F399336

General Info

Members Datasets Scaffolds Average Seq Length
307 130 265 177

Family's Representative Sequence

Representative Sequence 3300046491|Ga0495584_0020563|Ga0495584_0020563_113_694
Length 193
Sequence MSGFRKTFTAGRLMKMAITSGKTTQVVLASGIAMLLAGCGLTQKVTDGTVAVTKSIFYKQVKILHLDIRAREAMNNNAGGMALSTVVRIYQLKDRKAFDSTDYPSLFAADSQALKADLVAEKDIRLQPGGAMIVDMPMEENAQYVAVAGMFMSPDQVNNTWRVILSRDDLSPDKARIIEAGDNSLTLKPMKDD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
3 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
4 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
5 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
6 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
7 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
8 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
9 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
10 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
11 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
12 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
13 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
14 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
15 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
16 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
17 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
18 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
19 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
20 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
21 2821118458 Enterobacter asburiae 609 Isolate Unclassified
22 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
23 2865014394 Pantoea sp. R-71966 Isolate Unclassified
24 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
25 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
26 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
27 2919150387 Rahnella aceris 1817 Isolate Unclassified
28 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
29 2927143783 Rahnella sp. 2050 Isolate Unclassified
30 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
31 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
32 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
33 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
34 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
37 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
38 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
39 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
40 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
60 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
61 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
62 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
63 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
80 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
83 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
84 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
85 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
86 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
87 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
90 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
91 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
92 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
95 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
96 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
97 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
100 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
101 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
104 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
105 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
113 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
114 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
115 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
116 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
119 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
124 640753048 Serratia proteamaculans 568 Isolate Endosphere
125 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
126 8018221730 Enterobacter sp. CM29 Isolate Unclassified
127 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
128 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
129 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
130 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.64
Metatranscriptomes 0
Isolates 13.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.84
Nodule 3.91
Rhizoplane 6.84
Rhizosphere 47.23
Stem 0
Stem Tuber 0
Unclassified 35.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_679507 2162886007 Bacteria 1950
2 JGI25163J39215_1000582 3300002771 Bacteria 10262
3 JGI25164J39214_1000039 3300002772 Bacteria 129437
4 rootH2_10016568 3300003320 Bacteria 39258
5 Ga0055538_1000052 3300003751 Bacteria 129813
6 Ga0055539_1000077 3300003752 Bacteria 129445
7 Ga0055533_1000083 3300003756 Bacteria 129813
8 Ga0055525_1000110 3300003759 Bacteria 129813
9 Ga0055541_1000054 3300003841 Bacteria 129813
10 Ga0058692_1000407 3300003856 Bacteria 20298
11 Ga0058692_1000762 3300003856 Bacteria 12939
12 Ga0058692_1001942 3300003856 Bacteria 7208
13 Ga0058692_1019029 3300003856 Bacteria 1472
14 Ga0058692_1041980 3300003856 Bacteria 798
15 Ga0065704_10073401 3300005289 Bacteria 7207
16 Ga0065704_10114550 3300005289 Bacteria 1888
17 Ga0070659_100092108 3300005366 Bacteria 2430
18 Ga0070665_100000374 3300005548 Bacteria 66650
19 Ga0070665_100245937 3300005548 Bacteria 1789
20 Ga0070664_100991645 3300005564 Bacteria 789
21 Ga0068857_100000051 3300005577 Bacteria 64784
22 Ga0075364_10010982 3300006051 Bacteria 5491
23 Ga0075364_10369818 3300006051 Bacteria 978
24 Ga0079104_1000618 3300006946 Bacteria 34829
25 Ga0079104_1000776 3300006946 Bacteria 27238
26 Ga0079104_1001740 3300006946 Bacteria 13774
27 Ga0079104_1002899 3300006946 Bacteria 8556
28 Ga0079104_1005121 3300006946 Bacteria 5335
29 Ga0079104_1063871 3300006946 Bacteria 787
30 Ga0105251_10002512 3300009011 Bacteria 14321
31 Ga0105251_10008399 3300009011 Bacteria 6217
32 Ga0105251_10010310 3300009011 Bacteria 5433
33 Ga0105251_10011973 3300009011 Bacteria 4925
34 Ga0105251_10011994 3300009011 Bacteria 4919
35 Ga0105251_10022607 3300009011 Bacteria 3261
36 Ga0105251_10114716 3300009011 Bacteria 1226
37 Ga0105244_10000084 3300009036 Bacteria 103435
38 Ga0105244_10000494 3300009036 Bacteria 35545
39 Ga0105244_10001257 3300009036 Bacteria 20789
40 Ga0105244_10001485 3300009036 Bacteria 18822
41 Ga0105244_10002653 3300009036 Bacteria 13406
42 Ga0105244_10003034 3300009036 Bacteria 12327
43 Ga0105244_10018354 3300009036 Bacteria 3926
44 Ga0105244_10063586 3300009036 Bacteria 1853
45 Ga0105244_10079926 3300009036 Bacteria 1619
46 Ga0105244_10083358 3300009036 Bacteria 1580
47 Ga0105250_10000018 3300009092 Bacteria 246692
48 Ga0105250_10079544 3300009092 Bacteria 1328
49 Ga0105250_10081498 3300009092 Bacteria 1312
50 Ga0105250_10085073 3300009092 Bacteria 1284
51 Ga0105250_10087884 3300009092 Bacteria 1262
52 Ga0105237_11432035 3300009545 Bacteria 697
53 Ga0105246_11158755 3300011119 Bacteria 709
54 Ga0157373_10005544 3300013100 Bacteria 9463
55 Ga0157373_10049589 3300013100 Bacteria 2991
56 Ga0157371_10001518 3300013102 Bacteria 23987
57 Ga0157371_10004017 3300013102 Bacteria 13027
58 Ga0157369_10051460 3300013105 Bacteria 4457
59 Ga0157369_10055252 3300013105 Bacteria 4286
60 Ga0163162_10159488 3300013306 Bacteria 2377
61 Ga0157372_10018718 3300013307 Bacteria 7450
62 Ga0157372_10057630 3300013307 Bacteria 4342
63 Ga0183366_1001 3300015679 Bacteria 2743932
64 Ga0183370_1001 3300015680 Bacteria 2743932
65 Ga0183369_1001 3300015685 Bacteria 2743932
66 Ga0183368_1001 3300015687 Bacteria 2743932
67 Ga0209760_100067 3300025207 Bacteria 87264
68 Ga0209760_104012 3300025207 Bacteria 1281
69 Ga0209784_100012 3300025224 Bacteria 535823
70 Ga0209566_100010 3300025225 Bacteria 535823
71 Ga0209674_100023 3300025226 Bacteria 535823
72 Ga0209563_100027 3300025230 Bacteria 535823
73 Ga0207427_100017 3300025231 Bacteria 535823
74 Ga0209437_100029 3300025233 Bacteria 535823
75 Ga0209437_100100 3300025233 Bacteria 228479
76 Ga0209677_100014 3300025253 Bacteria 535823
77 Ga0209233_1001264 3300025261 Bacteria 10150
78 Ga0207696_1000013 3300025711 Bacteria 524881
79 Ga0207696_1000062 3300025711 Bacteria 239603
80 Ga0207696_1000874 3300025711 Bacteria 18759
81 Ga0207655_1000144 3300025728 Bacteria 136801
82 Ga0207655_1000185 3300025728 Bacteria 110202
83 Ga0207655_1001012 3300025728 Bacteria 28607
84 Ga0207655_1001135 3300025728 Bacteria 25953
85 Ga0207655_1021583 3300025728 Bacteria 3262
86 Ga0207713_1000007 3300025735 Bacteria 564979
87 Ga0207713_1000766 3300025735 Bacteria 29687
88 Ga0207713_1001503 3300025735 Bacteria 18425
89 Ga0207713_1018518 3300025735 Bacteria 3445
90 Ga0207713_1019903 3300025735 Bacteria 3269
91 Ga0207713_1050891 3300025735 Bacteria 1650
92 Ga0207713_1073829 3300025735 Bacteria 1250
93 Ga0207690_10130428 3300025932 Bacteria 1839
94 Ga0207679_10855386 3300025945 Bacteria 831
95 Ga0207668_10164101 3300025972 Bacteria 1734
96 Ga0207674_10001866 3300026116 Bacteria 26841
97 Ga0209281_1000284 3300027111 Bacteria 95457
98 Ga0209281_1000340 3300027111 Bacteria 79749
99 Ga0209281_1000378 3300027111 Bacteria 70786
100 Ga0209281_1000403 3300027111 Bacteria 66018
101 Ga0209281_1000613 3300027111 Bacteria 40172
102 Ga0209281_1002785 3300027111 Bacteria 6465
103 Ga0209371_1000001 3300027312 Bacteria 2771503
104 Ga0209371_1000036 3300027312 Bacteria 367250
105 Ga0209371_1000108 3300027312 Bacteria 141822
106 Ga0209371_1000532 3300027312 Bacteria 36173
107 Ga0209371_1000679 3300027312 Bacteria 29421
108 Ga0209371_1000984 3300027312 Bacteria 21939
109 Ga0209371_1002257 3300027312 Bacteria 11064
110 Ga0209371_1006904 3300027312 Bacteria 4089
111 Ga0209371_1007355 3300027312 Bacteria 3853
112 Ga0268266_10000894 3300028379 Bacteria 38498
113 Ga0268266_10104185 3300028379 Bacteria 2505
114 Ga0268256_1000001 3300030500 Bacteria 2771065
115 Ga0268256_1000076 3300030500 Bacteria 178295
116 Ga0268256_1000256 3300030500 Bacteria 56357
117 Ga0268256_1000563 3300030500 Bacteria 30009
118 Ga0268256_1001042 3300030500 Bacteria 18585
119 Ga0268256_1001147 3300030500 Bacteria 17118
120 Ga0268256_1001992 3300030500 Bacteria 11064
121 Ga0268256_1005875 3300030500 Bacteria 4699
122 Ga0268256_1007552 3300030500 Bacteria 3853
123 Ga0268256_1020394 3300030500 Bacteria 1787
124 Ga0439438_000237 3300041405 Bacteria 24714
125 Ga0439438_006020 3300041405 Bacteria 4364
126 Ga0439447_006132 3300041407 Bacteria 3929
127 Ga0439432_020375 3300042006 Bacteria 2205
128 Ga0439452_000406 3300042010 Bacteria 25323
129 Ga0439452_000952 3300042010 Bacteria 13001
130 Ga0495591_000268 3300046458 Bacteria 49284
131 Ga0495591_004277 3300046458 Bacteria 7056
132 Ga0495638_0000456 3300046460 Bacteria 48948
133 Ga0495650_0000047 3300046471 Bacteria 335136
134 Ga0495605_0056732 3300046474 Bacteria 1888
135 Ga0495584_0020563 3300046491 Bacteria 3351
136 Ga0495585_0051877 3300046492 Bacteria 2272
137 Ga0495606_0000556 3300046507 Bacteria 59586
138 Ga0495620_0086439 3300046515 Bacteria 1263
139 Ga0495648_0000368 3300046524 Bacteria 49770
140 Ga0495654_0000021 3300046530 Bacteria 270163
141 Ga0495654_0000439 3300046530 Bacteria 35336
142 Ga0495654_0091602 3300046530 Bacteria 1410
143 Ga0495668_0023083 3300046616 Bacteria 3551
144 Ga0495625_0007086 3300046660 Bacteria 9851
145 Ga0495649_0000032 3300046694 Bacteria 151121
146 Ga0495649_0000101 3300046694 Bacteria 75373
147 Ga0495649_0023166 3300046694 Bacteria 3469
148 Ga0495589_0000004 3300046794 Bacteria 439891
149 Ga0495589_0000028 3300046794 Bacteria 179523
150 Ga0495589_0000044 3300046794 Bacteria 125396
151 Ga0495660_0000006 3300046810 Bacteria 571713
152 Ga0495660_0000010 3300046810 Bacteria 370769
153 Ga0495660_0019817 3300046810 Bacteria 3860
154 Ga0495672_0000038 3300047320 Bacteria 273489
155 Ga0495672_0000039 3300047320 Bacteria 272506
156 Ga0495672_0000062 3300047320 Bacteria 211745
157 Ga0495683_0000771 3300047323 Bacteria 23048
158 Ga0495679_000082 3300047446 Bacteria 87565
159 Ga0495679_001463 3300047446 Bacteria 13389
160 Ga0495679_020321 3300047446 Bacteria 2314
161 Ga0495673_0027272 3300047469 Bacteria 2721
162 Ga0496100_0052712 3300048903 Bacteria 2646
163 Ga0496101_0001277 3300048904 Bacteria 15057
164 Ga0496101_0010177 3300048904 Bacteria 6205
165 Ga0496102_0011469 3300048905 Bacteria 7642
166 Ga0496103_0068535 3300048906 Bacteria 2217
167 Ga0496104_0028398 3300048907 Bacteria 5186
168 Ga0496113_0301202 3300048916 Bacteria 1284
169 Ga0496113_0324718 3300048916 Bacteria 1234
170 Ga0496116_0000020 3300048919 Bacteria 501307
171 Ga0496116_0000565 3300048919 Bacteria 49511
172 Ga0496116_0003500 3300048919 Bacteria 15455
173 Ga0496116_0004321 3300048919 Bacteria 13593
174 Ga0496116_0012954 3300048919 Bacteria 6765
175 Ga0496116_0152409 3300048919 Bacteria 1281
176 Ga0496117_0000078 3300048920 Bacteria 227068
177 Ga0496117_0002867 3300048920 Bacteria 20953
178 Ga0496117_0009259 3300048920 Bacteria 9202
179 Ga0496117_0017373 3300048920 Bacteria 6007
180 Ga0496117_0022266 3300048920 Bacteria 5087
181 Ga0496117_0061613 3300048920 Bacteria 2577
182 Ga0496117_0132915 3300048920 Bacteria 1504
183 Ga0496118_0000059 3300048921 Bacteria 226336
184 Ga0496118_0001133 3300048921 Bacteria 41145
185 Ga0496118_0007515 3300048921 Bacteria 11522
186 Ga0496118_0020487 3300048921 Bacteria 5860
187 Ga0496118_0053516 3300048921 Bacteria 3067
188 Ga0496118_0075317 3300048921 Bacteria 2407
189 Ga0496118_0122779 3300048921 Bacteria 1688
190 Ga0496118_0224255 3300048921 Bacteria 1091
191 Ga0496119_0001327 3300048922 Bacteria 30412
192 Ga0496119_0003248 3300048922 Bacteria 17000
193 Ga0496119_0003919 3300048922 Bacteria 15099
194 Ga0496119_0006071 3300048922 Bacteria 11317
195 Ga0496119_0010497 3300048922 Bacteria 7786
196 Ga0496119_0021460 3300048922 Bacteria 4668
197 Ga0496119_0048103 3300048922 Bacteria 2647
198 Ga0496119_0062402 3300048922 Bacteria 2221
199 Ga0496119_0090545 3300048922 Bacteria 1739
200 Ga0496119_0136678 3300048922 Bacteria 1328
201 Ga0496119_0226345 3300048922 Bacteria 954
202 Ga0496120_0001921 3300048923 Bacteria 22931
203 Ga0496120_0001953 3300048923 Bacteria 22587
204 Ga0496120_0001960 3300048923 Bacteria 22495
205 Ga0496120_0003376 3300048923 Bacteria 14619
206 Ga0496120_0003598 3300048923 Bacteria 13917
207 Ga0496120_0003645 3300048923 Bacteria 13801
208 Ga0496120_0016896 3300048923 Bacteria 4750
209 Ga0496120_0027505 3300048923 Bacteria 3496
210 Ga0496120_0069486 3300048923 Bacteria 1939
211 Ga0496120_0097017 3300048923 Bacteria 1564
212 Ga0496121_0000558 3300048924 Bacteria 70344
213 Ga0496121_0007331 3300048924 Bacteria 13335
214 Ga0496121_0028027 3300048924 Bacteria 5254
215 Ga0496121_0042201 3300048924 Bacteria 3972
216 Ga0496121_0129969 3300048924 Bacteria 1887
217 Ga0496121_0207555 3300048924 Bacteria 1390
218 Ga0496122_0000010 3300048925 Bacteria 547417
219 Ga0496122_0001508 3300048925 Bacteria 37124
220 Ga0496122_0006040 3300048925 Bacteria 14121
221 Ga0496122_0016165 3300048925 Bacteria 7087
222 Ga0496122_0027607 3300048925 Bacteria 4845
223 Ga0496122_0045508 3300048925 Bacteria 3410
224 Ga0496122_0054495 3300048925 Bacteria 3002
225 Ga0496122_0056133 3300048925 Bacteria 2938
226 Ga0496123_0000061 3300048926 Bacteria 220856
227 Ga0496123_0002129 3300048926 Bacteria 25333
228 Ga0496123_0003650 3300048926 Bacteria 17021
229 Ga0496123_0009094 3300048926 Bacteria 8994
230 Ga0496123_0012609 3300048926 Bacteria 7185
231 Ga0496123_0015400 3300048926 Bacteria 6273
232 Ga0496123_0020292 3300048926 Bacteria 5203
233 Ga0496123_0028768 3300048926 Bacteria 4107
234 Ga0496123_0253080 3300048926 Bacteria 868
235 Ga0496123_0265875 3300048926 Bacteria 837
236 Ga0496124_0000642 3300048927 Bacteria 57689
237 Ga0496124_0001117 3300048927 Bacteria 42230
238 Ga0496124_0003042 3300048927 Bacteria 20939
239 Ga0496124_0003080 3300048927 Bacteria 20763
240 Ga0496124_0009922 3300048927 Bacteria 9734
241 Ga0496124_0018642 3300048927 Bacteria 6492
242 Ga0496124_0045875 3300048927 Bacteria 3745
243 Ga0496124_0047737 3300048927 Bacteria 3661
244 Ga0496124_0062578 3300048927 Bacteria 3113
245 Ga0496124_0204565 3300048927 Bacteria 1498
246 Ga0496124_0204934 3300048927 Bacteria 1496
247 Ga0496124_0598266 3300048927 Bacteria 718
248 Ga0496125_0000071 3300048928 Bacteria 243580
249 Ga0496125_0001338 3300048928 Bacteria 36325
250 Ga0496125_0021787 3300048928 Bacteria 5962
251 Ga0496125_0052731 3300048928 Bacteria 3342
252 Ga0496125_0112138 3300048928 Bacteria 1971
253 Ga0496125_0335725 3300048928 Bacteria 909
254 Ga0496126_0000472 3300048929 Bacteria 79898
255 Ga0496126_0002685 3300048929 Bacteria 23504
256 Ga0496126_0029939 3300048929 Bacteria 5166
257 Ga0496126_0034602 3300048929 Bacteria 4743
258 Ga0496126_0036431 3300048929 Bacteria 4600
259 Ga0496126_0047550 3300048929 Bacteria 3927
260 Ga0496126_0066389 3300048929 Bacteria 3226
261 Ga0496126_0080454 3300048929 Bacteria 2883
262 Ga0496126_0128825 3300048929 Bacteria 2188
263 Ga0496126_0273742 3300048929 Bacteria 1400
264 Ga0496126_0471454 3300048929 Bacteria 1007
265 Ga0495678_002198 3300049459 Bacteria 13677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009036 Ga0105244_10063586 Ga0105244_100635863 160
2 3300025207 Ga0209760_104012 Ga0209760_1040122 161
3 3300009036 Ga0105244_10001257 Ga0105244_100012576 163
4 3300013307 Ga0157372_10057630 Ga0157372_100576303 163
5 3300048919 Ga0496116_0000565 Ga0496116_0000565_7203_7700 163
6 3300048927 Ga0496124_0003042 Ga0496124_0003042_10603_11100 163
7 3300009011 Ga0105251_10010310 Ga0105251_100103102 165
8 3300009036 Ga0105244_10018354 Ga0105244_100183544 165
9 3300048919 Ga0496116_0004321 Ga0496116_0004321_3681_4178 165
10 3300048922 Ga0496119_0226345 Ga0496119_0226345_337_834 165
11 3300048924 Ga0496121_0000558 Ga0496121_0000558_39761_40258 165
12 3300048926 Ga0496123_0253080 Ga0496123_0253080_288_785 165
13 3300048929 Ga0496126_0029939 Ga0496126_0029939_1305_1802 165
14 3300048929 Ga0496126_0066389 Ga0496126_0066389_275_772 165
15 3300048929 Ga0496126_0080454 Ga0496126_0080454_175_672 165
16 3300009011 Ga0105251_10114716 Ga0105251_101147162 167
17 3300009092 Ga0105250_10000018 Ga0105250_100000188 167
18 3300013306 Ga0163162_10159488 Ga0163162_101594882 167
19 3300025711 Ga0207696_1000062 Ga0207696_1000062226 167
20 3300046530 Ga0495654_0000021 Ga0495654_0000021_264792_265325 167
21 3300046616 Ga0495668_0023083 Ga0495668_0023083_2205_2738 167
22 3300048903 Ga0496100_0052712 Ga0496100_0052712_337_870 167
23 3300048904 Ga0496101_0001277 Ga0496101_0001277_7944_8477 167
24 3300048916 Ga0496113_0301202 Ga0496113_0301202_493_1002 167
25 3300048919 Ga0496116_0012954 Ga0496116_0012954_4895_5404 167
26 3300048921 Ga0496118_0075317 Ga0496118_0075317_1648_2157 167
27 3300048922 Ga0496119_0010497 Ga0496119_0010497_2590_3123 167
28 3300048922 Ga0496119_0021460 Ga0496119_0021460_498_1007 167
29 3300048922 Ga0496119_0048103 Ga0496119_0048103_1792_2301 167
30 3300048922 Ga0496119_0062402 Ga0496119_0062402_329_859 167
31 3300048923 Ga0496120_0001960 Ga0496120_0001960_15780_16313 167
32 3300048923 Ga0496120_0003645 Ga0496120_0003645_10379_10909 167
33 3300048923 Ga0496120_0016896 Ga0496120_0016896_1714_2223 167
34 3300048923 Ga0496120_0097017 Ga0496120_0097017_280_789 167
35 3300048924 Ga0496121_0028027 Ga0496121_0028027_2650_3159 167
36 3300048925 Ga0496122_0001508 Ga0496122_0001508_3578_4084 167
37 3300048925 Ga0496122_0016165 Ga0496122_0016165_1905_2438 167
38 3300048925 Ga0496122_0027607 Ga0496122_0027607_686_1195 167
39 3300048925 Ga0496122_0054495 Ga0496122_0054495_1808_2317 167
40 3300048926 Ga0496123_0003650 Ga0496123_0003650_9509_10039 167
41 3300048926 Ga0496123_0009094 Ga0496123_0009094_4014_4523 167
42 3300048926 Ga0496123_0012609 Ga0496123_0012609_4666_5199 167
43 3300048926 Ga0496123_0020292 Ga0496123_0020292_4250_4756 167
44 3300048926 Ga0496123_0028768 Ga0496123_0028768_1842_2351 167
45 3300048927 Ga0496124_0000642 Ga0496124_0000642_53549_54058 167
46 3300048927 Ga0496124_0018642 Ga0496124_0018642_5909_6418 167
47 3300048927 Ga0496124_0062578 Ga0496124_0062578_1745_2278 167
48 3300048928 Ga0496125_0021787 Ga0496125_0021787_1745_2254 167
49 3300048928 Ga0496125_0052731 Ga0496125_0052731_2480_2989 167
50 3300048928 Ga0496125_0112138 Ga0496125_0112138_92_601 167
51 3300048929 Ga0496126_0000472 Ga0496126_0000472_47195_47725 167
52 3300048929 Ga0496126_0036431 Ga0496126_0036431_1769_2278 167
53 3300048929 Ga0496126_0047550 Ga0496126_0047550_1721_2254 167
54 iso_pu_bacteria 8016733728 8016735494 167
55 iso_pu_bacteria 8019499862 8019501118 167
56 3300047446 Ga0495679_020321 Ga0495679_020321_1502_2038 168
57 3300009092 Ga0105250_10079544 Ga0105250_100795442 169
58 3300048919 Ga0496116_0152409 Ga0496116_0152409_599_1117 169
59 3300048920 Ga0496117_0022266 Ga0496117_0022266_4110_4628 169
60 3300048921 Ga0496118_0001133 Ga0496118_0001133_7567_8085 169
61 3300048922 Ga0496119_0003248 Ga0496119_0003248_12212_12730 169
62 3300048923 Ga0496120_0001921 Ga0496120_0001921_18143_18661 169
63 3300048924 Ga0496121_0129969 Ga0496121_0129969_559_1077 169
64 3300048927 Ga0496124_0204934 Ga0496124_0204934_605_1123 169
65 3300002771 JGI25163J39215_1000582 JGI25163J39215_10005827 170
66 3300002772 JGI25164J39214_1000039 JGI25164J39214_10000395 170
67 3300003320 rootH2_10016568 rootH2_1001656815 170
68 3300003751 Ga0055538_1000052 Ga0055538_10000525 170
69 3300003752 Ga0055539_1000077 Ga0055539_10000775 170
70 3300003756 Ga0055533_1000083 Ga0055533_10000835 170
71 3300003759 Ga0055525_1000110 Ga0055525_10001105 170
72 3300003841 Ga0055541_1000054 Ga0055541_10000545 170
73 3300003856 Ga0058692_1000407 Ga0058692_10004078 170
74 3300003856 Ga0058692_1000762 Ga0058692_100076213 170
75 3300003856 Ga0058692_1001942 Ga0058692_10019424 170
76 3300003856 Ga0058692_1019029 Ga0058692_10190292 170
77 3300005289 Ga0065704_10114550 Ga0065704_101145502 170
78 3300005548 Ga0070665_100000374 Ga0070665_1000003746 170
79 3300006051 Ga0075364_10369818 Ga0075364_103698182 170
80 3300006946 Ga0079104_1000618 Ga0079104_100061828 170
81 3300006946 Ga0079104_1000776 Ga0079104_10007763 170
82 3300006946 Ga0079104_1001740 Ga0079104_10017403 170
83 3300006946 Ga0079104_1002899 Ga0079104_10028993 170
84 3300009011 Ga0105251_10002512 Ga0105251_1000251211 170
85 3300009011 Ga0105251_10011994 Ga0105251_100119942 170
86 3300009011 Ga0105251_10022607 Ga0105251_100226072 170
87 3300009036 Ga0105244_10001485 Ga0105244_1000148516 170
88 3300009036 Ga0105244_10079926 Ga0105244_100799262 170
89 3300009092 Ga0105250_10081498 Ga0105250_100814982 170
90 3300009092 Ga0105250_10085073 Ga0105250_100850733 170
91 3300009092 Ga0105250_10087884 Ga0105250_100878842 170
92 3300009545 Ga0105237_11432035 Ga0105237_114320352 170
93 3300013100 Ga0157373_10049589 Ga0157373_100495893 170
94 3300013102 Ga0157371_10001518 Ga0157371_1000151816 170
95 3300013105 Ga0157369_10055252 Ga0157369_100552524 170
96 3300015679 Ga0183366_1001 Ga0183366_10012444 170
97 3300015680 Ga0183370_1001 Ga0183370_10012444 170
98 3300015685 Ga0183369_1001 Ga0183369_10012445 170
99 3300015687 Ga0183368_1001 Ga0183368_10012444 170
100 3300025207 Ga0209760_100067 Ga0209760_1000677 170
101 3300025224 Ga0209784_100012 Ga0209784_100012494 170
102 3300025225 Ga0209566_100010 Ga0209566_100010494 170
103 3300025226 Ga0209674_100023 Ga0209674_100023494 170
104 3300025230 Ga0209563_100027 Ga0209563_100027494 170
105 3300025231 Ga0207427_100017 Ga0207427_100017494 170
106 3300025233 Ga0209437_100029 Ga0209437_100029494 170
107 3300025253 Ga0209677_100014 Ga0209677_100014494 170
108 3300025261 Ga0209233_1001264 Ga0209233_10012646 170
109 3300025711 Ga0207696_1000874 Ga0207696_100087418 170
110 3300025728 Ga0207655_1001135 Ga0207655_10011353 170
111 3300025735 Ga0207713_1000766 Ga0207713_100076622 170
112 3300025735 Ga0207713_1019903 Ga0207713_10199034 170
113 3300025735 Ga0207713_1050891 Ga0207713_10508912 170
114 3300025735 Ga0207713_1073829 Ga0207713_10738292 170
115 3300025972 Ga0207668_10164101 Ga0207668_101641012 170
116 3300027111 Ga0209281_1000284 Ga0209281_100028415 170
117 3300027111 Ga0209281_1000340 Ga0209281_100034033 170
118 3300027111 Ga0209281_1000378 Ga0209281_100037842 170
119 3300027111 Ga0209281_1000613 Ga0209281_100061334 170
120 3300027312 Ga0209371_1000001 Ga0209371_10000012306 170
121 3300027312 Ga0209371_1000108 Ga0209371_1000108103 170
122 3300027312 Ga0209371_1000984 Ga0209371_10009849 170
123 3300027312 Ga0209371_1006904 Ga0209371_10069043 170
124 3300028379 Ga0268266_10000894 Ga0268266_100008945 170
125 3300030500 Ga0268256_1000001 Ga0268256_1000001334 170
126 3300030500 Ga0268256_1000076 Ga0268256_100007698 170
127 3300030500 Ga0268256_1000256 Ga0268256_100025638 170
128 3300030500 Ga0268256_1005875 Ga0268256_10058755 170
129 3300041405 Ga0439438_000237 Ga0439438_000237_23879_24421 170
130 3300041405 Ga0439438_006020 Ga0439438_006020_1596_2132 170
131 3300041407 Ga0439447_006132 Ga0439447_006132_2732_3268 170
132 3300042010 Ga0439452_000952 Ga0439452_000952_772_1314 170
133 3300046458 Ga0495591_004277 Ga0495591_004277_2619_3161 170
134 3300046471 Ga0495650_0000047 Ga0495650_0000047_667_1209 170
135 3300046474 Ga0495605_0056732 Ga0495605_0056732_678_1220 170
136 3300046491 Ga0495584_0020563 Ga0495584_0020563_113_694 170
137 3300046507 Ga0495606_0000556 Ga0495606_0000556_29870_30412 170
138 3300046515 Ga0495620_0086439 Ga0495620_0086439_467_1009 170
139 3300046524 Ga0495648_0000368 Ga0495648_0000368_30735_31277 170
140 3300046660 Ga0495625_0007086 Ga0495625_0007086_7718_8260 170
141 3300046694 Ga0495649_0000032 Ga0495649_0000032_131865_132407 170
142 3300046694 Ga0495649_0000032 Ga0495649_0000032_19764_20306 170
143 3300046694 Ga0495649_0023166 Ga0495649_0023166_1102_1644 170
144 3300046794 Ga0495589_0000028 Ga0495589_0000028_48789_49331 170
145 3300046810 Ga0495660_0000006 Ga0495660_0000006_480051_480593 170
146 3300046810 Ga0495660_0000010 Ga0495660_0000010_209709_210251 170
147 3300047320 Ga0495672_0000039 Ga0495672_0000039_114397_114939 170
148 3300047320 Ga0495672_0000062 Ga0495672_0000062_120651_121193 170
149 3300047323 Ga0495683_0000771 Ga0495683_0000771_5477_6019 170
150 3300047446 Ga0495679_000082 Ga0495679_000082_15215_15757 170
151 3300047469 Ga0495673_0027272 Ga0495673_0027272_733_1275 170
152 3300048904 Ga0496101_0010177 Ga0496101_0010177_4830_5372 170
153 3300048907 Ga0496104_0028398 Ga0496104_0028398_3514_4056 170
154 3300048919 Ga0496116_0000020 Ga0496116_0000020_496013_496555 170
155 3300048920 Ga0496117_0002867 Ga0496117_0002867_15933_16475 170
156 3300048920 Ga0496117_0009259 Ga0496117_0009259_4611_5153 170
157 3300048920 Ga0496117_0017373 Ga0496117_0017373_5127_5669 170
158 3300048920 Ga0496117_0061613 Ga0496117_0061613_1245_1787 170
159 3300048920 Ga0496117_0132915 Ga0496117_0132915_747_1289 170
160 3300048921 Ga0496118_0007515 Ga0496118_0007515_923_1465 170
161 3300048921 Ga0496118_0020487 Ga0496118_0020487_3809_4351 170
162 3300048921 Ga0496118_0053516 Ga0496118_0053516_339_881 170
163 3300048921 Ga0496118_0122779 Ga0496118_0122779_335_877 170
164 3300048921 Ga0496118_0224255 Ga0496118_0224255_73_615 170
165 3300048922 Ga0496119_0001327 Ga0496119_0001327_3622_4164 170
166 3300048922 Ga0496119_0136678 Ga0496119_0136678_701_1243 170
167 3300048923 Ga0496120_0001953 Ga0496120_0001953_3622_4164 170
168 3300048923 Ga0496120_0069486 Ga0496120_0069486_904_1446 170
169 3300048924 Ga0496121_0007331 Ga0496121_0007331_11993_12535 170
170 3300048924 Ga0496121_0042201 Ga0496121_0042201_2533_3075 170
171 3300048924 Ga0496121_0207555 Ga0496121_0207555_543_1085 170
172 3300048925 Ga0496122_0000010 Ga0496122_0000010_196495_197037 170
173 3300048925 Ga0496122_0045508 Ga0496122_0045508_2129_2671 170
174 3300048925 Ga0496122_0056133 Ga0496122_0056133_2187_2729 170
175 3300048926 Ga0496123_0000061 Ga0496123_0000061_19641_20183 170
176 3300048926 Ga0496123_0015400 Ga0496123_0015400_708_1250 170
177 3300048926 Ga0496123_0265875 Ga0496123_0265875_210_752 170
178 3300048927 Ga0496124_0003080 Ga0496124_0003080_820_1362 170
179 3300048927 Ga0496124_0045875 Ga0496124_0045875_2629_3165 170
180 3300048927 Ga0496124_0598266 Ga0496124_0598266_29_571 170
181 3300048928 Ga0496125_0000071 Ga0496125_0000071_20190_20732 170
182 3300048929 Ga0496126_0002685 Ga0496126_0002685_3699_4241 170
183 3300048929 Ga0496126_0034602 Ga0496126_0034602_2935_3477 170
184 3300048929 Ga0496126_0128825 Ga0496126_0128825_751_1293 170
185 3300048929 Ga0496126_0273742 Ga0496126_0273742_84_626 170
186 3300048929 Ga0496126_0471454 Ga0496126_0471454_98_640 170
187 3300049459 Ga0495678_002198 Ga0495678_002198_10293_10835 170
188 iso_pu_bacteria 2585427592 2585831564 170
189 iso_pu_bacteria 2600255256 2601535467 170
190 iso_pu_bacteria 2600255257 2601540024 170
191 iso_pu_bacteria 2600255310 2601758647 170
192 iso_pu_bacteria 2600255311 2601764761 170
193 iso_pu_bacteria 2602042046 2603636807 170
194 iso_pu_bacteria 2602042047 2603645427 170
195 iso_pu_bacteria 2667528172 2671101048 170
196 iso_pu_bacteria 2711768156 2712468968 170
197 iso_pu_bacteria 2791354903 2791922414 170
198 iso_pu_bacteria 2814123068 2814695361 170
199 iso_pu_bacteria 2865014394 2865016630 170
200 iso_pu_bacteria 2869551831 2869553676 170
201 iso_pu_bacteria 2904474040 2904476924 170
202 iso_pu_bacteria 2919150387 2919153093 170
203 iso_pu_bacteria 2923634449 2923635153 170
204 iso_pu_bacteria 2927143783 2927147054 170
205 iso_pu_bacteria 2939607340 2939610980 170
206 iso_pu_bacteria 8054844752 8054848012 170
207 iso_pu_bacteria 8054849141 8054851690 170
208 iso_pu_bacteria 2808606414 2809125285 172
209 iso_pu_bacteria 8054844752 8054848060 172
210 2162886007 SwRhRL2b_contig_679507 SwRhRL2b_0127.00000990 173
211 3300003856 Ga0058692_1041980 Ga0058692_10419802 173
212 3300005289 Ga0065704_10073401 Ga0065704_100734015 173
213 3300005366 Ga0070659_100092108 Ga0070659_1000921082 173
214 3300005548 Ga0070665_100245937 Ga0070665_1002459372 173
215 3300005564 Ga0070664_100991645 Ga0070664_1009916452 173
216 3300005577 Ga0068857_100000051 Ga0068857_10000005159 173
217 3300006051 Ga0075364_10010982 Ga0075364_100109822 173
218 3300006946 Ga0079104_1005121 Ga0079104_10051216 173
219 3300006946 Ga0079104_1063871 Ga0079104_10638712 173
220 3300009011 Ga0105251_10008399 Ga0105251_100083992 173
221 3300009011 Ga0105251_10011973 Ga0105251_100119735 173
222 3300009036 Ga0105244_10000084 Ga0105244_100000845 173
223 3300009036 Ga0105244_10000494 Ga0105244_1000049429 173
224 3300009036 Ga0105244_10002653 Ga0105244_100026539 173
225 3300009036 Ga0105244_10003034 Ga0105244_100030344 173
226 3300009036 Ga0105244_10083358 Ga0105244_100833582 173
227 3300011119 Ga0105246_11158755 Ga0105246_111587552 173
228 3300013100 Ga0157373_10005544 Ga0157373_100055442 173
229 3300013102 Ga0157371_10004017 Ga0157371_100040172 173
230 3300013105 Ga0157369_10051460 Ga0157369_100514602 173
231 3300013307 Ga0157372_10018718 Ga0157372_100187185 173
232 3300025233 Ga0209437_100100 Ga0209437_100100118 173
233 3300025711 Ga0207696_1000013 Ga0207696_1000013400 173
234 3300025728 Ga0207655_1000144 Ga0207655_100014469 173
235 3300025728 Ga0207655_1000185 Ga0207655_100018588 173
236 3300025728 Ga0207655_1001012 Ga0207655_100101218 173
237 3300025728 Ga0207655_1021583 Ga0207655_10215834 173
238 3300025735 Ga0207713_1000007 Ga0207713_1000007389 173
239 3300025735 Ga0207713_1001503 Ga0207713_10015034 173
240 3300025735 Ga0207713_1018518 Ga0207713_10185183 173
241 3300025932 Ga0207690_10130428 Ga0207690_101304282 173
242 3300025945 Ga0207679_10855386 Ga0207679_108553862 173
243 3300026116 Ga0207674_10001866 Ga0207674_1000186613 173
244 3300027111 Ga0209281_1000403 Ga0209281_10004033 173
245 3300027111 Ga0209281_1002785 Ga0209281_10027857 173
246 3300027312 Ga0209371_1000036 Ga0209371_1000036325 173
247 3300027312 Ga0209371_1000532 Ga0209371_10005326 173
248 3300027312 Ga0209371_1000679 Ga0209371_100067920 173
249 3300027312 Ga0209371_1002257 Ga0209371_10022577 173
250 3300027312 Ga0209371_1007355 Ga0209371_10073554 173
251 3300028379 Ga0268266_10104185 Ga0268266_101041852 173
252 3300030500 Ga0268256_1000563 Ga0268256_100056321 173
253 3300030500 Ga0268256_1001042 Ga0268256_100104213 173
254 3300030500 Ga0268256_1001147 Ga0268256_10011476 173
255 3300030500 Ga0268256_1001992 Ga0268256_10019927 173
256 3300030500 Ga0268256_1007552 Ga0268256_10075524 173
257 3300030500 Ga0268256_1020394 Ga0268256_10203942 173
258 3300042006 Ga0439432_020375 Ga0439432_020375_191_736 173
259 3300042010 Ga0439452_000406 Ga0439452_000406_18720_19250 173
260 3300046458 Ga0495591_000268 Ga0495591_000268_19193_19738 173
261 3300046460 Ga0495638_0000456 Ga0495638_0000456_29239_29784 173
262 3300046492 Ga0495585_0051877 Ga0495585_0051877_339_884 173
263 3300046530 Ga0495654_0000439 Ga0495654_0000439_4935_5465 173
264 3300046530 Ga0495654_0091602 Ga0495654_0091602_57_602 173
265 3300046694 Ga0495649_0000101 Ga0495649_0000101_62438_62983 173
266 3300046794 Ga0495589_0000004 Ga0495589_0000004_439078_439608 173
267 3300046794 Ga0495589_0000044 Ga0495589_0000044_122370_122900 173
268 3300046810 Ga0495660_0019817 Ga0495660_0019817_1162_1707 173
269 3300047320 Ga0495672_0000038 Ga0495672_0000038_16936_17481 173
270 3300047446 Ga0495679_001463 Ga0495679_001463_11478_12023 173
271 3300048905 Ga0496102_0011469 Ga0496102_0011469_6573_7118 173
272 3300048906 Ga0496103_0068535 Ga0496103_0068535_1113_1658 173
273 3300048916 Ga0496113_0324718 Ga0496113_0324718_118_663 173
274 3300048919 Ga0496116_0003500 Ga0496116_0003500_826_1371 173
275 3300048920 Ga0496117_0000078 Ga0496117_0000078_70366_70911 173
276 3300048921 Ga0496118_0000059 Ga0496118_0000059_156158_156703 173
277 3300048922 Ga0496119_0003919 Ga0496119_0003919_4568_5098 173
278 3300048922 Ga0496119_0006071 Ga0496119_0006071_9565_10110 173
279 3300048922 Ga0496119_0090545 Ga0496119_0090545_449_994 173
280 3300048923 Ga0496120_0003376 Ga0496120_0003376_4088_4618 173
281 3300048923 Ga0496120_0003598 Ga0496120_0003598_13067_13612 173
282 3300048923 Ga0496120_0027505 Ga0496120_0027505_1031_1576 173
283 3300048925 Ga0496122_0006040 Ga0496122_0006040_10213_10758 173
284 3300048926 Ga0496123_0002129 Ga0496123_0002129_5479_6024 173
285 3300048927 Ga0496124_0001117 Ga0496124_0001117_39695_40240 173
286 3300048927 Ga0496124_0009922 Ga0496124_0009922_1801_2331 173
287 3300048927 Ga0496124_0047737 Ga0496124_0047737_16_561 173
288 3300048927 Ga0496124_0204565 Ga0496124_0204565_585_1130 173
289 3300048928 Ga0496125_0001338 Ga0496125_0001338_31149_31694 173
290 3300048928 Ga0496125_0335725 Ga0496125_0335725_237_830 173
291 iso_pu_bacteria 2508501071 2508851764 173
292 iso_pu_bacteria 2547132416 2548648953 173
293 iso_pu_bacteria 2602042066 2603698694 173
294 iso_pu_bacteria 2602042067 2603705430 173
295 iso_pu_bacteria 2608642108 2608670765 173
296 iso_pu_bacteria 2671180115 2671587653 173
297 iso_pu_bacteria 2681812866 2681996161 173
298 iso_pu_bacteria 2791354903 2791923214 173
299 iso_pu_bacteria 2821118458 2821121101 173
300 iso_pu_bacteria 2844528606 2844529199 173
301 iso_pu_bacteria 2881609920 2881610197 173
302 iso_pu_bacteria 2923634449 2923635953 173
303 iso_pu_bacteria 2927833300 2927837552 173
304 iso_pu_bacteria 2939602548 2939604884 173
305 iso_pu_bacteria 640753048 640937334 173
306 iso_pu_bacteria 8018221730 8018225600 173
307 iso_pu_bacteria 8055087960 8055088924 173

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12790

T6SS-SciN

Type VI secretion lipoprotein, VasD, EvfM, TssJ, VC_A0113

62

183

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y7o-assembly1.cif.gz_C t6ss protein tssm c-terminal domain (869-1107) from eaec 0.9672 38 170
4y7o-assembly1.cif.gz_C t6ss protein tssm c-terminal domain (869-1107) from eaec 0.9595 38 170
6hs7-assembly1.cif.gz_F type vi membrane complex 0.9374 37 169
6hs7-assembly1.cif.gz_F type vi membrane complex 0.9305 37 169
4y7o-assembly2.cif.gz_D t6ss protein tssm c-terminal domain (869-1107) from eaec 0.9266 41 168
ID Description Score Start End Superfamily
6ixhK00 Mainly Beta;Sandwich;Immunoglobulin-like;Type VI secretion system, lipoprotein SciN 0.9475 38 170 2.60.40.4150
6ixhK00 Mainly Beta;Sandwich;Immunoglobulin-like;Type VI secretion system, lipoprotein SciN 0.9401 38 170 2.60.40.4150
4a1rB00 Mainly Beta;Sandwich;Immunoglobulin-like;Type VI secretion system, lipoprotein SciN 0.8362 37 172 2.60.40.4150
4a1rB00 Mainly Beta;Sandwich;Immunoglobulin-like;Type VI secretion system, lipoprotein SciN 0.8083 37 172 2.60.40.4150
3zhnA00 Mainly Beta;Sandwich;Immunoglobulin-like;Type VI secretion system, lipoprotein SciN 0.7609 37 171 2.60.40.4150
ID Description Score Start End GO Terms
AF-A0A2N4YPS2-F1-model_v4 Type VI secretion system lipoprotein TssJ 0.983 34 173
AF-A0A7H4NHT7-F1-model_v4 deleted 0.9786 67 172
AF-A0A2N4YPS2-F1-model_v4 Type VI secretion system lipoprotein TssJ 0.9692 34 173
AF-E5B9N0-F1-model_v4 Uncharacterized protein 0.9642 57 172
AF-A0A7H4NHT7-F1-model_v4 deleted 0.9607 67 172

Feature Viewer

pLDDT pTM Quality
83.11 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map