F399533

General Info

Members Datasets Scaffolds Average Seq Length
308 193 616 165

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100033354|Ga0070680_1000333542
Length 178
Sequence MSQNSGPRVYLVAAVAANGVIGAGGKLPWHIPEELKHFKRLTLGHPVIMGRRTWESLKGPLPQRENIVVTRTPGYHAPGAAVASSLGGALALCAGEPVAFVIGGTRLFEESLPLADGMVLTEIQRDYAGDTWFPKWDRSQWRESQREAHTADDGTRFDFVLYERKRPESRPCEGGDPV

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
112 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
113 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
114 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
115 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
116 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
117 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
118 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
119 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
120 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
121 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
122 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
123 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
124 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
175 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
176 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 0.32
Rhizosphere 99.03
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100033354 3300005336 Bacteria 4149
2 Ga0070676_10579186 3300005328 Bacteria 807
3 Ga0070683_100088648 3300005329 Bacteria 2903
4 Ga0068869_100049073 3300005334 Bacteria 3055
5 Ga0070680_100081321 3300005336 Bacteria 2673
6 Ga0070689_100159513 3300005340 Bacteria 1822
7 Ga0070689_100316299 3300005340 Bacteria 1302
8 Ga0070689_100706153 3300005340 Bacteria 881
9 Ga0070691_10095923 3300005341 Bacteria 1468
10 Ga0070691_10328191 3300005341 Bacteria 844
11 Ga0070687_100296733 3300005343 Bacteria 1024
12 Ga0070692_10048342 3300005345 Bacteria 2204
13 Ga0070692_10093508 3300005345 Bacteria 1637
14 Ga0070668_100047783 3300005347 Bacteria 3291
15 Ga0070669_100028693 3300005353 Bacteria 4007
16 Ga0070675_100038670 3300005354 Bacteria 3889
17 Ga0070674_100071276 3300005356 Bacteria 2457
18 Ga0070701_10195059 3300005438 Bacteria 1194
19 Ga0070701_10296232 3300005438 Bacteria 993
20 Ga0070711_100665870 3300005439 Bacteria 874
21 Ga0070705_100034018 3300005440 Bacteria 2845
22 Ga0070700_100027627 3300005441 Bacteria 3366
23 Ga0070700_100226283 3300005441 Bacteria 1328
24 Ga0070700_100827799 3300005441 Bacteria 748
25 Ga0070694_100005632 3300005444 Bacteria 7591
26 Ga0070694_100066293 3300005444 Bacteria 2476
27 Ga0070694_100247356 3300005444 Bacteria 1348
28 Ga0070694_100322735 3300005444 Bacteria 1189
29 Ga0070681_10162249 3300005458 Bacteria 2159
30 Ga0070681_10906900 3300005458 Bacteria 800
31 Ga0068867_100000411 3300005459 Bacteria 28681
32 Ga0068867_101085693 3300005459 Bacteria 730
33 Ga0068867_101169695 3300005459 Bacteria 705
34 Ga0070707_100323743 3300005468 Bacteria 1498
35 Ga0070707_100485492 3300005468 Bacteria 1197
36 Ga0070699_100008311 3300005518 Bacteria 9003
37 Ga0070684_100050828 3300005535 Bacteria 3601
38 Ga0070697_100001028 3300005536 Bacteria 21073
39 Ga0070697_100363710 3300005536 Bacteria 1251
40 Ga0070672_100278858 3300005543 Bacteria 1413
41 Ga0070686_100057736 3300005544 Bacteria 2494
42 Ga0070695_101033894 3300005545 Bacteria 669
43 Ga0070695_101204491 3300005545 Bacteria 623
44 Ga0070696_100054292 3300005546 Bacteria 2791
45 Ga0070696_100302770 3300005546 Bacteria 1225
46 Ga0070696_100455212 3300005546 Bacteria 1010
47 Ga0070693_100253408 3300005547 Bacteria 1168
48 Ga0070704_100002071 3300005549 Bacteria 11142
49 Ga0070704_100125810 3300005549 Bacteria 1977
50 Ga0070704_100505736 3300005549 Bacteria 1049
51 Ga0070704_101386154 3300005549 Bacteria 645
52 Ga0068857_100270435 3300005577 Bacteria 1562
53 Ga0070702_100136120 3300005615 Bacteria 1559
54 Ga0068859_100094561 3300005617 Bacteria 3041
55 Ga0068859_100464497 3300005617 Bacteria 1361
56 Ga0068859_100796239 3300005617 Bacteria 1033
57 Ga0068859_101381013 3300005617 Bacteria 777
58 Ga0068866_10119494 3300005718 Bacteria 1483
59 Ga0068861_100023514 3300005719 Bacteria 4445
60 Ga0068870_10050664 3300005840 Bacteria 2195
61 Ga0068858_100076334 3300005842 Bacteria 3112
62 Ga0068860_100505704 3300005843 Bacteria 1207
63 Ga0068862_100038160 3300005844 Bacteria 4073
64 Ga0068862_100350511 3300005844 Bacteria 1369
65 Ga0068862_100373802 3300005844 Bacteria 1327
66 Ga0070716_100065819 3300006173 Bacteria 2112
67 Ga0068871_100001395 3300006358 Bacteria 16182
68 Ga0075428_100119638 3300006844 Bacteria 2867
69 Ga0075428_100722688 3300006844 Bacteria 1060
70 Ga0075430_100014188 3300006846 Bacteria 6791
71 Ga0075430_100221224 3300006846 Bacteria 1571
72 Ga0075431_100089158 3300006847 Bacteria 3184
73 Ga0075431_100315438 3300006847 Bacteria 1577
74 Ga0075431_101085030 3300006847 Bacteria 765
75 Ga0075433_10771475 3300006852 Bacteria 841
76 Ga0075434_100428315 3300006871 Bacteria 1344
77 Ga0075434_100872098 3300006871 Bacteria 915
78 Ga0075429_100176733 3300006880 Bacteria 1871
79 Ga0075429_101144531 3300006880 Unclassified 679
80 Ga0068865_100007141 3300006881 Bacteria 6857
81 Ga0068865_100710946 3300006881 Bacteria 859
82 Ga0075436_100000442 3300006914 Bacteria 26532
83 Ga0097620_100094559 3300006931 Bacteria 3041
84 Ga0097620_100464478 3300006931 Bacteria 1361
85 Ga0097620_100796367 3300006931 Bacteria 1033
86 Ga0097620_101380879 3300006931 Bacteria 777
87 Ga0099794_10014911 3300007265 Bacteria 3417
88 Ga0099794_10028430 3300007265 Bacteria 2602
89 Ga0111539_10035844 3300009094 Bacteria 6005
90 Ga0111539_10102351 3300009094 Bacteria 3361
91 Ga0111539_10794778 3300009094 Bacteria 1101
92 Ga0105245_11057110 3300009098 Bacteria 857
93 Ga0114129_10076831 3300009147 Bacteria 4648
94 Ga0114129_10257980 3300009147 Bacteria 2338
95 Ga0114129_12352946 3300009147 Bacteria 639
96 Ga0105243_10003588 3300009148 Bacteria 12522
97 Ga0105242_10675323 3300009176 Bacteria 1007
98 Ga0105242_10740998 3300009176 Bacteria 966
99 Ga0105249_10001866 3300009553 Bacteria 18286
100 Ga0105246_11055816 3300011119 Bacteria 739
101 Ga0157380_10032203 3300014326 Bacteria 4031
102 Ga0157380_11139983 3300014326 Bacteria 821
103 Ga0157377_10031163 3300014745 Bacteria 2895
104 Ga0157379_10480222 3300014968 Bacteria 1150
105 Ga0157376_10624996 3300014969 Bacteria 1075
106 Ga0207653_10097579 3300025885 Bacteria 1036
107 Ga0207642_10371260 3300025899 Bacteria 849
108 Ga0207688_10014763 3300025901 Bacteria 4239
109 Ga0207645_10023927 3300025907 Bacteria 3964
110 Ga0207645_10063259 3300025907 Bacteria 2364
111 Ga0207643_10011905 3300025908 Bacteria 4696
112 Ga0207707_10131708 3300025912 Bacteria 2187
113 Ga0207663_10394134 3300025916 Bacteria 1057
114 Ga0207660_10072227 3300025917 Bacteria 2513
115 Ga0207662_10079374 3300025918 Bacteria 1999
116 Ga0207662_10424474 3300025918 Bacteria 905
117 Ga0207659_10011033 3300025926 Bacteria 5695
118 Ga0207706_10070753 3300025933 Bacteria 3068
119 Ga0207704_10112790 3300025938 Bacteria 1842
120 Ga0207691_10254688 3300025940 Bacteria 1514
121 Ga0207689_10063152 3300025942 Bacteria 3046
122 Ga0207661_10039612 3300025944 Bacteria 3700
123 Ga0207651_10310749 3300025960 Bacteria 1314
124 Ga0207668_10030515 3300025972 Bacteria 3543
125 Ga0207677_10390944 3300026023 Bacteria 1177
126 Ga0207708_10072988 3300026075 Bacteria 2630
127 Ga0207708_10208102 3300026075 Bacteria 1563
128 Ga0207708_10598564 3300026075 Bacteria 934
129 Ga0207648_10000711 3300026089 Bacteria 37350
130 Ga0207648_10402583 3300026089 Bacteria 1240
131 Ga0207648_10696335 3300026089 Bacteria 941
132 Ga0207648_10953212 3300026089 Unclassified 803
133 Ga0207674_10072220 3300026116 Bacteria 3467
134 Ga0207675_100020559 3300026118 Bacteria 6153
135 Ga0207683_11860019 3300026121 Bacteria 551
136 Ga0209967_1001970 3300027364 Bacteria 2647
137 Ga0209967_1004798 3300027364 Bacteria 1808
138 Ga0209967_1012754 3300027364 Bacteria 1188
139 Ga0209967_1038416 3300027364 Bacteria 725
140 Ga0209981_1003012 3300027378 Bacteria 2168
141 Ga0210000_1001670 3300027462 Bacteria 3129
142 Ga0210000_1022891 3300027462 Bacteria 960
143 Ga0209968_1028927 3300027526 Bacteria 922
144 Ga0209968_1051520 3300027526 Bacteria 716
145 Ga0209999_1010899 3300027543 Bacteria 1644
146 Ga0209983_1017044 3300027665 Bacteria 1501
147 Ga0209983_1155960 3300027665 Bacteria 523
148 Ga0209588_1096398 3300027671 Bacteria 953
149 Ga0209971_1007435 3300027682 Bacteria 2600
150 Ga0209966_1005973 3300027695 Bacteria 2105
151 Ga0209974_10020437 3300027876 Bacteria 2194
152 Ga0207428_10086474 3300027907 Bacteria 2440
153 Ga0207428_10109012 3300027907 Bacteria 2132
154 Ga0207428_10729090 3300027907 Bacteria 707
155 Ga0268265_10001393 3300028380 Bacteria 20490
156 Ga0268265_10084188 3300028380 Bacteria 2520
157 Ga0268264_10631362 3300028381 Bacteria 1058
158 Ga0307408_100014562 3300031548 Unclassified 5226
159 Ga0307408_100298646 3300031548 Bacteria 1348
160 Ga0307408_100438878 3300031548 Bacteria 1130
161 Ga0307408_101042327 3300031548 Bacteria 756
162 Ga0307412_11024118 3300031911 Bacteria 731
163 Ga0307416_100106431 3300032002 Bacteria 2458
164 Ga0307416_100222455 3300032002 Bacteria 1812
165 Ga0307416_100461743 3300032002 Bacteria 1325
166 Ga0307416_100624980 3300032002 Bacteria 1159
167 Ga0307416_100877083 3300032002 Bacteria 996
168 Ga0307411_10141098 3300032005 Bacteria 1777
169 Ga0307411_10785831 3300032005 Bacteria 837
170 Ga0307415_100723481 3300032126 Bacteria 901
171 Ga0373934_0197298 3300035086 Bacteria 828
172 Ga0373923_0175571 3300035111 Bacteria 983
173 Ga0373941_0020261 3300035115 Bacteria 1862
174 Ga0373954_0142371 3300035118 Bacteria 1170
175 Ga0373955_0009908 3300035172 Bacteria 4485
176 Ga0373961_0017796 3300035241 Bacteria 1849
177 Ga0373933_0016522 3300035724 Bacteria 4129
178 Ga0373937_0058821 3300036401 Bacteria 3531
179 Ga0439453_0017087 3300041408 Bacteria 1271
180 Ga0439461_0019686 3300041410 Bacteria 1331
181 Ga0451807_1817773 3300041486 Bacteria 1959
182 Ga0451845_0033753 3300041501 Bacteria 565
183 Ga0439441_000607 3300042001 Bacteria 4034
184 Ga0439441_031776 3300042001 Bacteria 1027
185 Ga0439443_003049 3300042003 Bacteria 2072
186 Ga0439451_015530 3300042009 Bacteria 1536
187 Ga0439456_015404 3300042013 Bacteria 1596
188 Ga0439446_0007983 3300042156 Bacteria 2796
189 Ga0439434_0000408 3300042435 Bacteria 12235
190 Ga0439434_0140319 3300042435 Bacteria 796
191 Ga0439435_0000029 3300042436 Bacteria 15789
192 Ga0439435_0000945 3300042436 Bacteria 5046
193 Ga0439435_0001117 3300042436 Bacteria 4783
194 Ga0439444_0000889 3300042437 Bacteria 3635
195 Ga0439444_0044583 3300042437 Bacteria 882
196 Ga0439460_0000350 3300042461 Bacteria 9685
197 Ga0450916_023284 3300042530 Bacteria 864
198 Ga0466964_0013915 3300044706 Bacteria 3056
199 Ga0466960_0305603 3300044901 Bacteria 897
200 Ga0451576_0833640 3300045051 Bacteria 968
201 Ga0466967_0000292 3300045976 Bacteria 22396
202 Ga0495592_0098675 3300046454 Bacteria 2084
203 Ga0495603_0709281 3300046455 Bacteria 575
204 Ga0495582_0156797 3300046473 Bacteria 1294
205 Ga0495662_0009776 3300046476 Bacteria 4712
206 Ga0495608_0014511 3300046511 Bacteria 5465
207 Ga0495618_0132288 3300046514 Bacteria 1596
208 Ga0495628_0012764 3300046516 Bacteria 7073
209 Ga0495666_0036533 3300046526 Bacteria 2393
210 Ga0495642_0100815 3300046528 Bacteria 1229
211 Ga0495642_0162024 3300046528 Bacteria 970
212 Ga0495652_0258593 3300046529 Bacteria 1286
213 Ga0495640_0023222 3300046533 Bacteria 4526
214 Ga0495586_0005346 3300046535 Bacteria 6868
215 Ga0495598_0084563 3300046537 Bacteria 1024
216 Ga0495634_0035341 3300046642 Bacteria 3423
217 Ga0495658_0044197 3300046683 Bacteria 2495
218 Ga0495669_0327291 3300046684 Bacteria 740
219 Ga0495613_0049945 3300046689 Bacteria 3086
220 Ga0495624_0109969 3300046690 Bacteria 1695
221 Ga0495600_0054832 3300046809 Bacteria 2604
222 Ga0495604_0107496 3300047317 Bacteria 2039
223 Ga0495636_0025470 3300047318 Bacteria 2402
224 Ga0495636_0350719 3300047318 Bacteria 697
225 Ga0495680_0000847 3300047322 Bacteria 33966
226 Ga0495593_0070655 3300047673 Bacteria 1814
227 Ga0501298_063880 3300049521 Bacteria 784
228 Ga0501031_0026800 3300049568 Bacteria 3757
229 Ga0501032_0038333 3300049569 Bacteria 3265
230 Ga0501033_0072470 3300049570 Bacteria 2529
231 Ga0501033_0192915 3300049570 Bacteria 1457
232 Ga0501036_0000184 3300049572 Bacteria 41502
233 Ga0501036_0049951 3300049572 Bacteria 3543
234 Ga0501036_0120463 3300049572 Bacteria 2216
235 Ga0501036_1030255 3300049572 Bacteria 673
236 Ga0501037_0076489 3300049573 Bacteria 2430
237 Ga0501037_0123672 3300049573 Bacteria 1858
238 Ga0501038_0001603 3300049574 Bacteria 20986
239 Ga0501038_0158074 3300049574 Bacteria 1844
240 Ga0501038_0172740 3300049574 Bacteria 1748
241 Ga0501039_0000053 3300049575 Bacteria 94861
242 Ga0501039_0410681 3300049575 Bacteria 1063
243 Ga0501040_0005735 3300049576 Bacteria 8031
244 Ga0501040_0016085 3300049576 Bacteria 4946
245 Ga0501040_0102602 3300049576 Bacteria 1996
246 Ga0501041_0000118 3300049577 Bacteria 33545
247 Ga0501041_0004901 3300049577 Bacteria 7774
248 Ga0501041_0070431 3300049577 Bacteria 2146
249 Ga0501041_0260385 3300049577 Bacteria 1091
250 Ga0501042_0000120 3300049578 Bacteria 33485
251 Ga0501042_0068280 3300049578 Bacteria 2542
252 Ga0501043_0104304 3300049579 Bacteria 2228
253 Ga0501046_0003828 3300049580 Bacteria 13767
254 Ga0501046_0090106 3300049580 Bacteria 2360
255 Ga0501046_0373586 3300049580 Bacteria 1033
256 Ga0501048_0004450 3300049582 Bacteria 10671
257 Ga0501048_0039531 3300049582 Bacteria 3384
258 Ga0501068_0024809 3300049584 Bacteria 3523
259 Ga0501070_0029679 3300049586 Bacteria 4583
260 Ga0501070_0971415 3300049586 Bacteria 660
261 Ga0501071_0032359 3300049587 Bacteria 3713
262 Ga0501071_0056102 3300049587 Bacteria 2845
263 Ga0501071_0133798 3300049587 Bacteria 1844
264 Ga0501072_0000147 3300049588 Bacteria 52765
265 Ga0501072_0121641 3300049588 Bacteria 2080
266 Ga0501072_0327605 3300049588 Bacteria 1217
267 Ga0501072_0753781 3300049588 Bacteria 764
268 Ga0501072_0775058 3300049588 Bacteria 752
269 Ga0501074_0048413 3300049590 Bacteria 3070
270 Ga0501075_0000662 3300049591 Bacteria 21182
271 Ga0501075_0042248 3300049591 Bacteria 3418
272 Ga0501075_0056737 3300049591 Bacteria 2949
273 Ga0501076_0000265 3300049592 Bacteria 32365
274 Ga0501076_0040591 3300049592 Bacteria 3658
275 Ga0501076_0475535 3300049592 Bacteria 1029
276 Ga0501076_0482101 3300049592 Bacteria 1022
277 Ga0501076_1053255 3300049592 Bacteria 670
278 Ga0501077_0004587 3300049593 Bacteria 8392
279 Ga0501077_0330721 3300049593 Bacteria 972
280 Ga0501209_146396 3300049656 Bacteria 710
281 Ga0501227_120751 3300049665 Bacteria 708
282 Ga0501233_111546 3300049668 Bacteria 732
283 Ga0501079_0000132 3300049741 Bacteria 40276
284 Ga0501079_0916790 3300049741 Bacteria 690
285 Ga0501080_0091871 3300049742 Bacteria 2819
286 Ga0501080_0092122 3300049742 Bacteria 2815
287 Ga0501081_0001294 3300049743 Bacteria 15236
288 Ga0501035_0088488 3300049822 Bacteria 2729
289 Ga0501045_0007702 3300049824 Bacteria 7492
290 Ga0501045_0154216 3300049824 Bacteria 1709
291 Ga0501045_0501621 3300049824 Bacteria 901
292 nmdc:mga05p37_133558_c1 3300050507 Bacteria 3044
293 nmdc:mga05p37_511962_c1 3300050507 Bacteria 1375
294 nmdc:mga0qj67_1067430_c1 3300050509 Bacteria 632
295 nmdc:mga0qj67_19709_c1 3300050509 Bacteria 5157
296 nmdc:mga0qj67_40968_c1 3300050509 Bacteria 3642
297 nmdc:mga06r32_34091_c1 3300050510 Bacteria 4799
298 nmdc:mga08y16_16781_c1 3300050511 Bacteria 7708
299 nmdc:mga08y16_328826_c1 3300050511 Bacteria 1573
300 nmdc:mga0n895_1177156_c1 3300050512 Bacteria 741
301 nmdc:mga08x19_81_c1 3300050514 Bacteria 87015
302 Ga0495601_0062284 3300053077 Bacteria 2369
303 Ga0500566_0251618 3300053094 Bacteria 859
304 Ga0501084_0000260 3300054114 Bacteria 39924
305 Ga0501084_0335561 3300054114 Bacteria 1277
306 Ga0590077_021942 3300059426 Bacteria 1361
307 Ga0501082_0005354 3300060353 Bacteria 11138
308 Ga0530510_0024623 3300061734 Bacteria 4297
309 Ga0070680_100033354
310 Ga0070676_10579186
311 Ga0070683_100088648
312 Ga0068869_100049073
313 Ga0070680_100081321
314 Ga0070689_100159513
315 Ga0070689_100316299
316 Ga0070689_100706153
317 Ga0070691_10095923
318 Ga0070691_10328191
319 Ga0070687_100296733
320 Ga0070692_10048342
321 Ga0070692_10093508
322 Ga0070668_100047783
323 Ga0070669_100028693
324 Ga0070675_100038670
325 Ga0070674_100071276
326 Ga0070701_10195059
327 Ga0070701_10296232
328 Ga0070711_100665870
329 Ga0070705_100034018
330 Ga0070700_100027627
331 Ga0070700_100226283
332 Ga0070700_100827799
333 Ga0070694_100005632
334 Ga0070694_100066293
335 Ga0070694_100247356
336 Ga0070694_100322735
337 Ga0070681_10162249
338 Ga0070681_10906900
339 Ga0068867_100000411
340 Ga0068867_101085693
341 Ga0068867_101169695
342 Ga0070707_100323743
343 Ga0070707_100485492
344 Ga0070699_100008311
345 Ga0070684_100050828
346 Ga0070697_100001028
347 Ga0070697_100363710
348 Ga0070672_100278858
349 Ga0070686_100057736
350 Ga0070695_101033894
351 Ga0070695_101204491
352 Ga0070696_100054292
353 Ga0070696_100302770
354 Ga0070696_100455212
355 Ga0070693_100253408
356 Ga0070704_100002071
357 Ga0070704_100125810
358 Ga0070704_100505736
359 Ga0070704_101386154
360 Ga0068857_100270435
361 Ga0070702_100136120
362 Ga0068859_100094561
363 Ga0068859_100464497
364 Ga0068859_100796239
365 Ga0068859_101381013
366 Ga0068866_10119494
367 Ga0068861_100023514
368 Ga0068870_10050664
369 Ga0068858_100076334
370 Ga0068860_100505704
371 Ga0068862_100038160
372 Ga0068862_100350511
373 Ga0068862_100373802
374 Ga0070716_100065819
375 Ga0068871_100001395
376 Ga0075428_100119638
377 Ga0075428_100722688
378 Ga0075430_100014188
379 Ga0075430_100221224
380 Ga0075431_100089158
381 Ga0075431_100315438
382 Ga0075431_101085030
383 Ga0075433_10771475
384 Ga0075434_100428315
385 Ga0075434_100872098
386 Ga0075429_100176733
387 Ga0075429_101144531
388 Ga0068865_100007141
389 Ga0068865_100710946
390 Ga0075436_100000442
391 Ga0097620_100094559
392 Ga0097620_100464478
393 Ga0097620_100796367
394 Ga0097620_101380879
395 Ga0099794_10014911
396 Ga0099794_10028430
397 Ga0111539_10035844
398 Ga0111539_10102351
399 Ga0111539_10794778
400 Ga0105245_11057110
401 Ga0114129_10076831
402 Ga0114129_10257980
403 Ga0114129_12352946
404 Ga0105243_10003588
405 Ga0105242_10675323
406 Ga0105242_10740998
407 Ga0105249_10001866
408 Ga0105246_11055816
409 Ga0157380_10032203
410 Ga0157380_11139983
411 Ga0157377_10031163
412 Ga0157379_10480222
413 Ga0157376_10624996
414 Ga0207653_10097579
415 Ga0207642_10371260
416 Ga0207688_10014763
417 Ga0207645_10023927
418 Ga0207645_10063259
419 Ga0207643_10011905
420 Ga0207707_10131708
421 Ga0207663_10394134
422 Ga0207660_10072227
423 Ga0207662_10079374
424 Ga0207662_10424474
425 Ga0207659_10011033
426 Ga0207706_10070753
427 Ga0207704_10112790
428 Ga0207691_10254688
429 Ga0207689_10063152
430 Ga0207661_10039612
431 Ga0207651_10310749
432 Ga0207668_10030515
433 Ga0207677_10390944
434 Ga0207708_10072988
435 Ga0207708_10208102
436 Ga0207708_10598564
437 Ga0207648_10000711
438 Ga0207648_10402583
439 Ga0207648_10696335
440 Ga0207648_10953212
441 Ga0207674_10072220
442 Ga0207675_100020559
443 Ga0207683_11860019
444 Ga0209967_1001970
445 Ga0209967_1004798
446 Ga0209967_1012754
447 Ga0209967_1038416
448 Ga0209981_1003012
449 Ga0210000_1001670
450 Ga0210000_1022891
451 Ga0209968_1028927
452 Ga0209968_1051520
453 Ga0209999_1010899
454 Ga0209983_1017044
455 Ga0209983_1155960
456 Ga0209588_1096398
457 Ga0209971_1007435
458 Ga0209966_1005973
459 Ga0209974_10020437
460 Ga0207428_10086474
461 Ga0207428_10109012
462 Ga0207428_10729090
463 Ga0268265_10001393
464 Ga0268265_10084188
465 Ga0268264_10631362
466 Ga0307408_100014562
467 Ga0307408_100298646
468 Ga0307408_100438878
469 Ga0307408_101042327
470 Ga0307412_11024118
471 Ga0307416_100106431
472 Ga0307416_100222455
473 Ga0307416_100461743
474 Ga0307416_100624980
475 Ga0307416_100877083
476 Ga0307411_10141098
477 Ga0307411_10785831
478 Ga0307415_100723481
479 Ga0373934_0197298
480 Ga0373923_0175571
481 Ga0373941_0020261
482 Ga0373954_0142371
483 Ga0373955_0009908
484 Ga0373961_0017796
485 Ga0373933_0016522
486 Ga0373937_0058821
487 Ga0439453_0017087
488 Ga0439461_0019686
489 Ga0451807_1817773
490 Ga0451845_0033753
491 Ga0439441_000607
492 Ga0439441_031776
493 Ga0439443_003049
494 Ga0439451_015530
495 Ga0439456_015404
496 Ga0439446_0007983
497 Ga0439434_0000408
498 Ga0439434_0140319
499 Ga0439435_0000029
500 Ga0439435_0000945
501 Ga0439435_0001117
502 Ga0439444_0000889
503 Ga0439444_0044583
504 Ga0439460_0000350
505 Ga0450916_023284
506 Ga0466964_0013915
507 Ga0466960_0305603
508 Ga0451576_0833640
509 Ga0466967_0000292
510 Ga0495592_0098675
511 Ga0495603_0709281
512 Ga0495582_0156797
513 Ga0495662_0009776
514 Ga0495608_0014511
515 Ga0495618_0132288
516 Ga0495628_0012764
517 Ga0495666_0036533
518 Ga0495642_0100815
519 Ga0495642_0162024
520 Ga0495652_0258593
521 Ga0495640_0023222
522 Ga0495586_0005346
523 Ga0495598_0084563
524 Ga0495634_0035341
525 Ga0495658_0044197
526 Ga0495669_0327291
527 Ga0495613_0049945
528 Ga0495624_0109969
529 Ga0495600_0054832
530 Ga0495604_0107496
531 Ga0495636_0025470
532 Ga0495636_0350719
533 Ga0495680_0000847
534 Ga0495593_0070655
535 Ga0501298_063880
536 Ga0501031_0026800
537 Ga0501032_0038333
538 Ga0501033_0072470
539 Ga0501033_0192915
540 Ga0501036_0000184
541 Ga0501036_0049951
542 Ga0501036_0120463
543 Ga0501036_1030255
544 Ga0501037_0076489
545 Ga0501037_0123672
546 Ga0501038_0001603
547 Ga0501038_0158074
548 Ga0501038_0172740
549 Ga0501039_0000053
550 Ga0501039_0410681
551 Ga0501040_0005735
552 Ga0501040_0016085
553 Ga0501040_0102602
554 Ga0501041_0000118
555 Ga0501041_0004901
556 Ga0501041_0070431
557 Ga0501041_0260385
558 Ga0501042_0000120
559 Ga0501042_0068280
560 Ga0501043_0104304
561 Ga0501046_0003828
562 Ga0501046_0090106
563 Ga0501046_0373586
564 Ga0501048_0004450
565 Ga0501048_0039531
566 Ga0501068_0024809
567 Ga0501070_0029679
568 Ga0501070_0971415
569 Ga0501071_0032359
570 Ga0501071_0056102
571 Ga0501071_0133798
572 Ga0501072_0000147
573 Ga0501072_0121641
574 Ga0501072_0327605
575 Ga0501072_0753781
576 Ga0501072_0775058
577 Ga0501074_0048413
578 Ga0501075_0000662
579 Ga0501075_0042248
580 Ga0501075_0056737
581 Ga0501076_0000265
582 Ga0501076_0040591
583 Ga0501076_0475535
584 Ga0501076_0482101
585 Ga0501076_1053255
586 Ga0501077_0004587
587 Ga0501077_0330721
588 Ga0501209_146396
589 Ga0501227_120751
590 Ga0501233_111546
591 Ga0501079_0000132
592 Ga0501079_0916790
593 Ga0501080_0091871
594 Ga0501080_0092122
595 Ga0501081_0001294
596 Ga0501035_0088488
597 Ga0501045_0007702
598 Ga0501045_0154216
599 Ga0501045_0501621
600 nmdc:mga05p37_133558_c1
601 nmdc:mga05p37_511962_c1
602 nmdc:mga0qj67_1067430_c1
603 nmdc:mga0qj67_19709_c1
604 nmdc:mga0qj67_40968_c1
605 nmdc:mga06r32_34091_c1
606 nmdc:mga08y16_16781_c1
607 nmdc:mga08y16_328826_c1
608 nmdc:mga0n895_1177156_c1
609 nmdc:mga08x19_81_c1
610 Ga0495601_0062284
611 Ga0500566_0251618
612 Ga0501084_0000260
613 Ga0501084_0335561
614 Ga0590077_021942
615 Ga0501082_0005354
616 Ga0530510_0024623

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00186

DHFR_1

Dihydrofolate reductase

8

166

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqa-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with nadph 0.9715 12 168
3tq8-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with trimethoprim 0.9694 12 170
3tqa-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with nadph 0.9595 12 168
3jw3-assembly2.cif.gz_B crystal structure of bacillus anthracis (f96i) dihydrofolate reductase complexed with nadph and trimethoprim 0.9591 9 170
3dat-assembly1.cif.gz_A crystal structure of the ternary mtx nadph complex of bacillus anthracis dihydrofolate reductase 0.9581 12 169
ID Description Score Start End Superfamily
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9715 12 168 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9595 12 168 3.40.430.10
4or7A00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9544 13 170 3.40.430.10
3fl9F00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9517 12 170 3.40.430.10
3ix9B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9473 11 170 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A059WZ67-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9943 53 170 GO:0004146
GO:0005829
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A3C1PJR9-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9881 12 112 GO:0004146
GO:0005829
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A1W9U3T4-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9865 12 169 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A059WZ67-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.986 53 170 GO:0004146
GO:0005829
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A2N2TST0-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9857 8 170 GO:0004146
GO:0005829
GO:0006730
GO:0016301
GO:0046452
GO:0046654
GO:0046655
GO:0050661

Map