 Ga0495662_0089030 3300046476 Unclassified 1504
245 Ga0495664_0000575 3300046477 Bacteria 18480
246 Ga0495664_0004981 3300046477 Bacteria 7273
247 Ga0495664_0069376 3300046477 Bacteria 2104
248 Ga0495608_0098189 3300046511 Bacteria 1890
249 Ga0495608_0300039 3300046511 Unclassified 995
250 Ga0495618_0266799 3300046514 Unclassified 1071
251 Ga0495628_0056014 3300046516 Bacteria 3104
252 Ga0495630_0117523 3300046517 Unclassified 2016
253 Ga0495652_0026392 3300046529 Bacteria 5133
254 Ga0495665_0033221 3300046531 Bacteria 2760
255 Ga0495665_0219405 3300046531 Bacteria 983
256 Ga0495640_0056281 3300046533 Bacteria 2687
257 Ga0495586_0037937 3300046535 Bacteria 2587
258 Ga0495587_0010068 3300046536 Bacteria 6035
259 Ga0495645_0006325 3300046543 Bacteria 8214
260 Ga0495645_0015942 3300046543 Bacteria 5354
261 Ga0495645_0030095 3300046543 Unclassified 3954
262 Ga0495667_0010878 3300046559 Bacteria 6152
263 Ga0495667_0274631 3300046559 Unclassified 1070
264 Ga0495634_0037331 3300046642 Bacteria 3320
265 Ga0495634_0214532 3300046642 Unclassified 1190
266 Ga0495635_0166771 3300046663 Unclassified 1498
267 Ga0495635_0203464 3300046663 Bacteria 1342
268 Ga0495657_0147602 3300046675 Unclassified 1462
269 Ga0495599_0019308 3300046678 Bacteria 4248
270 Ga0495623_0114880 3300046679 Unclassified 1627
271 Ga0495613_0048143 3300046689 Bacteria 3148
272 Ga0495613_0106499 3300046689 Bacteria 2023
273 Ga0495613_0122111 3300046689 Bacteria 1870
274 Ga0495613_0259670 3300046689 Unclassified 1211
275 Ga0495624_0037200 3300046690 Unclassified 3134
276 Ga0495604_0409617 3300047317 Unclassified 891
277 Ga0495674_0003092 3300047319 Bacteria 16177
278 Ga0495674_0012530 3300047319 Bacteria 7987
279 Ga0495674_0024093 3300047319 Bacteria 5600
280 Ga0495674_0138177 3300047319 Bacteria 2049
281 Ga0495680_0121383 3300047322 Bacteria 1929
282 Ga0495680_0430067 3300047322 Unclassified 907
283 Ga0495675_0028800 3300047444 Unclassified 3540
284 Ga0495675_0113247 3300047444 Unclassified 1692
285 Ga0495684_0076882 3300047471 Unclassified 2535
286 Ga0495684_0141368 3300047471 Unclassified 1804
287 Ga0496104_0128795 3300048907 Bacteria 2431
288 Ga0496104_0402959 3300048907 Unclassified 1280
289 Ga0496106_0114418 3300048909 Unclassified 2104
290 Ga0496110_0072935 3300048913 Bacteria 3047
291 Ga0496114_0498770 3300048917 Unclassified 1077
292 Ga0501072_0314803 3300049588 Bacteria 1244
293 nmdc:mga05p37_236241_c1 3300050507 Bacteria 2200
294 nmdc:mga05p37_273600_c1 3300050507 Bacteria 2017
295 nmdc:mga05p37_50937_c1 3300050507 Bacteria 5092
296 nmdc:mga09592_3477_c1 3300050508 Bacteria 12715
297 nmdc:mga06r32_24008_c1 3300050510 Bacteria 5652
298 nmdc:mga08y16_265135_c1 3300050511 Bacteria 1773
299 nmdc:mga0n895_119142_c1 3300050512 Bacteria 2661
300 nmdc:mga0rr50_52726_c1 3300050513 Bacteria 3024
301 nmdc:mga08x19_76860_c1 3300050514 Bacteria 2186
302 nmdc:mga08x19_946_c1 3300050514 Bacteria 18277
303 nmdc:mga0a205_1360_c1 3300050515 Bacteria 20622
304 nmdc:mga0a205_289228_c1 3300050515 Bacteria 1513
305 Ga0495601_0203820 3300053077 Bacteria 1292
306 Ga0587077_013275 3300059493 Unclassified 1333
307 Ga0587082_023152 3300059504 Archaea 1028
308 Ga0587085_018954 3300059506 Bacteria 1026

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046663 Ga0495635_0203464 Ga0495635_0203464_55_753 215
2 3300046689 Ga0495613_0048143 Ga0495613_0048143_2437_3135 215
3 3300009177 Ga0105248_10023983 Ga0105248_100239835 218
4 3300005471 Ga0070698_100738577 Ga0070698_1007385771 224
5 3300035170 Ga0373943_0254239 Ga0373943_0254239_90_836 233
6 3300035695 Ga0373927_0022438 Ga0373927_0022438_2239_2985 233
7 3300045051 Ga0451576_0012268 Ga0451576_0012268_682_1398 233
8 3300046517 Ga0495630_0117523 Ga0495630_0117523_247_1008 234
9 3300046559 Ga0495667_0274631 Ga0495667_0274631_291_1052 234
10 3300046642 Ga0495634_0214532 Ga0495634_0214532_60_821 234
11 3300046689 Ga0495613_0106499 Ga0495613_0106499_101_862 234
12 3300047471 Ga0495684_0141368 Ga0495684_0141368_519_1280 234
13 3300009093 Ga0105240_10049574 Ga0105240_100495745 235
14 3300009545 Ga0105237_10054147 Ga0105237_100541472 235
15 3300013296 Ga0157374_10132766 Ga0157374_101327661 235
16 3300009147 Ga0114129_10389704 Ga0114129_103897042 236
17 3300050507 nmdc:mga05p37_273600_c1 nmdc:mga05p37_273600_c1_653_1378 236
18 3300050515 nmdc:mga0a205_289228_c1 nmdc:mga0a205_289228_c1_134_862 237
19 3300009174 Ga0105241_10013848 Ga0105241_100138487 243
20 3300013306 Ga0163162_10008190 Ga0163162_100081902 243
21 3300046689 Ga0495613_0259670 Ga0495613_0259670_53_835 243
22 3300039438 Ga0436360_0996247 Ga0436360_0996247_432_1211 244
23 3300050511 nmdc:mga08y16_265135_c1 nmdc:mga08y16_265135_c1_345_1103 244
24 3300035725 Ga0373947_0227345 Ga0373947_0227345_291_1073 245
25 3300005440 Ga0070705_100014432 Ga0070705_1000144324 246
26 3300005543 Ga0070672_100303853 Ga0070672_1003038532 246
27 3300005546 Ga0070696_100041318 Ga0070696_1000413184 246
28 3300005719 Ga0068861_100255678 Ga0068861_1002556781 246
29 3300006852 Ga0075433_10130985 Ga0075433_101309854 246
30 3300007076 Ga0075435_100048600 Ga0075435_1000486005 246
31 3300009093 Ga0105240_10000167 Ga0105240_1000016752 246
32 3300009545 Ga0105237_10004092 Ga0105237_100040925 246
33 3300013297 Ga0157378_10008985 Ga0157378_100089856 246
34 3300014325 Ga0163163_10164500 Ga0163163_101645004 246
35 3300025940 Ga0207691_10437477 Ga0207691_104374771 246
36 3300005445 Ga0070708_100215966 Ga0070708_1002159663 248
37 3300005467 Ga0070706_100528061 Ga0070706_1005280612 248
38 3300005518 Ga0070699_100348804 Ga0070699_1003488041 248
39 3300005536 Ga0070697_100181024 Ga0070697_1001810241 248
40 3300005843 Ga0068860_100444671 Ga0068860_1004446711 248
41 3300009094 Ga0111539_10442672 Ga0111539_104426722 248
42 3300025910 Ga0207684_10030365 Ga0207684_100303652 248
43 3300028381 Ga0268264_10140939 Ga0268264_101409392 248
44 3300005614 Ga0068856_100459915 Ga0068856_1004599152 253
45 3300009174 Ga0105241_10049787 Ga0105241_100497871 253
46 3300047319 Ga0495674_0138177 Ga0495674_0138177_1147_1965 253
47 3300046462 Ga0495651_0156022 Ga0495651_0156022_41_892 254
48 3300046463 Ga0495653_0062447 Ga0495653_0062447_794_1645 254
49 3300046476 Ga0495662_0089030 Ga0495662_0089030_250_1101 254
50 3300046477 Ga0495664_0069376 Ga0495664_0069376_1004_1855 254
51 3300046514 Ga0495618_0266799 Ga0495618_0266799_160_1011 254
52 3300046543 Ga0495645_0015942 Ga0495645_0015942_291_1142 254
53 3300046663 Ga0495635_0166771 Ga0495635_0166771_433_1284 254
54 3300047322 Ga0495680_0430067 Ga0495680_0430067_12_863 254
55 3300036401 Ga0373937_0453384 Ga0373937_0453384_292_1110 255
56 3300046454 Ga0495592_0025190 Ga0495592_0025190_2305_3123 255
57 3300046462 Ga0495651_0030040 Ga0495651_0030040_2335_3153 255
58 3300046463 Ga0495653_0122497 Ga0495653_0122497_557_1375 255
59 3300046477 Ga0495664_0000575 Ga0495664_0000575_7835_8653 255
60 3300046511 Ga0495608_0098189 Ga0495608_0098189_1035_1853 255
61 3300046516 Ga0495628_0056014 Ga0495628_0056014_1212_2030 255
62 3300046529 Ga0495652_0026392 Ga0495652_0026392_916_1734 255
63 3300046531 Ga0495665_0033221 Ga0495665_0033221_1878_2696 255
64 3300046533 Ga0495640_0056281 Ga0495640_0056281_1339_2157 255
65 3300046536 Ga0495587_0010068 Ga0495587_0010068_2610_3428 255
66 3300046642 Ga0495634_0037331 Ga0495634_0037331_1806_2624 255
67 3300046675 Ga0495657_0147602 Ga0495657_0147602_236_1054 255
68 3300046678 Ga0495599_0019308 Ga0495599_0019308_2501_3319 255
69 3300046679 Ga0495623_0114880 Ga0495623_0114880_263_1081 255
70 3300047322 Ga0495680_0121383 Ga0495680_0121383_682_1500 255
71 3300005467 Ga0070706_100052273 Ga0070706_1000522732 256
72 3300005518 Ga0070699_100555738 Ga0070699_1005557381 256
73 3300006844 Ga0075428_100019022 Ga0075428_1000190222 256
74 3300006880 Ga0075429_100034828 Ga0075429_1000348282 256
75 3300009094 Ga0111539_10942083 Ga0111539_109420831 256
76 3300009147 Ga0114129_10064062 Ga0114129_100640623 256
77 3300025910 Ga0207684_10034651 Ga0207684_100346512 256
78 3300046511 Ga0495608_0300039 Ga0495608_0300039_131_958 256
79 3300047317 Ga0495604_0409617 Ga0495604_0409617_46_858 256
80 3300050507 nmdc:mga05p37_50937_c1 nmdc:mga05p37_50937_c1_927_1721 256
81 3300050508 nmdc:mga09592_3477_c1 nmdc:mga09592_3477_c1_3505_4299 256
82 3300050510 nmdc:mga06r32_24008_c1 nmdc:mga06r32_24008_c1_1953_2747 256
83 3300049588 Ga0501072_0314803 Ga0501072_0314803_388_1224 257
84 3300006163 Ga0070715_10219092 Ga0070715_102190921 259
85 3300014325 Ga0163163_10028280 Ga0163163_100282806 260
86 3300009098 Ga0105245_10366376 Ga0105245_103663762 261
87 3300009545 Ga0105237_10172896 Ga0105237_101728962 261
88 3300013307 Ga0157372_10009333 Ga0157372_100093335 261
89 3300013307 Ga0157372_10017493 Ga0157372_100174935 261
90 3300004803 Ga0058862_12082813 Ga0058862_120828131 262
91 3300005436 Ga0070713_100121962 Ga0070713_1001219623 262
92 3300020078 Ga0206352_10119627 Ga0206352_101196271 262
93 3300025912 Ga0207707_10124467 Ga0207707_101244672 262
94 3300025913 Ga0207695_10002047 Ga0207695_100020478 262
95 3300025914 Ga0207671_10005439 Ga0207671_100054393 262
96 3300035086 Ga0373934_0147594 Ga0373934_0147594_49_873 262
97 3300035118 Ga0373954_0036574 Ga0373954_0036574_568_1395 263
98 3300036401 Ga0373937_0003789 Ga0373937_0003789_1517_2344 263
99 3300053077 Ga0495601_0203820 Ga0495601_0203820_123_950 263
100 3300005467 Ga0070706_100095732 Ga0070706_1000957322 264
101 3300005468 Ga0070707_100119602 Ga0070707_1001196022 264
102 3300025910 Ga0207684_10046869 Ga0207684_100468691 264
103 3300025922 Ga0207646_10151552 Ga0207646_101515522 264
104 3300035111 Ga0373923_0067055 Ga0373923_0067055_30_839 264
105 3300035725 Ga0373947_0021579 Ga0373947_0021579_1028_1837 264
106 3300036401 Ga0373937_0069046 Ga0373937_0069046_811_1647 264
107 3300037068 Ga0373925_0115891 Ga0373925_0115891_404_1240 264
108 3300045976 Ga0466967_0693629 Ga0466967_0693629_132_971 264
109 3300013104 Ga0157370_10610799 Ga0157370_106107992 265
110 3300013306 Ga0163162_10065605 Ga0163162_100656053 265
111 3300013308 Ga0157375_10842893 Ga0157375_108428931 265
112 3300014325 Ga0163163_10106215 Ga0163163_101062152 265
113 3300047444 Ga0495675_0113247 Ga0495675_0113247_502_1356 265
114 3300009098 Ga0105245_10037810 Ga0105245_100378101 266
115 3300009177 Ga0105248_10049136 Ga0105248_100491362 266
116 3300009551 Ga0105238_10001942 Ga0105238_1000194217 266
117 3300009551 Ga0105238_10018770 Ga0105238_100187701 266
118 3300009553 Ga0105249_10074912 Ga0105249_100749121 266
119 3300013308 Ga0157375_10003364 Ga0157375_1000336411 266
120 3300046543 Ga0495645_0030095 Ga0495645_0030095_1269_2114 267
121 3300046559 Ga0495667_0010878 Ga0495667_0010878_1721_2566 267
122 3300047319 Ga0495674_0003092 Ga0495674_0003092_1575_2420 267
123 3300047444 Ga0495675_0028800 Ga0495675_0028800_2446_3291 267
124 3300047471 Ga0495684_0076882 Ga0495684_0076882_192_1037 267
125 3300006028 Ga0070717_10291577 Ga0070717_102915772 268
126 3300025939 Ga0207665_10160780 Ga0207665_101607802 268
127 3300009098 Ga0105245_10041303 Ga0105245_100413034 269
128 3300025927 Ga0207687_10072108 Ga0207687_100721082 269
129 3300048907 Ga0496104_0402959 Ga0496104_0402959_404_1249 269
130 3300025914 Ga0207671_10036712 Ga0207671_100367122 270
131 3300005445 Ga0070708_100102316 Ga0070708_1001023162 271
132 3300005467 Ga0070706_100023384 Ga0070706_1000233845 271
133 3300005468 Ga0070707_100015361 Ga0070707_1000153613 271
134 3300025922 Ga0207646_10172144 Ga0207646_101721442 271
135 3300037471 Ga0395905_0160782 Ga0395905_0160782_996_1838 271
136 3300005329 Ga0070683_100070667 Ga0070683_1000706673 272
137 3300005339 Ga0070660_100027432 Ga0070660_1000274325 272
138 3300005345 Ga0070692_10009978 Ga0070692_100099783 272
139 3300005367 Ga0070667_100455175 Ga0070667_1004551751 272
140 3300005518 Ga0070699_100107894 Ga0070699_1001078942 272
141 3300005535 Ga0070684_100142270 Ga0070684_1001422702 272
142 3300005563 Ga0068855_100317677 Ga0068855_1003176773 272
143 3300005578 Ga0068854_100049872 Ga0068854_1000498723 272
144 3300006237 Ga0097621_100172421 Ga0097621_1001724212 272
145 3300006358 Ga0068871_100178922 Ga0068871_1001789223 272
146 3300025924 Ga0207694_10010202 Ga0207694_100102023 272
147 3300025927 Ga0207687_10192533 Ga0207687_101925332 272
148 3300025929 Ga0207664_10009150 Ga0207664_100091503 272
149 3300025934 Ga0207686_10134703 Ga0207686_101347032 272
150 3300025981 Ga0207640_10106532 Ga0207640_101065321 272
151 3300025986 Ga0207658_10209097 Ga0207658_102090973 272
152 3300026035 Ga0207703_10102535 Ga0207703_101025352 272
153 3300026078 Ga0207702_10269792 Ga0207702_102697921 272
154 3300026116 Ga0207674_10165627 Ga0207674_101656272 272
155 3300026121 Ga0207683_10303267 Ga0207683_103032672 272
156 3300005329 Ga0070683_100394635 Ga0070683_1003946351 273
157 3300005435 Ga0070714_100553726 Ga0070714_1005537261 273
158 3300009093 Ga0105240_10212173 Ga0105240_102121732 273
159 3300025929 Ga0207664_10474965 Ga0207664_104749651 273
160 3300025944 Ga0207661_10398252 Ga0207661_103982521 273
161 3300025949 Ga0207667_10434614 Ga0207667_104346142 273
162 3300059506 Ga0587085_018954 Ga0587085_018954_11_886 273
163 3300005329 Ga0070683_100289365 Ga0070683_1002893652 274
164 3300005439 Ga0070711_100281153 Ga0070711_1002811532 274
165 3300005467 Ga0070706_100382105 Ga0070706_1003821052 274
166 3300005535 Ga0070684_100091217 Ga0070684_1000912173 274
167 3300005539 Ga0068853_100343478 Ga0068853_1003434781 274
168 3300005547 Ga0070693_100031866 Ga0070693_1000318662 274
169 3300005577 Ga0068857_100012408 Ga0068857_1000124086 274
170 3300005614 Ga0068856_100218840 Ga0068856_1002188402 274
171 3300005616 Ga0068852_100549318 Ga0068852_1005493181 274
172 3300005834 Ga0068851_10145164 Ga0068851_101451641 274
173 3300005841 Ga0068863_100337557 Ga0068863_1003375572 274
174 3300005842 Ga0068858_100005915 Ga0068858_1000059154 274
175 3300006028 Ga0070717_10373492 Ga0070717_103734921 274
176 3300006175 Ga0070712_100109991 Ga0070712_1001099912 274
177 3300006237 Ga0097621_100024399 Ga0097621_1000243993 274
178 3300006358 Ga0068871_100013032 Ga0068871_1000130323 274
179 3300013308 Ga0157375_10599521 Ga0157375_105995212 274
180 3300014325 Ga0163163_10053514 Ga0163163_100535143 274
181 3300025910 Ga0207684_10491528 Ga0207684_104915281 274
182 3300025915 Ga0207693_10031221 Ga0207693_100312214 274
183 3300025916 Ga0207663_10267659 Ga0207663_102676592 274
184 3300025922 Ga0207646_10066095 Ga0207646_100660953 274
185 3300025924 Ga0207694_10001557 Ga0207694_1000155719 274
186 3300025924 Ga0207694_10097898 Ga0207694_100978982 274
187 3300025927 Ga0207687_10000237 Ga0207687_100002373 274
188 3300025941 Ga0207711_10002756 Ga0207711_100027564 274
189 3300025944 Ga0207661_10033590 Ga0207661_100335903 274
190 3300025961 Ga0207712_10102944 Ga0207712_101029442 274
191 3300026035 Ga0207703_10070084 Ga0207703_100700843 274
192 3300026078 Ga0207702_10470813 Ga0207702_104708131 274
193 3300026116 Ga0207674_10000852 Ga0207674_100008524 274
194 3300026142 Ga0207698_10493591 Ga0207698_104935911 274
195 3300035695 Ga0373927_0011082 Ga0373927_0011082_435_1355 274
196 3300035725 Ga0373947_0001079 Ga0373947_0001079_6603_7523 274
197 3300037068 Ga0373925_0003461 Ga0373925_0003461_343_1263 274
198 3300046531 Ga0495665_0219405 Ga0495665_0219405_47_967 274
199 3300046690 Ga0495624_0037200 Ga0495624_0037200_693_1613 274
200 3300005436 Ga0070713_100018598 Ga0070713_1000185984 275
201 3300005518 Ga0070699_100207920 Ga0070699_1002079202 275
202 3300006028 Ga0070717_10150499 Ga0070717_101504991 275
203 3300006175 Ga0070712_100140025 Ga0070712_1001400252 275
204 3300006847 Ga0075431_100510632 Ga0075431_1005106321 275
205 3300009177 Ga0105248_10689255 Ga0105248_106892551 275
206 3300025913 Ga0207695_10062531 Ga0207695_100625313 275
207 3300025928 Ga0207700_10025821 Ga0207700_100258211 275
208 3300046477 Ga0495664_0004981 Ga0495664_0004981_940_1812 275
209 3300046535 Ga0495586_0037937 Ga0495586_0037937_1519_2400 275
210 3300047319 Ga0495674_0012530 Ga0495674_0012530_486_1367 275
211 3300047319 Ga0495674_0024093 Ga0495674_0024093_2658_3530 275
212 3300005458 Ga0070681_10474691 Ga0070681_104746911 276
213 3300005468 Ga0070707_100358894 Ga0070707_1003588941 276
214 3300005471 Ga0070698_100068419 Ga0070698_1000684193 276
215 3300006852 Ga0075433_10504803 Ga0075433_105048031 276
216 3300006881 Ga0068865_100018087 Ga0068865_1000180874 276
217 3300006914 Ga0075436_100147488 Ga0075436_1001474882 276
218 3300007076 Ga0075435_100209451 Ga0075435_1002094512 276
219 3300009093 Ga0105240_10111731 Ga0105240_101117312 276
220 3300025913 Ga0207695_10090234 Ga0207695_100902342 276
221 3300048907 Ga0496104_0128795 Ga0496104_0128795_231_1094 276
222 3300048909 Ga0496106_0114418 Ga0496106_0114418_107_970 276
223 3300050507 nmdc:mga05p37_236241_c1 nmdc:mga05p37_236241_c1_561_1448 276
224 3300050512 nmdc:mga0n895_119142_c1 nmdc:mga0n895_119142_c1_661_1548 276
225 3300050513 nmdc:mga0rr50_52726_c1 nmdc:mga0rr50_52726_c1_1093_1980 276
226 3300050514 nmdc:mga08x19_946_c1 nmdc:mga08x19_946_c1_633_1520 276
227 3300050515 nmdc:mga0a205_1360_c1 nmdc:mga0a205_1360_c1_656_1543 276
228 3300005355 Ga0070671_100309194 Ga0070671_1003091942 277
229 3300009101 Ga0105247_10045579 Ga0105247_100455792 277
230 3300009177 Ga0105248_10859514 Ga0105248_108595141 277
231 3300009551 Ga0105238_10104968 Ga0105238_101049683 277
232 3300035117 Ga0373953_0062913 Ga0373953_0062913_131_1015 277
233 3300035724 Ga0373933_0161884 Ga0373933_0161884_123_995 277
234 3300004799 Ga0058863_11918874 Ga0058863_119188741 278
235 3300004800 Ga0058861_10691150 Ga0058861_106911501 278
236 3300005364 Ga0070673_100410101 Ga0070673_1004101011 278
237 3300025921 Ga0207652_10287320 Ga0207652_102873202 278
238 3300025929 Ga0207664_10578174 Ga0207664_105781741 278
239 3300005435 Ga0070714_100000257 Ga0070714_10000025737 279
240 3300005436 Ga0070713_100003140 Ga0070713_1000031409 279
241 3300005436 Ga0070713_100249090 Ga0070713_1002490901 279
242 3300005439 Ga0070711_100024360 Ga0070711_1000243603 279
243 3300005467 Ga0070706_100557029 Ga0070706_1005570292 279
244 3300006028 Ga0070717_10028961 Ga0070717_100289613 279
245 3300025928 Ga0207700_10020108 Ga0207700_100201083 279
246 3300025929 Ga0207664_10010524 Ga0207664_100105242 279
247 3300005467 Ga0070706_100345899 Ga0070706_1003458991 280
248 3300005468 Ga0070707_100107583 Ga0070707_1001075832 280
249 3300005536 Ga0070697_100252152 Ga0070697_1002521521 280
250 3300025910 Ga0207684_10015732 Ga0207684_100157324 280
251 3300025922 Ga0207646_10320827 Ga0207646_103208271 280
252 3300046543 Ga0495645_0006325 Ga0495645_0006325_1525_2424 280
253 3300059493 Ga0587077_013275 Ga0587077_013275_405_1298 280
254 3300059504 Ga0587082_023152 Ga0587082_023152_108_1001 280
255 3300005436 Ga0070713_100182654 Ga0070713_1001826542 281
256 3300006358 Ga0068871_100387065 Ga0068871_1003870651 281
257 3300025928 Ga0207700_10349617 Ga0207700_103496172 281
258 3300035692 Ga0373935_0110433 Ga0373935_0110433_869_1750 281
259 3300005327 Ga0070658_10427563 Ga0070658_104275632 282
260 3300005329 Ga0070683_100027689 Ga0070683_1000276894 282
261 3300005338 Ga0068868_100026640 Ga0068868_1000266402 282
262 3300005354 Ga0070675_100341440 Ga0070675_1003414401 282
263 3300005364 Ga0070673_100137445 Ga0070673_1001374451 282
264 3300005444 Ga0070694_100160160 Ga0070694_1001601602 282
265 3300005467 Ga0070706_100030104 Ga0070706_1000301046 282
266 3300005535 Ga0070684_100075591 Ga0070684_1000755913 282
267 3300005536 Ga0070697_100190482 Ga0070697_1001904822 282
268 3300005543 Ga0070672_100201247 Ga0070672_1002012472 282
269 3300005549 Ga0070704_100154487 Ga0070704_1001544872 282
270 3300005578 Ga0068854_100031407 Ga0068854_1000314073 282
271 3300005618 Ga0068864_100285542 Ga0068864_1002855421 282
272 3300006175 Ga0070712_100061184 Ga0070712_1000611843 282
273 3300006237 Ga0097621_100114536 Ga0097621_1001145362 282
274 3300006358 Ga0068871_100089546 Ga0068871_1000895462 282
275 3300006871 Ga0075434_100581693 Ga0075434_1005816931 282
276 3300006914 Ga0075436_100027764 Ga0075436_1000277645 282
277 3300025910 Ga0207684_10025700 Ga0207684_100257006 282
278 3300025915 Ga0207693_10068619 Ga0207693_100686191 282
279 3300026095 Ga0207676_10408103 Ga0207676_104081032 282
280 3300050514 nmdc:mga08x19_76860_c1 nmdc:mga08x19_76860_c1_1127_1999 282
281 3300013296 Ga0157374_10021251 Ga0157374_100212511 283
282 3300035695 Ga0373927_0001819 Ga0373927_0001819_9526_10401 283
283 3300048913 Ga0496110_0072935 Ga0496110_0072935_767_1657 283
284 3300048917 Ga0496114_0498770 Ga0496114_0498770_16_906 283
285 3300005435 Ga0070714_100003579 Ga0070714_1000035796 284
286 3300005614 Ga0068856_100055874 Ga0068856_1000558742 284
287 3300025916 Ga0207663_10109166 Ga0207663_101091662 285
288 3300025925 Ga0207650_10177051 Ga0207650_101770512 285
289 3300005458 Ga0070681_10047436 Ga0070681_100474363 286
290 3300005841 Ga0068863_100156921 Ga0068863_1001569212 286
291 3300009177 Ga0105248_10820653 Ga0105248_108206531 286
292 3300014325 Ga0163163_10135229 Ga0163163_101352292 286
293 3300026088 Ga0207641_10134834 Ga0207641_101348341 286
294 3300005467 Ga0070706_100001433 Ga0070706_10000143327 287
295 3300005536 Ga0070697_100001261 Ga0070697_10000126121 287
296 3300025910 Ga0207684_10000354 Ga0207684_1000035441 287
297 3300035086 Ga0373934_0001634 Ga0373934_0001634_4165_5103 288
298 3300035117 Ga0373953_0011840 Ga0373953_0011840_277_1215 288
299 3300035118 Ga0373954_0005364 Ga0373954_0005364_2867_3805 288
300 3300035119 Ga0373956_0089647 Ga0373956_0089647_466_1404 288
301 3300035120 Ga0373957_0062933 Ga0373957_0062933_210_1148 288
302 3300035172 Ga0373955_0007095 Ga0373955_0007095_3402_4340 288
303 3300035410 Ga0373924_0071634 Ga0373924_0071634_72_1010 288
304 3300035724 Ga0373933_0268218 Ga0373933_0268218_49_987 288
305 3300036401 Ga0373937_0048310 Ga0373937_0048310_2361_3299 288
306 3300046462 Ga0495651_0176702 Ga0495651_0176702_171_1109 288
307 3300046689 Ga0495613_0122111 Ga0495613_0122111_234_1172 288
308 3300004798 Ga0058859_11786207 Ga0058859_117862072 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07589

PEP-CTERM

PEP-CTERM motif

294

318

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ci7-assembly1.cif.gz_B the crystal structure of the cysteine protease and lectin-like domains of cwp84, a surface layer associated protein of clostridium difficile 0.5665 51 264
7tok-assembly2.cif.gz_B crystal structure of the cbm domain of carbohydrate esterase fjoacxe 0.4232 47 265
7tok-assembly2.cif.gz_B crystal structure of the cbm domain of carbohydrate esterase fjoacxe 0.4206 47 265
6ooy-assembly1.cif.gz_A asymmetric htnf-alpha 0.3653 56 205
6x83-assembly1.cif.gz_C crystal structure of tnfalpha with fragment compound 6 0.3608 55 205
ID Description Score Start End Superfamily
af_A4I0M2_138_767_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.5563 129 181 1.20.58.390
af_Q965Y9_1501_1664_2.60.120.820 Mainly Beta;Sandwich;Jelly Rolls;PHR domain 0.4498 28 266 2.60.120.820
af_Q965Y9_1501_1664_2.60.120.820 Mainly Beta;Sandwich;Jelly Rolls;PHR domain 0.437 28 266 2.60.120.820
af_G5EEZ6_455_718_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.4104 52 212 2.40.10.10
af_Q9ESK3_500_644_2.60.120.380 Mainly Beta;Sandwich;Jelly Rolls; 0.4032 23 205 2.60.120.380
ID Description Score Start End GO Terms
AF-A0A2V7CL95-F1-model_v4 PEP-CTERM sorting domain-containing protein 0.9354 16 265
AF-A0A2V5TFI7-F1-model_v4 PEP-CTERM sorting domain-containing protein 0.9164 50 264
AF-A0A2V8D2T5-F1-model_v4 Uncharacterized protein 0.9112 48 266
AF-A0A2V6PDH5-F1-model_v4 Uncharacterized protein 0.9055 38 265
AF-A0A2V7CL95-F1-model_v4 PEP-CTERM sorting domain-containing protein 0.9019 16 265

Feature Viewer

pLDDT pTM Quality
81.36 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map