F399580
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 308 | 167 | 308 | 282 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100001433|Ga0070706_10000143327 |
| Length | 322 |
| Sequence | MLISRRMTSSRKWVPTGVYMTRRFDHRAMPLSICLLAMLAAPAFGDTIYNNLTPNNLMAIATRPDSPGVFEIEAGDDFLLGSQTIINKASFVGLIVPGVTGGTPSISEVVAEMYRVFPKDSNTNRTSGPPTFSTPEVPTRVNSPSDVAFVSRDSAASELTFSTSVLAATFTALNSVKPGGIHMSPLQTTGGNGPLTGQEIQLNLTFTTPFNLPADHYFFVPQVALTNGGQFYWLSASRPISGASTTPFPAGVTDLQAWTRDANLDPDWLRVGMDIVGGTTPPTFNTAFSLDGTAVPEPSTLLLLGSGLAGVWAWRRKRESAN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 105 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 106 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 107 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 108 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 109 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 110 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 111 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 112 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 113 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 115 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 116 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 117 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 120 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 121 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 122 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 123 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 152 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 153 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 154 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 155 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.4 |
| Metatranscriptomes | 2.6 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.62 |
| Rhizosphere | 98.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058859_11786207 | 3300004798 | Bacteria | 1332 |
| 2 | Ga0058863_11918874 | 3300004799 | Bacteria | 914 |
| 3 | Ga0058861_10691150 | 3300004800 | Bacteria | 901 |
| 4 | Ga0058862_12082813 | 3300004803 | Bacteria | 1111 |
| 5 | Ga0070658_10427563 | 3300005327 | Unclassified | 1139 |
| 6 | Ga0070683_100027689 | 3300005329 | Bacteria | 5114 |
| 7 | Ga0070683_100070667 | 3300005329 | Bacteria | 3256 |
| 8 | Ga0070683_100289365 | 3300005329 | Bacteria | 1558 |
| 9 | Ga0070683_100394635 | 3300005329 | Unclassified | 1319 |
| 10 | Ga0068868_100026640 | 3300005338 | Bacteria | 4408 |
| 11 | Ga0070660_100027432 | 3300005339 | Bacteria | 4250 |
| 12 | Ga0070692_10009978 | 3300005345 | Bacteria | 4305 |
| 13 | Ga0070675_100341440 | 3300005354 | Unclassified | 1326 |
| 14 | Ga0070671_100309194 | 3300005355 | Bacteria | 1346 |
| 15 | Ga0070673_100137445 | 3300005364 | Bacteria | 2058 |
| 16 | Ga0070673_100410101 | 3300005364 | Bacteria | 1213 |
| 17 | Ga0070667_100455175 | 3300005367 | Bacteria | 1170 |
| 18 | Ga0070714_100000257 | 3300005435 | Bacteria | 41363 |
| 19 | Ga0070714_100003579 | 3300005435 | Bacteria | 11622 |
| 20 | Ga0070714_100553726 | 3300005435 | Unclassified | 1101 |
| 21 | Ga0070713_100003140 | 3300005436 | Bacteria | 10875 |
| 22 | Ga0070713_100018598 | 3300005436 | Bacteria | 5282 |
| 23 | Ga0070713_100121962 | 3300005436 | Bacteria | 2287 |
| 24 | Ga0070713_100182654 | 3300005436 | Bacteria | 1886 |
| 25 | Ga0070713_100249090 | 3300005436 | Bacteria | 1620 |
| 26 | Ga0070711_100024360 | 3300005439 | Unclassified | 3947 |
| 27 | Ga0070711_100281153 | 3300005439 | Unclassified | 1316 |
| 28 | Ga0070705_100014432 | 3300005440 | Bacteria | 4063 |
| 29 | Ga0070694_100160160 | 3300005444 | Bacteria | 1651 |
| 30 | Ga0070708_100102316 | 3300005445 | Unclassified | 2624 |
| 31 | Ga0070708_100215966 | 3300005445 | Bacteria | 1797 |
| 32 | Ga0070681_10047436 | 3300005458 | Bacteria | 4294 |
| 33 | Ga0070681_10474691 | 3300005458 | Bacteria | 1163 |
| 34 | Ga0070706_100001433 | 3300005467 | Bacteria | 25205 |
| 35 | Ga0070706_100023384 | 3300005467 | Bacteria | 5691 |
| 36 | Ga0070706_100030104 | 3300005467 | Bacteria | 5000 |
| 37 | Ga0070706_100052273 | 3300005467 | Unclassified | 3771 |
| 38 | Ga0070706_100095732 | 3300005467 | Bacteria | 2756 |
| 39 | Ga0070706_100345899 | 3300005467 | Bacteria | 1386 |
| 40 | Ga0070706_100382105 | 3300005467 | Bacteria | 1311 |
| 41 | Ga0070706_100528061 | 3300005467 | Bacteria | 1098 |
| 42 | Ga0070706_100557029 | 3300005467 | Bacteria | 1066 |
| 43 | Ga0070707_100015361 | 3300005468 | Bacteria | 7184 |
| 44 | Ga0070707_100107583 | 3300005468 | Unclassified | 2705 |
| 45 | Ga0070707_100119602 | 3300005468 | Bacteria | 2557 |
| 46 | Ga0070707_100358894 | 3300005468 | Bacteria | 1416 |
| 47 | Ga0070698_100068419 | 3300005471 | Bacteria | 3568 |
| 48 | Ga0070698_100738577 | 3300005471 | Unclassified | 927 |
| 49 | Ga0070699_100107894 | 3300005518 | Unclassified | 2443 |
| 50 | Ga0070699_100207920 | 3300005518 | Bacteria | 1741 |
| 51 | Ga0070699_100348804 | 3300005518 | Unclassified | 1333 |
| 52 | Ga0070699_100555738 | 3300005518 | Bacteria | 1045 |
| 53 | Ga0070684_100075591 | 3300005535 | Bacteria | 2971 |
| 54 | Ga0070684_100091217 | 3300005535 | Bacteria | 2710 |
| 55 | Ga0070684_100142270 | 3300005535 | Bacteria | 2169 |
| 56 | Ga0070697_100001261 | 3300005536 | Bacteria | 19124 |
| 57 | Ga0070697_100181024 | 3300005536 | Unclassified | 1786 |
| 58 | Ga0070697_100190482 | 3300005536 | Unclassified | 1741 |
| 59 | Ga0070697_100252152 | 3300005536 | Bacteria | 1509 |
| 60 | Ga0068853_100343478 | 3300005539 | Bacteria | 1387 |
| 61 | Ga0070672_100201247 | 3300005543 | Unclassified | 1665 |
| 62 | Ga0070672_100303853 | 3300005543 | Bacteria | 1353 |
| 63 | Ga0070696_100041318 | 3300005546 | Bacteria | 3186 |
| 64 | Ga0070693_100031866 | 3300005547 | Bacteria | 2894 |
| 65 | Ga0070704_100154487 | 3300005549 | Unclassified | 1808 |
| 66 | Ga0068855_100317677 | 3300005563 | Bacteria | 1722 |
| 67 | Ga0068857_100012408 | 3300005577 | Bacteria | 7418 |
| 68 | Ga0068854_100031407 | 3300005578 | Bacteria | 3690 |
| 69 | Ga0068854_100049872 | 3300005578 | Bacteria | 2993 |
| 70 | Ga0068856_100055874 | 3300005614 | Bacteria | 3895 |
| 71 | Ga0068856_100218840 | 3300005614 | Bacteria | 1919 |
| 72 | Ga0068856_100459915 | 3300005614 | Bacteria | 1293 |
| 73 | Ga0068852_100549318 | 3300005616 | Bacteria | 1155 |
| 74 | Ga0068864_100285542 | 3300005618 | Bacteria | 1541 |
| 75 | Ga0068861_100255678 | 3300005719 | Bacteria | 1497 |
| 76 | Ga0068851_10145164 | 3300005834 | Bacteria | 1293 |
| 77 | Ga0068863_100156921 | 3300005841 | Unclassified | 2179 |
| 78 | Ga0068863_100337557 | 3300005841 | Unclassified | 1465 |
| 79 | Ga0068858_100005915 | 3300005842 | Bacteria | 11939 |
| 80 | Ga0068860_100444671 | 3300005843 | Bacteria | 1288 |
| 81 | Ga0070717_10028961 | 3300006028 | Unclassified | 4438 |
| 82 | Ga0070717_10150499 | 3300006028 | Bacteria | 2013 |
| 83 | Ga0070717_10291577 | 3300006028 | Bacteria | 1449 |
| 84 | Ga0070717_10373492 | 3300006028 | Unclassified | 1278 |
| 85 | Ga0070715_10219092 | 3300006163 | Unclassified | 977 |
| 86 | Ga0070712_100061184 | 3300006175 | Bacteria | 2659 |
| 87 | Ga0070712_100109991 | 3300006175 | Bacteria | 2054 |
| 88 | Ga0070712_100140025 | 3300006175 | Unclassified | 1845 |
| 89 | Ga0097621_100024399 | 3300006237 | Bacteria | 4722 |
| 90 | Ga0097621_100114536 | 3300006237 | Bacteria | 2281 |
| 91 | Ga0097621_100172421 | 3300006237 | Bacteria | 1865 |
| 92 | Ga0068871_100013032 | 3300006358 | Bacteria | 6161 |
| 93 | Ga0068871_100089546 | 3300006358 | Unclassified | 2561 |
| 94 | Ga0068871_100178922 | 3300006358 | Bacteria | 1822 |
| 95 | Ga0068871_100387065 | 3300006358 | Unclassified | 1243 |
| 96 | Ga0075428_100019022 | 3300006844 | Bacteria | 7596 |
| 97 | Ga0075431_100510632 | 3300006847 | Unclassified | 1192 |
| 98 | Ga0075433_10130985 | 3300006852 | Bacteria | 2228 |
| 99 | Ga0075433_10504803 | 3300006852 | Unclassified | 1064 |
| 100 | Ga0075434_100581693 | 3300006871 | Unclassified | 1139 |
| 101 | Ga0075429_100034828 | 3300006880 | Bacteria | 4376 |
| 102 | Ga0068865_100018087 | 3300006881 | Unclassified | 4543 |
| 103 | Ga0075436_100027764 | 3300006914 | Bacteria | 3896 |
| 104 | Ga0075436_100147488 | 3300006914 | Bacteria | 1654 |
| 105 | Ga0075435_100048600 | 3300007076 | Unclassified | 3409 |
| 106 | Ga0075435_100209451 | 3300007076 | Bacteria | 1653 |
| 107 | Ga0105240_10000167 | 3300009093 | Bacteria | 133279 |
| 108 | Ga0105240_10049574 | 3300009093 | Bacteria | 5299 |
| 109 | Ga0105240_10111731 | 3300009093 | Unclassified | 3304 |
| 110 | Ga0105240_10212173 | 3300009093 | Bacteria | 2261 |
| 111 | Ga0111539_10442672 | 3300009094 | Unclassified | 1513 |
| 112 | Ga0111539_10942083 | 3300009094 | Bacteria | 1004 |
| 113 | Ga0105245_10037810 | 3300009098 | Unclassified | 4292 |
| 114 | Ga0105245_10041303 | 3300009098 | Bacteria | 4111 |
| 115 | Ga0105245_10366376 | 3300009098 | Bacteria | 1431 |
| 116 | Ga0105247_10045579 | 3300009101 | Bacteria | 2691 |
| 117 | Ga0114129_10064062 | 3300009147 | Bacteria | 5130 |
| 118 | Ga0114129_10389704 | 3300009147 | Bacteria | 1838 |
| 119 | Ga0105241_10013848 | 3300009174 | Bacteria | 5907 |
| 120 | Ga0105241_10049787 | 3300009174 | Bacteria | 3192 |
| 121 | Ga0105248_10023983 | 3300009177 | Bacteria | 6782 |
| 122 | Ga0105248_10049136 | 3300009177 | Bacteria | 4731 |
| 123 | Ga0105248_10689255 | 3300009177 | Bacteria | 1153 |
| 124 | Ga0105248_10820653 | 3300009177 | Unclassified | 1050 |
| 125 | Ga0105248_10859514 | 3300009177 | Bacteria | 1024 |
| 126 | Ga0105237_10004092 | 3300009545 | Bacteria | 17008 |
| 127 | Ga0105237_10054147 | 3300009545 | Bacteria | 4020 |
| 128 | Ga0105237_10172896 | 3300009545 | Bacteria | 2160 |
| 129 | Ga0105238_10001942 | 3300009551 | Bacteria | 20789 |
| 130 | Ga0105238_10018770 | 3300009551 | Bacteria | 7042 |
| 131 | Ga0105238_10104968 | 3300009551 | Unclassified | 2807 |
| 132 | Ga0105249_10074912 | 3300009553 | Bacteria | 3134 |
| 133 | Ga0157370_10610799 | 3300013104 | Unclassified | 998 |
| 134 | Ga0157374_10021251 | 3300013296 | Bacteria | 5771 |
| 135 | Ga0157374_10132766 | 3300013296 | Bacteria | 2411 |
| 136 | Ga0157378_10008985 | 3300013297 | Bacteria | 8699 |
| 137 | Ga0163162_10008190 | 3300013306 | Bacteria | 10198 |
| 138 | Ga0163162_10065605 | 3300013306 | Bacteria | 3678 |
| 139 | Ga0157372_10009333 | 3300013307 | Bacteria | 10439 |
| 140 | Ga0157372_10017493 | 3300013307 | Bacteria | 7692 |
| 141 | Ga0157375_10003364 | 3300013308 | Bacteria | 13862 |
| 142 | Ga0157375_10599521 | 3300013308 | Unclassified | 1261 |
| 143 | Ga0157375_10842893 | 3300013308 | Unclassified | 1064 |
| 144 | Ga0163163_10028280 | 3300014325 | Bacteria | 5381 |
| 145 | Ga0163163_10053514 | 3300014325 | Bacteria | 3985 |
| 146 | Ga0163163_10106215 | 3300014325 | Plasmid | 2834 |
| 147 | Ga0163163_10135229 | 3300014325 | Unclassified | 2506 |
| 148 | Ga0163163_10164500 | 3300014325 | Bacteria | 2264 |
| 149 | Ga0206352_10119627 | 3300020078 | Bacteria | 1167 |
| 150 | Ga0207684_10000354 | 3300025910 | Bacteria | 62819 |
| 151 | Ga0207684_10015732 | 3300025910 | Bacteria | 6509 |
| 152 | Ga0207684_10025700 | 3300025910 | Bacteria | 5017 |
| 153 | Ga0207684_10030365 | 3300025910 | Bacteria | 4600 |
| 154 | Ga0207684_10034651 | 3300025910 | Unclassified | 4289 |
| 155 | Ga0207684_10046869 | 3300025910 | Bacteria | 3666 |
| 156 | Ga0207684_10491528 | 3300025910 | Unclassified | 1052 |
| 157 | Ga0207707_10124467 | 3300025912 | Bacteria | 2254 |
| 158 | Ga0207695_10002047 | 3300025913 | Bacteria | 30915 |
| 159 | Ga0207695_10062531 | 3300025913 | Bacteria | 3842 |
| 160 | Ga0207695_10090234 | 3300025913 | Unclassified | 3080 |
| 161 | Ga0207671_10005439 | 3300025914 | Bacteria | 11725 |
| 162 | Ga0207671_10036712 | 3300025914 | Bacteria | 3635 |
| 163 | Ga0207693_10031221 | 3300025915 | Plasmid | 4208 |
| 164 | Ga0207693_10068619 | 3300025915 | Bacteria | 2775 |
| 165 | Ga0207663_10109166 | 3300025916 | Bacteria | 1875 |
| 166 | Ga0207663_10267659 | 3300025916 | Unclassified | 1265 |
| 167 | Ga0207652_10287320 | 3300025921 | Bacteria | 1484 |
| 168 | Ga0207646_10066095 | 3300025922 | Bacteria | 3228 |
| 169 | Ga0207646_10151552 | 3300025922 | Unclassified | 2091 |
| 170 | Ga0207646_10172144 | 3300025922 | Unclassified | 1955 |
| 171 | Ga0207646_10320827 | 3300025922 | Bacteria | 1400 |
| 172 | Ga0207694_10001557 | 3300025924 | Bacteria | 19467 |
| 173 | Ga0207694_10010202 | 3300025924 | Bacteria | 7081 |
| 174 | Ga0207694_10097898 | 3300025924 | Bacteria | 2322 |
| 175 | Ga0207650_10177051 | 3300025925 | Bacteria | 1698 |
| 176 | Ga0207687_10000237 | 3300025927 | Bacteria | 37671 |
| 177 | Ga0207687_10072108 | 3300025927 | Bacteria | 2469 |
| 178 | Ga0207687_10192533 | 3300025927 | Bacteria | 1588 |
| 179 | Ga0207700_10020108 | 3300025928 | Unclassified | 4526 |
| 180 | Ga0207700_10025821 | 3300025928 | Unclassified | 4087 |
| 181 | Ga0207700_10349617 | 3300025928 | Bacteria | 1287 |
| 182 | Ga0207664_10009150 | 3300025929 | Bacteria | 6942 |
| 183 | Ga0207664_10010524 | 3300025929 | Bacteria | 6533 |
| 184 | Ga0207664_10474965 | 3300025929 | Unclassified | 1118 |
| 185 | Ga0207664_10578174 | 3300025929 | Unclassified | 1009 |
| 186 | Ga0207686_10134703 | 3300025934 | Bacteria | 1699 |
| 187 | Ga0207665_10160780 | 3300025939 | Bacteria | 1615 |
| 188 | Ga0207691_10437477 | 3300025940 | Bacteria | 1114 |
| 189 | Ga0207711_10002756 | 3300025941 | Bacteria | 15477 |
| 190 | Ga0207661_10033590 | 3300025944 | Bacteria | 3983 |
| 191 | Ga0207661_10398252 | 3300025944 | Bacteria | 1248 |
| 192 | Ga0207667_10434614 | 3300025949 | Unclassified | 1335 |
| 193 | Ga0207712_10102944 | 3300025961 | Unclassified | 2127 |
| 194 | Ga0207640_10106532 | 3300025981 | Bacteria | 1978 |
| 195 | Ga0207658_10209097 | 3300025986 | Bacteria | 1634 |
| 196 | Ga0207703_10070084 | 3300026035 | Bacteria | 2893 |
| 197 | Ga0207703_10102535 | 3300026035 | Unclassified | 2428 |
| 198 | Ga0207702_10269792 | 3300026078 | Bacteria | 1604 |
| 199 | Ga0207702_10470813 | 3300026078 | Bacteria | 1221 |
| 200 | Ga0207641_10134834 | 3300026088 | Unclassified | 2221 |
| 201 | Ga0207676_10408103 | 3300026095 | Unclassified | 1271 |
| 202 | Ga0207674_10000852 | 3300026116 | Bacteria | 39796 |
| 203 | Ga0207674_10165627 | 3300026116 | Bacteria | 2165 |
| 204 | Ga0207683_10303267 | 3300026121 | Bacteria | 1461 |
| 205 | Ga0207698_10493591 | 3300026142 | Bacteria | 1190 |
| 206 | Ga0268264_10140939 | 3300028381 | Bacteria | 2150 |
| 207 | Ga0373934_0001634 | 3300035086 | Bacteria | 8223 |
| 208 | Ga0373934_0147594 | 3300035086 | Bacteria | 962 |
| 209 | Ga0373923_0067055 | 3300035111 | Bacteria | 1534 |
| 210 | Ga0373953_0011840 | 3300035117 | Bacteria | 3074 |
| 211 | Ga0373953_0062913 | 3300035117 | Bacteria | 1520 |
| 212 | Ga0373954_0005364 | 3300035118 | Bacteria | 5539 |
| 213 | Ga0373954_0036574 | 3300035118 | Bacteria | 2279 |
| 214 | Ga0373956_0089647 | 3300035119 | Bacteria | 1418 |
| 215 | Ga0373957_0062933 | 3300035120 | Bacteria | 1440 |
| 216 | Ga0373943_0254239 | 3300035170 | Unclassified | 988 |
| 217 | Ga0373955_0007095 | 3300035172 | Bacteria | 5134 |
| 218 | Ga0373924_0071634 | 3300035410 | Bacteria | 1463 |
| 219 | Ga0373935_0110433 | 3300035692 | Bacteria | 1825 |
| 220 | Ga0373927_0001819 | 3300035695 | Bacteria | 15845 |
| 221 | Ga0373927_0011082 | 3300035695 | Bacteria | 6005 |
| 222 | Ga0373927_0022438 | 3300035695 | Bacteria | 4135 |
| 223 | Ga0373933_0161884 | 3300035724 | Bacteria | 1421 |
| 224 | Ga0373933_0268218 | 3300035724 | Bacteria | 1101 |
| 225 | Ga0373947_0001079 | 3300035725 | Bacteria | 16722 |
| 226 | Ga0373947_0021579 | 3300035725 | Unclassified | 3728 |
| 227 | Ga0373947_0227345 | 3300035725 | Bacteria | 1228 |
| 228 | Ga0373937_0003789 | 3300036401 | Bacteria | 12785 |
| 229 | Ga0373937_0048310 | 3300036401 | Unclassified | 3895 |
| 230 | Ga0373937_0069046 | 3300036401 | Unclassified | 3258 |
| 231 | Ga0373937_0453384 | 3300036401 | Bacteria | 1218 |
| 232 | Ga0373925_0003461 | 3300037068 | Bacteria | 12203 |
| 233 | Ga0373925_0115891 | 3300037068 | Bacteria | 2075 |
| 234 | Ga0395905_0160782 | 3300037471 | Bacteria | 2111 |
| 235 | Ga0436360_0996247 | 3300039438 | Unclassified | 1930 |
| 236 | Ga0451576_0012268 | 3300045051 | Bacteria | 9645 |
| 237 | Ga0466967_0693629 | 3300045976 | Bacteria | 1008 |
| 238 | Ga0495592_0025190 | 3300046454 | Bacteria | 4517 |
| 239 | Ga0495651_0030040 | 3300046462 | Bacteria | 4237 |
| 240 | Ga0495651_0156022 | 3300046462 | Bacteria | 1640 |
| 241 | Ga0495651_0176702 | 3300046462 | Bacteria | 1515 |
| 242 | Ga0495653_0062447 | 3300046463 | Unclassified | 2815 |
| 243 | Ga0495653_0122497 | 3300046463 | Bacteria | 1851 |
| 244 | Ga0495662_0089030 | 3300046476 | Unclassified | 1504 |
| 245 | Ga0495664_0000575 | 3300046477 | Bacteria | 18480 |
| 246 | Ga0495664_0004981 | 3300046477 | Bacteria | 7273 |
| 247 | Ga0495664_0069376 | 3300046477 | Bacteria | 2104 |
| 248 | Ga0495608_0098189 | 3300046511 | Bacteria | 1890 |
| 249 | Ga0495608_0300039 | 3300046511 | Unclassified | 995 |
| 250 | Ga0495618_0266799 | 3300046514 | Unclassified | 1071 |
| 251 | Ga0495628_0056014 | 3300046516 | Bacteria | 3104 |
| 252 | Ga0495630_0117523 | 3300046517 | Unclassified | 2016 |
| 253 | Ga0495652_0026392 | 3300046529 | Bacteria | 5133 |
| 254 | Ga0495665_0033221 | 3300046531 | Bacteria | 2760 |
| 255 | Ga0495665_0219405 | 3300046531 | Bacteria | 983 |
| 256 | Ga0495640_0056281 | 3300046533 | Bacteria | 2687 |
| 257 | Ga0495586_0037937 | 3300046535 | Bacteria | 2587 |
| 258 | Ga0495587_0010068 | 3300046536 | Bacteria | 6035 |
| 259 | Ga0495645_0006325 | 3300046543 | Bacteria | 8214 |
| 260 | Ga0495645_0015942 | 3300046543 | Bacteria | 5354 |
| 261 | Ga0495645_0030095 | 3300046543 | Unclassified | 3954 |
| 262 | Ga0495667_0010878 | 3300046559 | Bacteria | 6152 |
| 263 | Ga0495667_0274631 | 3300046559 | Unclassified | 1070 |
| 264 | Ga0495634_0037331 | 3300046642 | Bacteria | 3320 |
| 265 | Ga0495634_0214532 | 3300046642 | Unclassified | 1190 |
| 266 | Ga0495635_0166771 | 3300046663 | Unclassified | 1498 |
| 267 | Ga0495635_0203464 | 3300046663 | Bacteria | 1342 |
| 268 | Ga0495657_0147602 | 3300046675 | Unclassified | 1462 |
| 269 | Ga0495599_0019308 | 3300046678 | Bacteria | 4248 |
| 270 | Ga0495623_0114880 | 3300046679 | Unclassified | 1627 |
| 271 | Ga0495613_0048143 | 3300046689 | Bacteria | 3148 |
| 272 | Ga0495613_0106499 | 3300046689 | Bacteria | 2023 |
| 273 | Ga0495613_0122111 | 3300046689 | Bacteria | 1870 |
| 274 | Ga0495613_0259670 | 3300046689 | Unclassified | 1211 |
| 275 | Ga0495624_0037200 | 3300046690 | Unclassified | 3134 |
| 276 | Ga0495604_0409617 | 3300047317 | Unclassified | 891 |
| 277 | Ga0495674_0003092 | 3300047319 | Bacteria | 16177 |
| 278 | Ga0495674_0012530 | 3300047319 | Bacteria | 7987 |
| 279 | Ga0495674_0024093 | 3300047319 | Bacteria | 5600 |
| 280 | Ga0495674_0138177 | 3300047319 | Bacteria | 2049 |
| 281 | Ga0495680_0121383 | 3300047322 | Bacteria | 1929 |
| 282 | Ga0495680_0430067 | 3300047322 | Unclassified | 907 |
| 283 | Ga0495675_0028800 | 3300047444 | Unclassified | 3540 |
| 284 | Ga0495675_0113247 | 3300047444 | Unclassified | 1692 |
| 285 | Ga0495684_0076882 | 3300047471 | Unclassified | 2535 |
| 286 | Ga0495684_0141368 | 3300047471 | Unclassified | 1804 |
| 287 | Ga0496104_0128795 | 3300048907 | Bacteria | 2431 |
| 288 | Ga0496104_0402959 | 3300048907 | Unclassified | 1280 |
| 289 | Ga0496106_0114418 | 3300048909 | Unclassified | 2104 |
| 290 | Ga0496110_0072935 | 3300048913 | Bacteria | 3047 |
| 291 | Ga0496114_0498770 | 3300048917 | Unclassified | 1077 |
| 292 | Ga0501072_0314803 | 3300049588 | Bacteria | 1244 |
| 293 | nmdc:mga05p37_236241_c1 | 3300050507 | Bacteria | 2200 |
| 294 | nmdc:mga05p37_273600_c1 | 3300050507 | Bacteria | 2017 |
| 295 | nmdc:mga05p37_50937_c1 | 3300050507 | Bacteria | 5092 |
| 296 | nmdc:mga09592_3477_c1 | 3300050508 | Bacteria | 12715 |
| 297 | nmdc:mga06r32_24008_c1 | 3300050510 | Bacteria | 5652 |
| 298 | nmdc:mga08y16_265135_c1 | 3300050511 | Bacteria | 1773 |
| 299 | nmdc:mga0n895_119142_c1 | 3300050512 | Bacteria | 2661 |
| 300 | nmdc:mga0rr50_52726_c1 | 3300050513 | Bacteria | 3024 |
| 301 | nmdc:mga08x19_76860_c1 | 3300050514 | Bacteria | 2186 |
| 302 | nmdc:mga08x19_946_c1 | 3300050514 | Bacteria | 18277 |
| 303 | nmdc:mga0a205_1360_c1 | 3300050515 | Bacteria | 20622 |
| 304 | nmdc:mga0a205_289228_c1 | 3300050515 | Bacteria | 1513 |
| 305 | Ga0495601_0203820 | 3300053077 | Bacteria | 1292 |
| 306 | Ga0587077_013275 | 3300059493 | Unclassified | 1333 |
| 307 | Ga0587082_023152 | 3300059504 | Archaea | 1028 |
| 308 | Ga0587085_018954 | 3300059506 | Bacteria | 1026 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046663 | Ga0495635_0203464 | Ga0495635_0203464_55_753 | 215 |
| 2 | 3300046689 | Ga0495613_0048143 | Ga0495613_0048143_2437_3135 | 215 |
| 3 | 3300009177 | Ga0105248_10023983 | Ga0105248_100239835 | 218 |
| 4 | 3300005471 | Ga0070698_100738577 | Ga0070698_1007385771 | 224 |
| 5 | 3300035170 | Ga0373943_0254239 | Ga0373943_0254239_90_836 | 233 |
| 6 | 3300035695 | Ga0373927_0022438 | Ga0373927_0022438_2239_2985 | 233 |
| 7 | 3300045051 | Ga0451576_0012268 | Ga0451576_0012268_682_1398 | 233 |
| 8 | 3300046517 | Ga0495630_0117523 | Ga0495630_0117523_247_1008 | 234 |
| 9 | 3300046559 | Ga0495667_0274631 | Ga0495667_0274631_291_1052 | 234 |
| 10 | 3300046642 | Ga0495634_0214532 | Ga0495634_0214532_60_821 | 234 |
| 11 | 3300046689 | Ga0495613_0106499 | Ga0495613_0106499_101_862 | 234 |
| 12 | 3300047471 | Ga0495684_0141368 | Ga0495684_0141368_519_1280 | 234 |
| 13 | 3300009093 | Ga0105240_10049574 | Ga0105240_100495745 | 235 |
| 14 | 3300009545 | Ga0105237_10054147 | Ga0105237_100541472 | 235 |
| 15 | 3300013296 | Ga0157374_10132766 | Ga0157374_101327661 | 235 |
| 16 | 3300009147 | Ga0114129_10389704 | Ga0114129_103897042 | 236 |
| 17 | 3300050507 | nmdc:mga05p37_273600_c1 | nmdc:mga05p37_273600_c1_653_1378 | 236 |
| 18 | 3300050515 | nmdc:mga0a205_289228_c1 | nmdc:mga0a205_289228_c1_134_862 | 237 |
| 19 | 3300009174 | Ga0105241_10013848 | Ga0105241_100138487 | 243 |
| 20 | 3300013306 | Ga0163162_10008190 | Ga0163162_100081902 | 243 |
| 21 | 3300046689 | Ga0495613_0259670 | Ga0495613_0259670_53_835 | 243 |
| 22 | 3300039438 | Ga0436360_0996247 | Ga0436360_0996247_432_1211 | 244 |
| 23 | 3300050511 | nmdc:mga08y16_265135_c1 | nmdc:mga08y16_265135_c1_345_1103 | 244 |
| 24 | 3300035725 | Ga0373947_0227345 | Ga0373947_0227345_291_1073 | 245 |
| 25 | 3300005440 | Ga0070705_100014432 | Ga0070705_1000144324 | 246 |
| 26 | 3300005543 | Ga0070672_100303853 | Ga0070672_1003038532 | 246 |
| 27 | 3300005546 | Ga0070696_100041318 | Ga0070696_1000413184 | 246 |
| 28 | 3300005719 | Ga0068861_100255678 | Ga0068861_1002556781 | 246 |
| 29 | 3300006852 | Ga0075433_10130985 | Ga0075433_101309854 | 246 |
| 30 | 3300007076 | Ga0075435_100048600 | Ga0075435_1000486005 | 246 |
| 31 | 3300009093 | Ga0105240_10000167 | Ga0105240_1000016752 | 246 |
| 32 | 3300009545 | Ga0105237_10004092 | Ga0105237_100040925 | 246 |
| 33 | 3300013297 | Ga0157378_10008985 | Ga0157378_100089856 | 246 |
| 34 | 3300014325 | Ga0163163_10164500 | Ga0163163_101645004 | 246 |
| 35 | 3300025940 | Ga0207691_10437477 | Ga0207691_104374771 | 246 |
| 36 | 3300005445 | Ga0070708_100215966 | Ga0070708_1002159663 | 248 |
| 37 | 3300005467 | Ga0070706_100528061 | Ga0070706_1005280612 | 248 |
| 38 | 3300005518 | Ga0070699_100348804 | Ga0070699_1003488041 | 248 |
| 39 | 3300005536 | Ga0070697_100181024 | Ga0070697_1001810241 | 248 |
| 40 | 3300005843 | Ga0068860_100444671 | Ga0068860_1004446711 | 248 |
| 41 | 3300009094 | Ga0111539_10442672 | Ga0111539_104426722 | 248 |
| 42 | 3300025910 | Ga0207684_10030365 | Ga0207684_100303652 | 248 |
| 43 | 3300028381 | Ga0268264_10140939 | Ga0268264_101409392 | 248 |
| 44 | 3300005614 | Ga0068856_100459915 | Ga0068856_1004599152 | 253 |
| 45 | 3300009174 | Ga0105241_10049787 | Ga0105241_100497871 | 253 |
| 46 | 3300047319 | Ga0495674_0138177 | Ga0495674_0138177_1147_1965 | 253 |
| 47 | 3300046462 | Ga0495651_0156022 | Ga0495651_0156022_41_892 | 254 |
| 48 | 3300046463 | Ga0495653_0062447 | Ga0495653_0062447_794_1645 | 254 |
| 49 | 3300046476 | Ga0495662_0089030 | Ga0495662_0089030_250_1101 | 254 |
| 50 | 3300046477 | Ga0495664_0069376 | Ga0495664_0069376_1004_1855 | 254 |
| 51 | 3300046514 | Ga0495618_0266799 | Ga0495618_0266799_160_1011 | 254 |
| 52 | 3300046543 | Ga0495645_0015942 | Ga0495645_0015942_291_1142 | 254 |
| 53 | 3300046663 | Ga0495635_0166771 | Ga0495635_0166771_433_1284 | 254 |
| 54 | 3300047322 | Ga0495680_0430067 | Ga0495680_0430067_12_863 | 254 |
| 55 | 3300036401 | Ga0373937_0453384 | Ga0373937_0453384_292_1110 | 255 |
| 56 | 3300046454 | Ga0495592_0025190 | Ga0495592_0025190_2305_3123 | 255 |
| 57 | 3300046462 | Ga0495651_0030040 | Ga0495651_0030040_2335_3153 | 255 |
| 58 | 3300046463 | Ga0495653_0122497 | Ga0495653_0122497_557_1375 | 255 |
| 59 | 3300046477 | Ga0495664_0000575 | Ga0495664_0000575_7835_8653 | 255 |
| 60 | 3300046511 | Ga0495608_0098189 | Ga0495608_0098189_1035_1853 | 255 |
| 61 | 3300046516 | Ga0495628_0056014 | Ga0495628_0056014_1212_2030 | 255 |
| 62 | 3300046529 | Ga0495652_0026392 | Ga0495652_0026392_916_1734 | 255 |
| 63 | 3300046531 | Ga0495665_0033221 | Ga0495665_0033221_1878_2696 | 255 |
| 64 | 3300046533 | Ga0495640_0056281 | Ga0495640_0056281_1339_2157 | 255 |
| 65 | 3300046536 | Ga0495587_0010068 | Ga0495587_0010068_2610_3428 | 255 |
| 66 | 3300046642 | Ga0495634_0037331 | Ga0495634_0037331_1806_2624 | 255 |
| 67 | 3300046675 | Ga0495657_0147602 | Ga0495657_0147602_236_1054 | 255 |
| 68 | 3300046678 | Ga0495599_0019308 | Ga0495599_0019308_2501_3319 | 255 |
| 69 | 3300046679 | Ga0495623_0114880 | Ga0495623_0114880_263_1081 | 255 |
| 70 | 3300047322 | Ga0495680_0121383 | Ga0495680_0121383_682_1500 | 255 |
| 71 | 3300005467 | Ga0070706_100052273 | Ga0070706_1000522732 | 256 |
| 72 | 3300005518 | Ga0070699_100555738 | Ga0070699_1005557381 | 256 |
| 73 | 3300006844 | Ga0075428_100019022 | Ga0075428_1000190222 | 256 |
| 74 | 3300006880 | Ga0075429_100034828 | Ga0075429_1000348282 | 256 |
| 75 | 3300009094 | Ga0111539_10942083 | Ga0111539_109420831 | 256 |
| 76 | 3300009147 | Ga0114129_10064062 | Ga0114129_100640623 | 256 |
| 77 | 3300025910 | Ga0207684_10034651 | Ga0207684_100346512 | 256 |
| 78 | 3300046511 | Ga0495608_0300039 | Ga0495608_0300039_131_958 | 256 |
| 79 | 3300047317 | Ga0495604_0409617 | Ga0495604_0409617_46_858 | 256 |
| 80 | 3300050507 | nmdc:mga05p37_50937_c1 | nmdc:mga05p37_50937_c1_927_1721 | 256 |
| 81 | 3300050508 | nmdc:mga09592_3477_c1 | nmdc:mga09592_3477_c1_3505_4299 | 256 |
| 82 | 3300050510 | nmdc:mga06r32_24008_c1 | nmdc:mga06r32_24008_c1_1953_2747 | 256 |
| 83 | 3300049588 | Ga0501072_0314803 | Ga0501072_0314803_388_1224 | 257 |
| 84 | 3300006163 | Ga0070715_10219092 | Ga0070715_102190921 | 259 |
| 85 | 3300014325 | Ga0163163_10028280 | Ga0163163_100282806 | 260 |
| 86 | 3300009098 | Ga0105245_10366376 | Ga0105245_103663762 | 261 |
| 87 | 3300009545 | Ga0105237_10172896 | Ga0105237_101728962 | 261 |
| 88 | 3300013307 | Ga0157372_10009333 | Ga0157372_100093335 | 261 |
| 89 | 3300013307 | Ga0157372_10017493 | Ga0157372_100174935 | 261 |
| 90 | 3300004803 | Ga0058862_12082813 | Ga0058862_120828131 | 262 |
| 91 | 3300005436 | Ga0070713_100121962 | Ga0070713_1001219623 | 262 |
| 92 | 3300020078 | Ga0206352_10119627 | Ga0206352_101196271 | 262 |
| 93 | 3300025912 | Ga0207707_10124467 | Ga0207707_101244672 | 262 |
| 94 | 3300025913 | Ga0207695_10002047 | Ga0207695_100020478 | 262 |
| 95 | 3300025914 | Ga0207671_10005439 | Ga0207671_100054393 | 262 |
| 96 | 3300035086 | Ga0373934_0147594 | Ga0373934_0147594_49_873 | 262 |
| 97 | 3300035118 | Ga0373954_0036574 | Ga0373954_0036574_568_1395 | 263 |
| 98 | 3300036401 | Ga0373937_0003789 | Ga0373937_0003789_1517_2344 | 263 |
| 99 | 3300053077 | Ga0495601_0203820 | Ga0495601_0203820_123_950 | 263 |
| 100 | 3300005467 | Ga0070706_100095732 | Ga0070706_1000957322 | 264 |
| 101 | 3300005468 | Ga0070707_100119602 | Ga0070707_1001196022 | 264 |
| 102 | 3300025910 | Ga0207684_10046869 | Ga0207684_100468691 | 264 |
| 103 | 3300025922 | Ga0207646_10151552 | Ga0207646_101515522 | 264 |
| 104 | 3300035111 | Ga0373923_0067055 | Ga0373923_0067055_30_839 | 264 |
| 105 | 3300035725 | Ga0373947_0021579 | Ga0373947_0021579_1028_1837 | 264 |
| 106 | 3300036401 | Ga0373937_0069046 | Ga0373937_0069046_811_1647 | 264 |
| 107 | 3300037068 | Ga0373925_0115891 | Ga0373925_0115891_404_1240 | 264 |
| 108 | 3300045976 | Ga0466967_0693629 | Ga0466967_0693629_132_971 | 264 |
| 109 | 3300013104 | Ga0157370_10610799 | Ga0157370_106107992 | 265 |
| 110 | 3300013306 | Ga0163162_10065605 | Ga0163162_100656053 | 265 |
| 111 | 3300013308 | Ga0157375_10842893 | Ga0157375_108428931 | 265 |
| 112 | 3300014325 | Ga0163163_10106215 | Ga0163163_101062152 | 265 |
| 113 | 3300047444 | Ga0495675_0113247 | Ga0495675_0113247_502_1356 | 265 |
| 114 | 3300009098 | Ga0105245_10037810 | Ga0105245_100378101 | 266 |
| 115 | 3300009177 | Ga0105248_10049136 | Ga0105248_100491362 | 266 |
| 116 | 3300009551 | Ga0105238_10001942 | Ga0105238_1000194217 | 266 |
| 117 | 3300009551 | Ga0105238_10018770 | Ga0105238_100187701 | 266 |
| 118 | 3300009553 | Ga0105249_10074912 | Ga0105249_100749121 | 266 |
| 119 | 3300013308 | Ga0157375_10003364 | Ga0157375_1000336411 | 266 |
| 120 | 3300046543 | Ga0495645_0030095 | Ga0495645_0030095_1269_2114 | 267 |
| 121 | 3300046559 | Ga0495667_0010878 | Ga0495667_0010878_1721_2566 | 267 |
| 122 | 3300047319 | Ga0495674_0003092 | Ga0495674_0003092_1575_2420 | 267 |
| 123 | 3300047444 | Ga0495675_0028800 | Ga0495675_0028800_2446_3291 | 267 |
| 124 | 3300047471 | Ga0495684_0076882 | Ga0495684_0076882_192_1037 | 267 |
| 125 | 3300006028 | Ga0070717_10291577 | Ga0070717_102915772 | 268 |
| 126 | 3300025939 | Ga0207665_10160780 | Ga0207665_101607802 | 268 |
| 127 | 3300009098 | Ga0105245_10041303 | Ga0105245_100413034 | 269 |
| 128 | 3300025927 | Ga0207687_10072108 | Ga0207687_100721082 | 269 |
| 129 | 3300048907 | Ga0496104_0402959 | Ga0496104_0402959_404_1249 | 269 |
| 130 | 3300025914 | Ga0207671_10036712 | Ga0207671_100367122 | 270 |
| 131 | 3300005445 | Ga0070708_100102316 | Ga0070708_1001023162 | 271 |
| 132 | 3300005467 | Ga0070706_100023384 | Ga0070706_1000233845 | 271 |
| 133 | 3300005468 | Ga0070707_100015361 | Ga0070707_1000153613 | 271 |
| 134 | 3300025922 | Ga0207646_10172144 | Ga0207646_101721442 | 271 |
| 135 | 3300037471 | Ga0395905_0160782 | Ga0395905_0160782_996_1838 | 271 |
| 136 | 3300005329 | Ga0070683_100070667 | Ga0070683_1000706673 | 272 |
| 137 | 3300005339 | Ga0070660_100027432 | Ga0070660_1000274325 | 272 |
| 138 | 3300005345 | Ga0070692_10009978 | Ga0070692_100099783 | 272 |
| 139 | 3300005367 | Ga0070667_100455175 | Ga0070667_1004551751 | 272 |
| 140 | 3300005518 | Ga0070699_100107894 | Ga0070699_1001078942 | 272 |
| 141 | 3300005535 | Ga0070684_100142270 | Ga0070684_1001422702 | 272 |
| 142 | 3300005563 | Ga0068855_100317677 | Ga0068855_1003176773 | 272 |
| 143 | 3300005578 | Ga0068854_100049872 | Ga0068854_1000498723 | 272 |
| 144 | 3300006237 | Ga0097621_100172421 | Ga0097621_1001724212 | 272 |
| 145 | 3300006358 | Ga0068871_100178922 | Ga0068871_1001789223 | 272 |
| 146 | 3300025924 | Ga0207694_10010202 | Ga0207694_100102023 | 272 |
| 147 | 3300025927 | Ga0207687_10192533 | Ga0207687_101925332 | 272 |
| 148 | 3300025929 | Ga0207664_10009150 | Ga0207664_100091503 | 272 |
| 149 | 3300025934 | Ga0207686_10134703 | Ga0207686_101347032 | 272 |
| 150 | 3300025981 | Ga0207640_10106532 | Ga0207640_101065321 | 272 |
| 151 | 3300025986 | Ga0207658_10209097 | Ga0207658_102090973 | 272 |
| 152 | 3300026035 | Ga0207703_10102535 | Ga0207703_101025352 | 272 |
| 153 | 3300026078 | Ga0207702_10269792 | Ga0207702_102697921 | 272 |
| 154 | 3300026116 | Ga0207674_10165627 | Ga0207674_101656272 | 272 |
| 155 | 3300026121 | Ga0207683_10303267 | Ga0207683_103032672 | 272 |
| 156 | 3300005329 | Ga0070683_100394635 | Ga0070683_1003946351 | 273 |
| 157 | 3300005435 | Ga0070714_100553726 | Ga0070714_1005537261 | 273 |
| 158 | 3300009093 | Ga0105240_10212173 | Ga0105240_102121732 | 273 |
| 159 | 3300025929 | Ga0207664_10474965 | Ga0207664_104749651 | 273 |
| 160 | 3300025944 | Ga0207661_10398252 | Ga0207661_103982521 | 273 |
| 161 | 3300025949 | Ga0207667_10434614 | Ga0207667_104346142 | 273 |
| 162 | 3300059506 | Ga0587085_018954 | Ga0587085_018954_11_886 | 273 |
| 163 | 3300005329 | Ga0070683_100289365 | Ga0070683_1002893652 | 274 |
| 164 | 3300005439 | Ga0070711_100281153 | Ga0070711_1002811532 | 274 |
| 165 | 3300005467 | Ga0070706_100382105 | Ga0070706_1003821052 | 274 |
| 166 | 3300005535 | Ga0070684_100091217 | Ga0070684_1000912173 | 274 |
| 167 | 3300005539 | Ga0068853_100343478 | Ga0068853_1003434781 | 274 |
| 168 | 3300005547 | Ga0070693_100031866 | Ga0070693_1000318662 | 274 |
| 169 | 3300005577 | Ga0068857_100012408 | Ga0068857_1000124086 | 274 |
| 170 | 3300005614 | Ga0068856_100218840 | Ga0068856_1002188402 | 274 |
| 171 | 3300005616 | Ga0068852_100549318 | Ga0068852_1005493181 | 274 |
| 172 | 3300005834 | Ga0068851_10145164 | Ga0068851_101451641 | 274 |
| 173 | 3300005841 | Ga0068863_100337557 | Ga0068863_1003375572 | 274 |
| 174 | 3300005842 | Ga0068858_100005915 | Ga0068858_1000059154 | 274 |
| 175 | 3300006028 | Ga0070717_10373492 | Ga0070717_103734921 | 274 |
| 176 | 3300006175 | Ga0070712_100109991 | Ga0070712_1001099912 | 274 |
| 177 | 3300006237 | Ga0097621_100024399 | Ga0097621_1000243993 | 274 |
| 178 | 3300006358 | Ga0068871_100013032 | Ga0068871_1000130323 | 274 |
| 179 | 3300013308 | Ga0157375_10599521 | Ga0157375_105995212 | 274 |
| 180 | 3300014325 | Ga0163163_10053514 | Ga0163163_100535143 | 274 |
| 181 | 3300025910 | Ga0207684_10491528 | Ga0207684_104915281 | 274 |
| 182 | 3300025915 | Ga0207693_10031221 | Ga0207693_100312214 | 274 |
| 183 | 3300025916 | Ga0207663_10267659 | Ga0207663_102676592 | 274 |
| 184 | 3300025922 | Ga0207646_10066095 | Ga0207646_100660953 | 274 |
| 185 | 3300025924 | Ga0207694_10001557 | Ga0207694_1000155719 | 274 |
| 186 | 3300025924 | Ga0207694_10097898 | Ga0207694_100978982 | 274 |
| 187 | 3300025927 | Ga0207687_10000237 | Ga0207687_100002373 | 274 |
| 188 | 3300025941 | Ga0207711_10002756 | Ga0207711_100027564 | 274 |
| 189 | 3300025944 | Ga0207661_10033590 | Ga0207661_100335903 | 274 |
| 190 | 3300025961 | Ga0207712_10102944 | Ga0207712_101029442 | 274 |
| 191 | 3300026035 | Ga0207703_10070084 | Ga0207703_100700843 | 274 |
| 192 | 3300026078 | Ga0207702_10470813 | Ga0207702_104708131 | 274 |
| 193 | 3300026116 | Ga0207674_10000852 | Ga0207674_100008524 | 274 |
| 194 | 3300026142 | Ga0207698_10493591 | Ga0207698_104935911 | 274 |
| 195 | 3300035695 | Ga0373927_0011082 | Ga0373927_0011082_435_1355 | 274 |
| 196 | 3300035725 | Ga0373947_0001079 | Ga0373947_0001079_6603_7523 | 274 |
| 197 | 3300037068 | Ga0373925_0003461 | Ga0373925_0003461_343_1263 | 274 |
| 198 | 3300046531 | Ga0495665_0219405 | Ga0495665_0219405_47_967 | 274 |
| 199 | 3300046690 | Ga0495624_0037200 | Ga0495624_0037200_693_1613 | 274 |
| 200 | 3300005436 | Ga0070713_100018598 | Ga0070713_1000185984 | 275 |
| 201 | 3300005518 | Ga0070699_100207920 | Ga0070699_1002079202 | 275 |
| 202 | 3300006028 | Ga0070717_10150499 | Ga0070717_101504991 | 275 |
| 203 | 3300006175 | Ga0070712_100140025 | Ga0070712_1001400252 | 275 |
| 204 | 3300006847 | Ga0075431_100510632 | Ga0075431_1005106321 | 275 |
| 205 | 3300009177 | Ga0105248_10689255 | Ga0105248_106892551 | 275 |
| 206 | 3300025913 | Ga0207695_10062531 | Ga0207695_100625313 | 275 |
| 207 | 3300025928 | Ga0207700_10025821 | Ga0207700_100258211 | 275 |
| 208 | 3300046477 | Ga0495664_0004981 | Ga0495664_0004981_940_1812 | 275 |
| 209 | 3300046535 | Ga0495586_0037937 | Ga0495586_0037937_1519_2400 | 275 |
| 210 | 3300047319 | Ga0495674_0012530 | Ga0495674_0012530_486_1367 | 275 |
| 211 | 3300047319 | Ga0495674_0024093 | Ga0495674_0024093_2658_3530 | 275 |
| 212 | 3300005458 | Ga0070681_10474691 | Ga0070681_104746911 | 276 |
| 213 | 3300005468 | Ga0070707_100358894 | Ga0070707_1003588941 | 276 |
| 214 | 3300005471 | Ga0070698_100068419 | Ga0070698_1000684193 | 276 |
| 215 | 3300006852 | Ga0075433_10504803 | Ga0075433_105048031 | 276 |
| 216 | 3300006881 | Ga0068865_100018087 | Ga0068865_1000180874 | 276 |
| 217 | 3300006914 | Ga0075436_100147488 | Ga0075436_1001474882 | 276 |
| 218 | 3300007076 | Ga0075435_100209451 | Ga0075435_1002094512 | 276 |
| 219 | 3300009093 | Ga0105240_10111731 | Ga0105240_101117312 | 276 |
| 220 | 3300025913 | Ga0207695_10090234 | Ga0207695_100902342 | 276 |
| 221 | 3300048907 | Ga0496104_0128795 | Ga0496104_0128795_231_1094 | 276 |
| 222 | 3300048909 | Ga0496106_0114418 | Ga0496106_0114418_107_970 | 276 |
| 223 | 3300050507 | nmdc:mga05p37_236241_c1 | nmdc:mga05p37_236241_c1_561_1448 | 276 |
| 224 | 3300050512 | nmdc:mga0n895_119142_c1 | nmdc:mga0n895_119142_c1_661_1548 | 276 |
| 225 | 3300050513 | nmdc:mga0rr50_52726_c1 | nmdc:mga0rr50_52726_c1_1093_1980 | 276 |
| 226 | 3300050514 | nmdc:mga08x19_946_c1 | nmdc:mga08x19_946_c1_633_1520 | 276 |
| 227 | 3300050515 | nmdc:mga0a205_1360_c1 | nmdc:mga0a205_1360_c1_656_1543 | 276 |
| 228 | 3300005355 | Ga0070671_100309194 | Ga0070671_1003091942 | 277 |
| 229 | 3300009101 | Ga0105247_10045579 | Ga0105247_100455792 | 277 |
| 230 | 3300009177 | Ga0105248_10859514 | Ga0105248_108595141 | 277 |
| 231 | 3300009551 | Ga0105238_10104968 | Ga0105238_101049683 | 277 |
| 232 | 3300035117 | Ga0373953_0062913 | Ga0373953_0062913_131_1015 | 277 |
| 233 | 3300035724 | Ga0373933_0161884 | Ga0373933_0161884_123_995 | 277 |
| 234 | 3300004799 | Ga0058863_11918874 | Ga0058863_119188741 | 278 |
| 235 | 3300004800 | Ga0058861_10691150 | Ga0058861_106911501 | 278 |
| 236 | 3300005364 | Ga0070673_100410101 | Ga0070673_1004101011 | 278 |
| 237 | 3300025921 | Ga0207652_10287320 | Ga0207652_102873202 | 278 |
| 238 | 3300025929 | Ga0207664_10578174 | Ga0207664_105781741 | 278 |
| 239 | 3300005435 | Ga0070714_100000257 | Ga0070714_10000025737 | 279 |
| 240 | 3300005436 | Ga0070713_100003140 | Ga0070713_1000031409 | 279 |
| 241 | 3300005436 | Ga0070713_100249090 | Ga0070713_1002490901 | 279 |
| 242 | 3300005439 | Ga0070711_100024360 | Ga0070711_1000243603 | 279 |
| 243 | 3300005467 | Ga0070706_100557029 | Ga0070706_1005570292 | 279 |
| 244 | 3300006028 | Ga0070717_10028961 | Ga0070717_100289613 | 279 |
| 245 | 3300025928 | Ga0207700_10020108 | Ga0207700_100201083 | 279 |
| 246 | 3300025929 | Ga0207664_10010524 | Ga0207664_100105242 | 279 |
| 247 | 3300005467 | Ga0070706_100345899 | Ga0070706_1003458991 | 280 |
| 248 | 3300005468 | Ga0070707_100107583 | Ga0070707_1001075832 | 280 |
| 249 | 3300005536 | Ga0070697_100252152 | Ga0070697_1002521521 | 280 |
| 250 | 3300025910 | Ga0207684_10015732 | Ga0207684_100157324 | 280 |
| 251 | 3300025922 | Ga0207646_10320827 | Ga0207646_103208271 | 280 |
| 252 | 3300046543 | Ga0495645_0006325 | Ga0495645_0006325_1525_2424 | 280 |
| 253 | 3300059493 | Ga0587077_013275 | Ga0587077_013275_405_1298 | 280 |
| 254 | 3300059504 | Ga0587082_023152 | Ga0587082_023152_108_1001 | 280 |
| 255 | 3300005436 | Ga0070713_100182654 | Ga0070713_1001826542 | 281 |
| 256 | 3300006358 | Ga0068871_100387065 | Ga0068871_1003870651 | 281 |
| 257 | 3300025928 | Ga0207700_10349617 | Ga0207700_103496172 | 281 |
| 258 | 3300035692 | Ga0373935_0110433 | Ga0373935_0110433_869_1750 | 281 |
| 259 | 3300005327 | Ga0070658_10427563 | Ga0070658_104275632 | 282 |
| 260 | 3300005329 | Ga0070683_100027689 | Ga0070683_1000276894 | 282 |
| 261 | 3300005338 | Ga0068868_100026640 | Ga0068868_1000266402 | 282 |
| 262 | 3300005354 | Ga0070675_100341440 | Ga0070675_1003414401 | 282 |
| 263 | 3300005364 | Ga0070673_100137445 | Ga0070673_1001374451 | 282 |
| 264 | 3300005444 | Ga0070694_100160160 | Ga0070694_1001601602 | 282 |
| 265 | 3300005467 | Ga0070706_100030104 | Ga0070706_1000301046 | 282 |
| 266 | 3300005535 | Ga0070684_100075591 | Ga0070684_1000755913 | 282 |
| 267 | 3300005536 | Ga0070697_100190482 | Ga0070697_1001904822 | 282 |
| 268 | 3300005543 | Ga0070672_100201247 | Ga0070672_1002012472 | 282 |
| 269 | 3300005549 | Ga0070704_100154487 | Ga0070704_1001544872 | 282 |
| 270 | 3300005578 | Ga0068854_100031407 | Ga0068854_1000314073 | 282 |
| 271 | 3300005618 | Ga0068864_100285542 | Ga0068864_1002855421 | 282 |
| 272 | 3300006175 | Ga0070712_100061184 | Ga0070712_1000611843 | 282 |
| 273 | 3300006237 | Ga0097621_100114536 | Ga0097621_1001145362 | 282 |
| 274 | 3300006358 | Ga0068871_100089546 | Ga0068871_1000895462 | 282 |
| 275 | 3300006871 | Ga0075434_100581693 | Ga0075434_1005816931 | 282 |
| 276 | 3300006914 | Ga0075436_100027764 | Ga0075436_1000277645 | 282 |
| 277 | 3300025910 | Ga0207684_10025700 | Ga0207684_100257006 | 282 |
| 278 | 3300025915 | Ga0207693_10068619 | Ga0207693_100686191 | 282 |
| 279 | 3300026095 | Ga0207676_10408103 | Ga0207676_104081032 | 282 |
| 280 | 3300050514 | nmdc:mga08x19_76860_c1 | nmdc:mga08x19_76860_c1_1127_1999 | 282 |
| 281 | 3300013296 | Ga0157374_10021251 | Ga0157374_100212511 | 283 |
| 282 | 3300035695 | Ga0373927_0001819 | Ga0373927_0001819_9526_10401 | 283 |
| 283 | 3300048913 | Ga0496110_0072935 | Ga0496110_0072935_767_1657 | 283 |
| 284 | 3300048917 | Ga0496114_0498770 | Ga0496114_0498770_16_906 | 283 |
| 285 | 3300005435 | Ga0070714_100003579 | Ga0070714_1000035796 | 284 |
| 286 | 3300005614 | Ga0068856_100055874 | Ga0068856_1000558742 | 284 |
| 287 | 3300025916 | Ga0207663_10109166 | Ga0207663_101091662 | 285 |
| 288 | 3300025925 | Ga0207650_10177051 | Ga0207650_101770512 | 285 |
| 289 | 3300005458 | Ga0070681_10047436 | Ga0070681_100474363 | 286 |
| 290 | 3300005841 | Ga0068863_100156921 | Ga0068863_1001569212 | 286 |
| 291 | 3300009177 | Ga0105248_10820653 | Ga0105248_108206531 | 286 |
| 292 | 3300014325 | Ga0163163_10135229 | Ga0163163_101352292 | 286 |
| 293 | 3300026088 | Ga0207641_10134834 | Ga0207641_101348341 | 286 |
| 294 | 3300005467 | Ga0070706_100001433 | Ga0070706_10000143327 | 287 |
| 295 | 3300005536 | Ga0070697_100001261 | Ga0070697_10000126121 | 287 |
| 296 | 3300025910 | Ga0207684_10000354 | Ga0207684_1000035441 | 287 |
| 297 | 3300035086 | Ga0373934_0001634 | Ga0373934_0001634_4165_5103 | 288 |
| 298 | 3300035117 | Ga0373953_0011840 | Ga0373953_0011840_277_1215 | 288 |
| 299 | 3300035118 | Ga0373954_0005364 | Ga0373954_0005364_2867_3805 | 288 |
| 300 | 3300035119 | Ga0373956_0089647 | Ga0373956_0089647_466_1404 | 288 |
| 301 | 3300035120 | Ga0373957_0062933 | Ga0373957_0062933_210_1148 | 288 |
| 302 | 3300035172 | Ga0373955_0007095 | Ga0373955_0007095_3402_4340 | 288 |
| 303 | 3300035410 | Ga0373924_0071634 | Ga0373924_0071634_72_1010 | 288 |
| 304 | 3300035724 | Ga0373933_0268218 | Ga0373933_0268218_49_987 | 288 |
| 305 | 3300036401 | Ga0373937_0048310 | Ga0373937_0048310_2361_3299 | 288 |
| 306 | 3300046462 | Ga0495651_0176702 | Ga0495651_0176702_171_1109 | 288 |
| 307 | 3300046689 | Ga0495613_0122111 | Ga0495613_0122111_234_1172 | 288 |
| 308 | 3300004798 | Ga0058859_11786207 | Ga0058859_117862072 | 292 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ci7-assembly1.cif.gz_B | the crystal structure of the cysteine protease and lectin-like domains of cwp84, a surface layer associated protein of clostridium difficile | 0.5665 | 51 | 264 |
| 7tok-assembly2.cif.gz_B | crystal structure of the cbm domain of carbohydrate esterase fjoacxe | 0.4232 | 47 | 265 |
| 7tok-assembly2.cif.gz_B | crystal structure of the cbm domain of carbohydrate esterase fjoacxe | 0.4206 | 47 | 265 |
| 6ooy-assembly1.cif.gz_A | asymmetric htnf-alpha | 0.3653 | 56 | 205 |
| 6x83-assembly1.cif.gz_C | crystal structure of tnfalpha with fragment compound 6 | 0.3608 | 55 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4I0M2_138_767_1.20.58.390 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain | 0.5563 | 129 | 181 | 1.20.58.390 |
| af_Q965Y9_1501_1664_2.60.120.820 | Mainly Beta;Sandwich;Jelly Rolls;PHR domain | 0.4498 | 28 | 266 | 2.60.120.820 |
| af_Q965Y9_1501_1664_2.60.120.820 | Mainly Beta;Sandwich;Jelly Rolls;PHR domain | 0.437 | 28 | 266 | 2.60.120.820 |
| af_G5EEZ6_455_718_2.40.10.10 | Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases | 0.4104 | 52 | 212 | 2.40.10.10 |
| af_Q9ESK3_500_644_2.60.120.380 | Mainly Beta;Sandwich;Jelly Rolls; | 0.4032 | 23 | 205 | 2.60.120.380 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7CL95-F1-model_v4 | PEP-CTERM sorting domain-containing protein | 0.9354 | 16 | 265 |
|
| AF-A0A2V5TFI7-F1-model_v4 | PEP-CTERM sorting domain-containing protein | 0.9164 | 50 | 264 |
|
| AF-A0A2V8D2T5-F1-model_v4 | Uncharacterized protein | 0.9112 | 48 | 266 |
|
| AF-A0A2V6PDH5-F1-model_v4 | Uncharacterized protein | 0.9055 | 38 | 265 |
|
| AF-A0A2V7CL95-F1-model_v4 | PEP-CTERM sorting domain-containing protein | 0.9019 | 16 | 265 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar