F399513

General Info

Members Datasets Scaffolds Average Seq Length
308 191 616 109

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10056007|Ga0070658_100560075
Length 108
Sequence MSVRAYLWQRGTAVLLVALIAVHLGVIFYASGRHLAAADILARTRGSIAWGAFYTTFVLAAAIHASIGIQAPLVEWFSLSRRGAMIFGACFGALLVALGLRAVMAVVL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
128 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
140 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
141 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
142 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.6
Nodule 0
Rhizoplane 0.32
Rhizosphere 96.75
Stem 0
Stem Tuber 0
Unclassified 6.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10056007 3300005327 Bacteria 3204
2 Ga0065712_10092309 3300005290 Bacteria 2336
3 Ga0065712_10133266 3300005290 Bacteria 1525
4 Ga0070658_10057353 3300005327 Bacteria 3168
5 Ga0070683_100038929 3300005329 Bacteria 4361
6 Ga0070683_100127258 3300005329 Bacteria 2409
7 Ga0070690_100133354 3300005330 Bacteria 1679
8 Ga0070670_101789229 3300005331 Unclassified 566
9 Ga0068869_100771092 3300005334 Bacteria 825
10 Ga0070680_100660355 3300005336 Bacteria 899
11 Ga0070680_101646709 3300005336 Bacteria 556
12 Ga0070660_100931002 3300005339 Bacteria 733
13 Ga0070689_100849643 3300005340 Bacteria 805
14 Ga0070687_100110945 3300005343 Bacteria 1552
15 Ga0070687_100958646 3300005343 Bacteria 617
16 Ga0070661_101603732 3300005344 Bacteria 550
17 Ga0070692_10234447 3300005345 Bacteria 1091
18 Ga0070675_100607530 3300005354 Bacteria 992
19 Ga0070671_100730390 3300005355 Bacteria 860
20 Ga0070673_100150735 3300005364 Bacteria 1969
21 Ga0070659_101847687 3300005366 Unclassified 541
22 Ga0070659_101939902 3300005366 Bacteria 528
23 Ga0070714_100030334 3300005435 Bacteria 4499
24 Ga0070714_100504361 3300005435 Bacteria 1154
25 Ga0070714_101014486 3300005435 Bacteria 808
26 Ga0070713_100058852 3300005436 Bacteria 3206
27 Ga0070710_10589458 3300005437 Bacteria 772
28 Ga0070701_10205559 3300005438 Unclassified 1166
29 Ga0070701_10681771 3300005438 Bacteria 689
30 Ga0070711_100027487 3300005439 Bacteria 3736
31 Ga0070705_100390949 3300005440 Bacteria 1027
32 Ga0070705_101052988 3300005440 Bacteria 663
33 Ga0070700_101371779 3300005441 Bacteria 596
34 Ga0070700_101681666 3300005441 Bacteria 544
35 Ga0070700_101846263 3300005441 Bacteria 521
36 Ga0070694_100103497 3300005444 Bacteria 2017
37 Ga0070708_100814559 3300005445 Unclassified 878
38 Ga0070678_100400048 3300005456 Bacteria 1193
39 Ga0068867_100504809 3300005459 Bacteria 1040
40 Ga0068867_100645454 3300005459 Bacteria 928
41 Ga0068867_101224750 3300005459 Bacteria 690
42 Ga0070698_100143213 3300005471 Bacteria 2340
43 Ga0070698_100555450 3300005471 Bacteria 1088
44 Ga0070699_100027305 3300005518 Bacteria 4926
45 Ga0070699_100311165 3300005518 Bacteria 1414
46 Ga0070699_101883608 3300005518 Unclassified 547
47 Ga0070684_100275026 3300005535 Bacteria 1542
48 Ga0070697_100088543 3300005536 Bacteria 2557
49 Ga0068853_100269524 3300005539 Bacteria 1567
50 Ga0070696_100146589 3300005546 Bacteria 1729
51 Ga0070696_101718844 3300005546 Bacteria 541
52 Ga0070693_100000865 3300005547 Bacteria 13507
53 Ga0070693_100322062 3300005547 Bacteria 1049
54 Ga0070704_101881581 3300005549 Unclassified 554
55 Ga0068855_100034412 3300005563 Bacteria 6043
56 Ga0068855_100049907 3300005563 Bacteria 4933
57 Ga0068855_100150079 3300005563 Bacteria 2650
58 Ga0068855_100240174 3300005563 Bacteria 2025
59 Ga0068855_101047745 3300005563 Bacteria 855
60 Ga0068855_101717682 3300005563 Bacteria 640
61 Ga0068857_100124169 3300005577 Bacteria 2326
62 Ga0068854_100571973 3300005578 Bacteria 961
63 Ga0068856_100134142 3300005614 Bacteria 2481
64 Ga0068856_100308632 3300005614 Bacteria 1600
65 Ga0070702_100882365 3300005615 Bacteria 699
66 Ga0070702_101585172 3300005615 Bacteria 541
67 Ga0070702_101723179 3300005615 Bacteria 521
68 Ga0068852_100144279 3300005616 Bacteria 2206
69 Ga0068852_100174224 3300005616 Bacteria 2019
70 Ga0068852_100274750 3300005616 Bacteria 1622
71 Ga0068852_100535005 3300005616 Bacteria 1170
72 Ga0068852_102542850 3300005616 Bacteria 532
73 Ga0068859_100039506 3300005617 Bacteria 4734
74 Ga0068859_100100741 3300005617 Bacteria 2945
75 Ga0068859_100220976 3300005617 Bacteria 1982
76 Ga0068864_100303292 3300005618 Bacteria 1496
77 Ga0068864_100556063 3300005618 Bacteria 1110
78 Ga0068851_10956742 3300005834 Bacteria 539
79 Ga0068863_101226069 3300005841 Bacteria 756
80 Ga0068858_100071684 3300005842 Bacteria 3214
81 Ga0068858_100099030 3300005842 Bacteria 2718
82 Ga0068860_100206241 3300005843 Bacteria 1906
83 Ga0070717_10588726 3300006028 Bacteria 1009
84 Ga0075364_10924103 3300006051 Bacteria 594
85 Ga0070716_100870660 3300006173 Bacteria 703
86 Ga0070716_101046465 3300006173 Bacteria 648
87 Ga0070712_100077161 3300006175 Bacteria 2401
88 Ga0075366_10104051 3300006195 Bacteria 1705
89 Ga0075366_10875199 3300006195 Bacteria 559
90 Ga0097621_100029897 3300006237 Bacteria 4307
91 Ga0097621_100100474 3300006237 Bacteria 2433
92 Ga0097621_100113079 3300006237 Bacteria 2296
93 Ga0097621_100798534 3300006237 Bacteria 874
94 Ga0075370_10384193 3300006353 Bacteria 841
95 Ga0068871_100037389 3300006358 Bacteria 3871
96 Ga0068871_100052463 3300006358 Bacteria 3302
97 Ga0068871_100816600 3300006358 Unclassified 860
98 Ga0075434_102201439 3300006871 Bacteria 555
99 Ga0075429_100370299 3300006880 Bacteria 1254
100 Ga0068865_100301820 3300006881 Bacteria 1282
101 Ga0075436_100144547 3300006914 Bacteria 1672
102 Ga0097620_100039503 3300006931 Bacteria 4734
103 Ga0097620_100100734 3300006931 Bacteria 2945
104 Ga0097620_100220974 3300006931 Bacteria 1982
105 Ga0099794_10390562 3300007265 Bacteria 726
106 Ga0105240_10040958 3300009093 Bacteria 5918
107 Ga0105240_10175649 3300009093 Bacteria 2532
108 Ga0105240_11211106 3300009093 Bacteria 799
109 Ga0111539_10000774 3300009094 Bacteria 41587
110 Ga0105245_10100578 3300009098 Bacteria 2674
111 Ga0105245_10128088 3300009098 Bacteria 2378
112 Ga0105245_11245433 3300009098 Bacteria 792
113 Ga0105245_11780115 3300009098 Bacteria 669
114 Ga0105241_10023884 3300009174 Bacteria 4538
115 Ga0105242_10050480 3300009176 Bacteria 3387
116 Ga0105242_10058360 3300009176 Bacteria 3163
117 Ga0105242_10127151 3300009176 Bacteria 2195
118 Ga0105248_10013584 3300009177 Bacteria 8966
119 Ga0105248_10234764 3300009177 Bacteria 2064
120 Ga0105238_10011151 3300009551 Bacteria 9039
121 Ga0105238_10049631 3300009551 Bacteria 4225
122 Ga0105238_11732561 3300009551 Unclassified 656
123 Ga0105249_10101133 3300009553 Bacteria 2711
124 Ga0105239_10523651 3300010375 Bacteria 1349
125 Ga0105239_12693221 3300010375 Bacteria 580
126 Ga0157371_10195593 3300013102 Bacteria 1449
127 Ga0157369_10518795 3300013105 Bacteria 1232
128 Ga0157369_11368844 3300013105 Bacteria 721
129 Ga0157374_10051215 3300013296 Bacteria 3841
130 Ga0157374_12238447 3300013296 Bacteria 574
131 Ga0157378_10159192 3300013297 Bacteria 2110
132 Ga0157378_10289181 3300013297 Bacteria 1582
133 Ga0157378_10436748 3300013297 Bacteria 1296
134 Ga0163162_10056030 3300013306 Bacteria 3971
135 Ga0163162_11143006 3300013306 Bacteria 883
136 Ga0163162_11925837 3300013306 Bacteria 677
137 Ga0157372_10149443 3300013307 Bacteria 2695
138 Ga0157372_10161259 3300013307 Bacteria 2592
139 Ga0157372_10498922 3300013307 Bacteria 1419
140 Ga0157372_11400101 3300013307 Bacteria 806
141 Ga0157375_10150988 3300013308 Bacteria 2459
142 Ga0163163_13038498 3300014325 Unclassified 523
143 Ga0157380_10167859 3300014326 Bacteria 1914
144 Ga0157380_11029212 3300014326 Bacteria 859
145 Ga0157380_12673813 3300014326 Unclassified 565
146 Ga0157380_12870939 3300014326 Bacteria 548
147 Ga0157377_10998509 3300014745 Bacteria 633
148 Ga0157379_10050329 3300014968 Bacteria 3719
149 Ga0157379_11040517 3300014968 Bacteria 782
150 Ga0157376_10195050 3300014969 Bacteria 1859
151 Ga0157376_10544960 3300014969 Bacteria 1147
152 Ga0157376_12882482 3300014969 Unclassified 520
153 Ga0206353_11109555 3300020082 Bacteria 642
154 Ga0207705_10177639 3300025909 Bacteria 1605
155 Ga0207705_10271354 3300025909 Bacteria 1297
156 Ga0207707_10682314 3300025912 Bacteria 864
157 Ga0207695_10010633 3300025913 Bacteria 11243
158 Ga0207663_10010775 3300025916 Bacteria 4881
159 Ga0207660_10573204 3300025917 Bacteria 918
160 Ga0207657_10712668 3300025919 Bacteria 779
161 Ga0207649_10597246 3300025920 Bacteria 849
162 Ga0207652_10095137 3300025921 Bacteria 2624
163 Ga0207652_10216598 3300025921 Bacteria 1725
164 Ga0207694_10021684 3300025924 Bacteria 4868
165 Ga0207694_10564552 3300025924 Unclassified 956
166 Ga0207650_11075931 3300025925 Bacteria 684
167 Ga0207687_10074586 3300025927 Bacteria 2432
168 Ga0207687_10109970 3300025927 Bacteria 2043
169 Ga0207700_10046959 3300025928 Bacteria 3198
170 Ga0207700_10611304 3300025928 Bacteria 970
171 Ga0207664_10433287 3300025929 Bacteria 1172
172 Ga0207664_11024919 3300025929 Bacteria 739
173 Ga0207686_10051478 3300025934 Bacteria 2565
174 Ga0207686_10327836 3300025934 Bacteria 1146
175 Ga0207670_10016437 3300025936 Bacteria 4446
176 Ga0207670_10036089 3300025936 Bacteria 3212
177 Ga0207704_10204893 3300025938 Bacteria 1447
178 Ga0207665_11022508 3300025939 Unclassified 658
179 Ga0207711_10132928 3300025941 Bacteria 2232
180 Ga0207711_10236405 3300025941 Bacteria 1674
181 Ga0207689_10062734 3300025942 Bacteria 3057
182 Ga0207689_10590455 3300025942 Bacteria 934
183 Ga0207661_10906463 3300025944 Bacteria 812
184 Ga0207667_10005977 3300025949 Bacteria 14805
185 Ga0207667_10029425 3300025949 Bacteria 5957
186 Ga0207667_10031995 3300025949 Bacteria 5674
187 Ga0207667_10444552 3300025949 Bacteria 1318
188 Ga0207667_10861813 3300025949 Bacteria 900
189 Ga0207712_10223910 3300025961 Bacteria 1505
190 Ga0207712_10473406 3300025961 Bacteria 1066
191 Ga0207640_10044453 3300025981 Bacteria 2846
192 Ga0207703_10026343 3300026035 Bacteria 4576
193 Ga0207703_10568518 3300026035 Bacteria 1070
194 Ga0207703_11345412 3300026035 Bacteria 687
195 Ga0207639_10590750 3300026041 Bacteria 1023
196 Ga0207639_10898003 3300026041 Bacteria 828
197 Ga0207639_11690430 3300026041 Bacteria 593
198 Ga0207702_10218021 3300026078 Bacteria 1777
199 Ga0207702_10485289 3300026078 Bacteria 1203
200 Ga0207641_11309762 3300026088 Bacteria 725
201 Ga0207648_10455471 3300026089 Bacteria 1165
202 Ga0207648_11027779 3300026089 Bacteria 772
203 Ga0207676_10764317 3300026095 Bacteria 941
204 Ga0207674_10160627 3300026116 Bacteria 2202
205 Ga0207698_10314293 3300026142 Bacteria 1464
206 Ga0207698_10897978 3300026142 Bacteria 893
207 Ga0207698_12225343 3300026142 Bacteria 561
208 Ga0207428_10003647 3300027907 Bacteria 14845
209 Ga0268264_10219376 3300028381 Bacteria 1750
210 Ga0268264_12091004 3300028381 Bacteria 575
211 Ga0265339_10017429 3300031249 Bacteria 4256
212 Ga0307408_100214473 3300031548 Bacteria 1567
213 Ga0307405_10111979 3300031731 Bacteria 1851
214 Ga0307405_10402429 3300031731 Bacteria 1072
215 Ga0307405_10543081 3300031731 Bacteria 939
216 Ga0307410_10416177 3300031852 Bacteria 1089
217 Ga0307406_10237519 3300031901 Bacteria 1365
218 Ga0307412_10154335 3300031911 Bacteria 1698
219 Ga0307412_10331193 3300031911 Bacteria 1215
220 Ga0307412_10344968 3300031911 Bacteria 1193
221 Ga0307409_100278464 3300031995 Bacteria 1545
222 Ga0307416_100024529 3300032002 Bacteria 4405
223 Ga0307416_100079475 3300032002 Bacteria 2764
224 Ga0307416_100616140 3300032002 Bacteria 1167
225 Ga0307416_100796327 3300032002 Bacteria 1041
226 Ga0307416_100869992 3300032002 Bacteria 1000
227 Ga0307416_101120307 3300032002 Bacteria 892
228 Ga0307416_102072266 3300032002 Bacteria 671
229 Ga0307411_10318532 3300032005 Bacteria 1255
230 Ga0307411_10554089 3300032005 Bacteria 981
231 Ga0307415_100287279 3300032126 Bacteria 1356
232 Ga0307415_101351440 3300032126 Bacteria 677
233 Ga0373940_0106566 3300035088 Bacteria 856
234 Ga0373936_0159219 3300035113 Bacteria 983
235 Ga0373939_0129620 3300035114 Bacteria 899
236 Ga0373954_0139312 3300035118 Bacteria 1183
237 Ga0373957_0131075 3300035120 Bacteria 1020
238 Ga0373943_0518353 3300035170 Bacteria 698
239 Ga0373935_0885090 3300035692 Bacteria 661
240 Ga0373927_0176927 3300035695 Bacteria 1399
241 Ga0373933_0152010 3300035724 Bacteria 1466
242 Ga0373937_0055438 3300036401 Bacteria 3638
243 Ga0373937_1044572 3300036401 Bacteria 766
244 Ga0373925_0061345 3300037068 Bacteria 2824
245 Ga0373925_0642073 3300037068 Bacteria 875
246 Ga0436365_1865855 3300039437 Bacteria 6531
247 Ga0439447_096464 3300041407 Unclassified 679
248 Ga0450892_014423 3300042130 Unclassified 729
249 Ga0450898_102958 3300042134 Unclassified 598
250 Ga0439444_0197445 3300042437 Unclassified 506
251 Ga0453683_0288452 3300044673 Bacteria 1049
252 Ga0495592_0034105 3300046454 Bacteria 3838
253 Ga0495629_0160697 3300046459 Bacteria 1561
254 Ga0495653_0095416 3300046463 Bacteria 2165
255 Ga0495582_0681505 3300046473 Unclassified 595
256 Ga0495664_0184128 3300046477 Bacteria 1266
257 Ga0495664_0301466 3300046477 Bacteria 967
258 Ga0495608_0003916 3300046511 Bacteria 10705
259 Ga0495608_0320794 3300046511 Bacteria 957
260 Ga0495628_0036265 3300046516 Bacteria 3959
261 Ga0495630_0702342 3300046517 Bacteria 774
262 Ga0495652_0946175 3300046529 Bacteria 566
263 Ga0495587_0009004 3300046536 Bacteria 6408
264 Ga0495598_0031739 3300046537 Bacteria 1488
265 Ga0495598_0263470 3300046537 Bacteria 642
266 Ga0495645_0000843 3300046543 Bacteria 20844
267 Ga0495645_0198959 3300046543 Bacteria 1361
268 Ga0495667_0016218 3300046559 Bacteria 5031
269 Ga0495635_0016849 3300046663 Bacteria 5104
270 Ga0495657_0009256 3300046675 Bacteria 7477
271 Ga0495599_0015770 3300046678 Bacteria 4690
272 Ga0495623_0063487 3300046679 Bacteria 2312
273 Ga0495600_0129455 3300046809 Bacteria 1641
274 Ga0495636_0185354 3300047318 Bacteria 946
275 Ga0495672_0139961 3300047320 Bacteria 1265
276 Ga0495675_0619798 3300047444 Unclassified 612
277 Ga0495684_0059085 3300047471 Bacteria 2920
278 Ga0496112_0456275 3300048915 Bacteria 1216
279 Ga0501034_0151946 3300049571 Bacteria 2291
280 Ga0501046_0057325 3300049580 Bacteria 3056
281 Ga0501047_0092994 3300049581 Bacteria 2894
282 Ga0501047_1421844 3300049581 Bacteria 509
283 Ga0501048_0547629 3300049582 Bacteria 830
284 Ga0501069_0000753 3300049585 Bacteria 15120
285 Ga0501070_0007363 3300049586 Bacteria 9344
286 Ga0501070_0159686 3300049586 Bacteria 1859
287 Ga0501073_0007998 3300049589 Bacteria 7851
288 Ga0501074_0000574 3300049590 Bacteria 22747
289 Ga0501079_0026665 3300049741 Bacteria 4430
290 Ga0501080_0148338 3300049742 Bacteria 2168
291 Ga0501080_0360147 3300049742 Bacteria 1312
292 Ga0501083_0005518 3300049744 Bacteria 8962
293 Ga0501035_1463664 3300049822 Unclassified 522
294 Ga0501044_0532597 3300049823 Bacteria 1073
295 Ga0501044_1068354 3300049823 Bacteria 677
296 nmdc:mga03n38_528096_c1 3300050490 Bacteria 665
297 nmdc:mga0k408_147029_c1 3300050493 Bacteria 1403
298 nmdc:mga0k408_818994_c1 3300050493 Unclassified 542
299 nmdc:mga07m45_494826_c1 3300050496 Bacteria 708
300 nmdc:mga09592_92520_c1 3300050508 Bacteria 2585
301 nmdc:mga0qj67_771780_c1 3300050509 Bacteria 762
302 nmdc:mga08y16_147_c1 3300050511 Bacteria 61021
303 nmdc:mga0n895_1774510_c1 3300050512 Bacteria 578
304 nmdc:mga08x19_418615_c1 3300050514 Bacteria 941
305 Ga0495601_0011833 3300053077 Bacteria 5232
306 Ga0495619_0150138 3300053085 Bacteria 1607
307 Ga0501084_0109474 3300054114 Bacteria 2321
308 Ga0501082_0052829 3300060353 Bacteria 3503
309 Ga0070658_10056007
310 Ga0065712_10092309
311 Ga0065712_10133266
312 Ga0070658_10057353
313 Ga0070683_100038929
314 Ga0070683_100127258
315 Ga0070690_100133354
316 Ga0070670_101789229
317 Ga0068869_100771092
318 Ga0070680_100660355
319 Ga0070680_101646709
320 Ga0070660_100931002
321 Ga0070689_100849643
322 Ga0070687_100110945
323 Ga0070687_100958646
324 Ga0070661_101603732
325 Ga0070692_10234447
326 Ga0070675_100607530
327 Ga0070671_100730390
328 Ga0070673_100150735
329 Ga0070659_101847687
330 Ga0070659_101939902
331 Ga0070714_100030334
332 Ga0070714_100504361
333 Ga0070714_101014486
334 Ga0070713_100058852
335 Ga0070710_10589458
336 Ga0070701_10205559
337 Ga0070701_10681771
338 Ga0070711_100027487
339 Ga0070705_100390949
340 Ga0070705_101052988
341 Ga0070700_101371779
342 Ga0070700_101681666
343 Ga0070700_101846263
344 Ga0070694_100103497
345 Ga0070708_100814559
346 Ga0070678_100400048
347 Ga0068867_100504809
348 Ga0068867_100645454
349 Ga0068867_101224750
350 Ga0070698_100143213
351 Ga0070698_100555450
352 Ga0070699_100027305
353 Ga0070699_100311165
354 Ga0070699_101883608
355 Ga0070684_100275026
356 Ga0070697_100088543
357 Ga0068853_100269524
358 Ga0070696_100146589
359 Ga0070696_101718844
360 Ga0070693_100000865
361 Ga0070693_100322062
362 Ga0070704_101881581
363 Ga0068855_100034412
364 Ga0068855_100049907
365 Ga0068855_100150079
366 Ga0068855_100240174
367 Ga0068855_101047745
368 Ga0068855_101717682
369 Ga0068857_100124169
370 Ga0068854_100571973
371 Ga0068856_100134142
372 Ga0068856_100308632
373 Ga0070702_100882365
374 Ga0070702_101585172
375 Ga0070702_101723179
376 Ga0068852_100144279
377 Ga0068852_100174224
378 Ga0068852_100274750
379 Ga0068852_100535005
380 Ga0068852_102542850
381 Ga0068859_100039506
382 Ga0068859_100100741
383 Ga0068859_100220976
384 Ga0068864_100303292
385 Ga0068864_100556063
386 Ga0068851_10956742
387 Ga0068863_101226069
388 Ga0068858_100071684
389 Ga0068858_100099030
390 Ga0068860_100206241
391 Ga0070717_10588726
392 Ga0075364_10924103
393 Ga0070716_100870660
394 Ga0070716_101046465
395 Ga0070712_100077161
396 Ga0075366_10104051
397 Ga0075366_10875199
398 Ga0097621_100029897
399 Ga0097621_100100474
400 Ga0097621_100113079
401 Ga0097621_100798534
402 Ga0075370_10384193
403 Ga0068871_100037389
404 Ga0068871_100052463
405 Ga0068871_100816600
406 Ga0075434_102201439
407 Ga0075429_100370299
408 Ga0068865_100301820
409 Ga0075436_100144547
410 Ga0097620_100039503
411 Ga0097620_100100734
412 Ga0097620_100220974
413 Ga0099794_10390562
414 Ga0105240_10040958
415 Ga0105240_10175649
416 Ga0105240_11211106
417 Ga0111539_10000774
418 Ga0105245_10100578
419 Ga0105245_10128088
420 Ga0105245_11245433
421 Ga0105245_11780115
422 Ga0105241_10023884
423 Ga0105242_10050480
424 Ga0105242_10058360
425 Ga0105242_10127151
426 Ga0105248_10013584
427 Ga0105248_10234764
428 Ga0105238_10011151
429 Ga0105238_10049631
430 Ga0105238_11732561
431 Ga0105249_10101133
432 Ga0105239_10523651
433 Ga0105239_12693221
434 Ga0157371_10195593
435 Ga0157369_10518795
436 Ga0157369_11368844
437 Ga0157374_10051215
438 Ga0157374_12238447
439 Ga0157378_10159192
440 Ga0157378_10289181
441 Ga0157378_10436748
442 Ga0163162_10056030
443 Ga0163162_11143006
444 Ga0163162_11925837
445 Ga0157372_10149443
446 Ga0157372_10161259
447 Ga0157372_10498922
448 Ga0157372_11400101
449 Ga0157375_10150988
450 Ga0163163_13038498
451 Ga0157380_10167859
452 Ga0157380_11029212
453 Ga0157380_12673813
454 Ga0157380_12870939
455 Ga0157377_10998509
456 Ga0157379_10050329
457 Ga0157379_11040517
458 Ga0157376_10195050
459 Ga0157376_10544960
460 Ga0157376_12882482
461 Ga0206353_11109555
462 Ga0207705_10177639
463 Ga0207705_10271354
464 Ga0207707_10682314
465 Ga0207695_10010633
466 Ga0207663_10010775
467 Ga0207660_10573204
468 Ga0207657_10712668
469 Ga0207649_10597246
470 Ga0207652_10095137
471 Ga0207652_10216598
472 Ga0207694_10021684
473 Ga0207694_10564552
474 Ga0207650_11075931
475 Ga0207687_10074586
476 Ga0207687_10109970
477 Ga0207700_10046959
478 Ga0207700_10611304
479 Ga0207664_10433287
480 Ga0207664_11024919
481 Ga0207686_10051478
482 Ga0207686_10327836
483 Ga0207670_10016437
484 Ga0207670_10036089
485 Ga0207704_10204893
486 Ga0207665_11022508
487 Ga0207711_10132928
488 Ga0207711_10236405
489 Ga0207689_10062734
490 Ga0207689_10590455
491 Ga0207661_10906463
492 Ga0207667_10005977
493 Ga0207667_10029425
494 Ga0207667_10031995
495 Ga0207667_10444552
496 Ga0207667_10861813
497 Ga0207712_10223910
498 Ga0207712_10473406
499 Ga0207640_10044453
500 Ga0207703_10026343
501 Ga0207703_10568518
502 Ga0207703_11345412
503 Ga0207639_10590750
504 Ga0207639_10898003
505 Ga0207639_11690430
506 Ga0207702_10218021
507 Ga0207702_10485289
508 Ga0207641_11309762
509 Ga0207648_10455471
510 Ga0207648_11027779
511 Ga0207676_10764317
512 Ga0207674_10160627
513 Ga0207698_10314293
514 Ga0207698_10897978
515 Ga0207698_12225343
516 Ga0207428_10003647
517 Ga0268264_10219376
518 Ga0268264_12091004
519 Ga0265339_10017429
520 Ga0307408_100214473
521 Ga0307405_10111979
522 Ga0307405_10402429
523 Ga0307405_10543081
524 Ga0307410_10416177
525 Ga0307406_10237519
526 Ga0307412_10154335
527 Ga0307412_10331193
528 Ga0307412_10344968
529 Ga0307409_100278464
530 Ga0307416_100024529
531 Ga0307416_100079475
532 Ga0307416_100616140
533 Ga0307416_100796327
534 Ga0307416_100869992
535 Ga0307416_101120307
536 Ga0307416_102072266
537 Ga0307411_10318532
538 Ga0307411_10554089
539 Ga0307415_100287279
540 Ga0307415_101351440
541 Ga0373940_0106566
542 Ga0373936_0159219
543 Ga0373939_0129620
544 Ga0373954_0139312
545 Ga0373957_0131075
546 Ga0373943_0518353
547 Ga0373935_0885090
548 Ga0373927_0176927
549 Ga0373933_0152010
550 Ga0373937_0055438
551 Ga0373937_1044572
552 Ga0373925_0061345
553 Ga0373925_0642073
554 Ga0436365_1865855
555 Ga0439447_096464
556 Ga0450892_014423
557 Ga0450898_102958
558 Ga0439444_0197445
559 Ga0453683_0288452
560 Ga0495592_0034105
561 Ga0495629_0160697
562 Ga0495653_0095416
563 Ga0495582_0681505
564 Ga0495664_0184128
565 Ga0495664_0301466
566 Ga0495608_0003916
567 Ga0495608_0320794
568 Ga0495628_0036265
569 Ga0495630_0702342
570 Ga0495652_0946175
571 Ga0495587_0009004
572 Ga0495598_0031739
573 Ga0495598_0263470
574 Ga0495645_0000843
575 Ga0495645_0198959
576 Ga0495667_0016218
577 Ga0495635_0016849
578 Ga0495657_0009256
579 Ga0495599_0015770
580 Ga0495623_0063487
581 Ga0495600_0129455
582 Ga0495636_0185354
583 Ga0495672_0139961
584 Ga0495675_0619798
585 Ga0495684_0059085
586 Ga0496112_0456275
587 Ga0501034_0151946
588 Ga0501046_0057325
589 Ga0501047_0092994
590 Ga0501047_1421844
591 Ga0501048_0547629
592 Ga0501069_0000753
593 Ga0501070_0007363
594 Ga0501070_0159686
595 Ga0501073_0007998
596 Ga0501074_0000574
597 Ga0501079_0026665
598 Ga0501080_0148338
599 Ga0501080_0360147
600 Ga0501083_0005518
601 Ga0501035_1463664
602 Ga0501044_0532597
603 Ga0501044_1068354
604 nmdc:mga03n38_528096_c1
605 nmdc:mga0k408_147029_c1
606 nmdc:mga0k408_818994_c1
607 nmdc:mga07m45_494826_c1
608 nmdc:mga09592_92520_c1
609 nmdc:mga0qj67_771780_c1
610 nmdc:mga08y16_147_c1
611 nmdc:mga0n895_1774510_c1
612 nmdc:mga08x19_418615_c1
613 Ga0495601_0011833
614 Ga0495619_0150138
615 Ga0501084_0109474
616 Ga0501082_0052829

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6h-assembly1.cif.gz_EG cryo-em structure of cytochrome c oxidase dimer (complex iv) from respiratory supercomplex of tetrahymena thermophila 0.8046 55 111
2wu5-assembly1.cif.gz_H crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant 0.7771 6 112
2acz-assembly1.cif.gz_D complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.7711 9 112
2ws3-assembly3.cif.gz_D crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd tyr83phe mutant 0.771 6 111
7jz2-assembly1.cif.gz_D succinate: quinone oxidoreductase sqr from e.coli k12 0.7687 9 111
ID Description Score Start End Superfamily
af_Q2FZC9_1_204_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8093 6 110 1.20.1300.10
2aczD01 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7784 6 112 1.20.1300.10
2wu5L00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7772 6 112 1.20.1300.10
2wdrL00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7701 6 111 1.20.1300.10
2ws3H00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7694 6 109 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A4Q0MKM4-F1-model_v4 Succinate dehydrogenase 0.9167 3 112 GO:0016020
GO:0046872
AF-A0A7C2Y7X0-F1-model_v4 Succinate dehydrogenase 0.8986 1 112 GO:0016020
GO:0046872
AF-A0A4Q0MKM4-F1-model_v4 Succinate dehydrogenase 0.894 3 112 GO:0016020
GO:0046872
AF-A0A845H315-F1-model_v4 deleted 0.8908 3 110
AF-A0A6J4LCV9-F1-model_v4 Succinate dehydrogenase hydrophobic anchor protein 0.8903 3 111 GO:0016020
GO:0046872

Map