F399332

General Info

Members Datasets Scaffolds Average Seq Length
307 200 307 384

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0001787|Ga0495580_0001787_4056_5327
Length 423
Sequence MIVAGVMSGTSADGINVALVRVRESQTLGSRRRSAKSVGQECPTHMGLGSAKLELLGHAEFAYPAGVRRAVLGAMNAPRARVADLARLNFRLGELYADAVLAAQKKLRVKAELVGCHGQTLYHQGTAATFLSKKLAVTWQTGEAAVIAARVGVPVVSDFRPGDMAAGGQGAPLVPYLDYILYRDPKVGRIAQNIGGIANLTAIPAGASRDDIIALDTGPGNMVIDALSERLFGTRFDRDGEIAGSGRVRDEAVTRFLRGSFFRQKPPKTAGREEFGREFAWEFLRVCRMSQPLNNAKGGAAGSASALSRKIETCDVMATATAFTARSISDAIERFVLPEGKYSELIVSGGGAKNATLMAMLANEVRDLGLRLRSSDEFGIPSEAKEAVAFALLAFETWNRRPSNVPSATGARRAAVLGKVAYP

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
85 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
86 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
132 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 1.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.89
Rhizosphere 94.14
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10110409 3300005327 Unclassified 2278
2 Ga0070683_100004635 3300005329 Bacteria 11354
3 Ga0070683_100020788 3300005329 Bacteria 5847
4 Ga0070670_100014084 3300005331 Bacteria 6860
5 Ga0070677_10021467 3300005333 Bacteria 2369
6 Ga0070666_10024735 3300005335 Bacteria 3914
7 Ga0068868_100098498 3300005338 Bacteria 2364
8 Ga0068868_100261427 3300005338 Bacteria 1460
9 Ga0070660_100000802 3300005339 Bacteria 20852
10 Ga0070689_100002279 3300005340 Bacteria 12479
11 Ga0070661_100033903 3300005344 Bacteria 3701
12 Ga0070661_100067440 3300005344 Bacteria 2629
13 Ga0070669_100014103 3300005353 Bacteria 5685
14 Ga0070674_100238838 3300005356 Bacteria 1421
15 Ga0070688_100000324 3300005365 Bacteria 24448
16 Ga0070659_100045544 3300005366 Bacteria 3436
17 Ga0070709_10027145 3300005434 Bacteria 3402
18 Ga0070714_100000060 3300005435 Bacteria 100913
19 Ga0070714_100113705 3300005435 Bacteria 2400
20 Ga0070714_100166645 3300005435 Bacteria 1997
21 Ga0070713_100001036 3300005436 Bacteria 17798
22 Ga0070713_100002374 3300005436 Bacteria 12270
23 Ga0070713_100035038 3300005436 Bacteria 4038
24 Ga0070713_100068175 3300005436 Bacteria 2998
25 Ga0070710_10001002 3300005437 Bacteria 13435
26 Ga0070710_10001259 3300005437 Bacteria 12036
27 Ga0070710_10007741 3300005437 Bacteria 5211
28 Ga0070710_10023313 3300005437 Bacteria 3252
29 Ga0070701_10052418 3300005438 Bacteria 2119
30 Ga0070711_100000948 3300005439 Bacteria 15349
31 Ga0070711_100004411 3300005439 Bacteria 8302
32 Ga0070708_100001252 3300005445 Bacteria 19517
33 Ga0070708_100006873 3300005445 Bacteria 9076
34 Ga0070708_100046927 3300005445 Bacteria 3814
35 Ga0070708_100073284 3300005445 Unclassified 3086
36 Ga0070663_100226734 3300005455 Bacteria 1469
37 Ga0070662_100021084 3300005457 Bacteria 4446
38 Ga0070681_10045318 3300005458 Bacteria 4400
39 Ga0068867_100006056 3300005459 Bacteria 8571
40 Ga0070706_100004861 3300005467 Bacteria 12871
41 Ga0070706_100069388 3300005467 Unclassified 3260
42 Ga0070707_100098145 3300005468 Bacteria 2837
43 Ga0070707_100128253 3300005468 Bacteria 2465
44 Ga0070698_100003126 3300005471 Bacteria 18238
45 Ga0070699_100001451 3300005518 Bacteria 21740
46 Ga0070699_100109792 3300005518 Bacteria 2421
47 Ga0070679_100063015 3300005530 Bacteria 3696
48 Ga0070684_100003436 3300005535 Bacteria 11890
49 Ga0070684_100282970 3300005535 Bacteria 1519
50 Ga0070697_100000069 3300005536 Bacteria 82627
51 Ga0070697_100000656 3300005536 Bacteria 26071
52 Ga0070697_100098435 3300005536 Bacteria 2427
53 Ga0068853_100060451 3300005539 Bacteria 3274
54 Ga0070672_100014807 3300005543 Bacteria 5534
55 Ga0070696_100032578 3300005546 Bacteria 3576
56 Ga0068855_100030202 3300005563 Bacteria 6482
57 Ga0070664_100071862 3300005564 Bacteria 2966
58 Ga0068857_100004889 3300005577 Bacteria 11367
59 Ga0068854_100233269 3300005578 Bacteria 1462
60 Ga0068852_100089617 3300005616 Bacteria 2749
61 Ga0068859_100085365 3300005617 Bacteria 3202
62 Ga0068864_100017734 3300005618 Bacteria 5938
63 Ga0068866_10039580 3300005718 Bacteria 2328
64 Ga0068851_10003975 3300005834 Bacteria 6624
65 Ga0068870_10037373 3300005840 Bacteria 2503
66 Ga0068863_100029017 3300005841 Bacteria 5285
67 Ga0068863_100050544 3300005841 Bacteria 3940
68 Ga0068858_100014594 3300005842 Bacteria 7400
69 Ga0068860_100176106 3300005843 Bacteria 2067
70 Ga0070717_10018677 3300006028 Bacteria 5421
71 Ga0070717_10073870 3300006028 Bacteria 2850
72 Ga0070715_10012674 3300006163 Bacteria 3076
73 Ga0070715_10019418 3300006163 Unclassified 2606
74 Ga0070716_100084570 3300006173 Unclassified 1903
75 Ga0070712_100000010 3300006175 Bacteria 143560
76 Ga0070712_100001607 3300006175 Bacteria 13809
77 Ga0070712_100004072 3300006175 Bacteria 8973
78 Ga0070712_100030616 3300006175 Unclassified 3619
79 Ga0068871_100093353 3300006358 Bacteria 2510
80 Ga0075433_10001506 3300006852 Bacteria 17214
81 Ga0075434_100000104 3300006871 Bacteria 47845
82 Ga0068865_100008192 3300006881 Bacteria 6452
83 Ga0075436_100007882 3300006914 Bacteria 7288
84 Ga0075436_100070030 3300006914 Bacteria 2424
85 Ga0097620_100085359 3300006931 Bacteria 3202
86 Ga0075435_100000354 3300007076 Bacteria 28199
87 Ga0099795_10016560 3300007788 Unclassified 2333
88 Ga0105245_10051484 3300009098 Bacteria 3691
89 Ga0105245_10082428 3300009098 Bacteria 2942
90 Ga0105241_10062049 3300009174 Bacteria 2880
91 Ga0105248_10439678 3300009177 Bacteria 1469
92 Ga0105237_10045407 3300009545 Bacteria 4422
93 Ga0105238_10030986 3300009551 Bacteria 5444
94 Ga0105249_10062460 3300009553 Bacteria 3421
95 Ga0105249_10178849 3300009553 Bacteria 2062
96 Ga0099796_10009958 3300010159 Unclassified 2594
97 Ga0105239_10024109 3300010375 Bacteria 6701
98 Ga0105239_10040621 3300010375 Bacteria 5097
99 Ga0105246_10052837 3300011119 Bacteria 2794
100 Ga0157373_10003491 3300013100 Bacteria 11888
101 Ga0157371_10002263 3300013102 Bacteria 18560
102 Ga0157374_10018087 3300013296 Bacteria 6216
103 Ga0157374_10206708 3300013296 Bacteria 1924
104 Ga0163162_10391768 3300013306 Bacteria 1522
105 Ga0157372_10002166 3300013307 Bacteria 21379
106 Ga0157372_10066357 3300013307 Bacteria 4054
107 Ga0157375_10099654 3300013308 Bacteria 2985
108 Ga0163163_10019291 3300014325 Bacteria 6403
109 Ga0163163_10021772 3300014325 Bacteria 6056
110 Ga0157380_10019640 3300014326 Bacteria 5038
111 Ga0182008_10004248 3300014497 Bacteria 8398
112 Ga0157377_10015610 3300014745 Bacteria 3891
113 Ga0157379_10177935 3300014968 Bacteria 1921
114 Ga0157376_10009054 3300014969 Bacteria 7212
115 Ga0157376_10017166 3300014969 Bacteria 5513
116 Ga0182007_10015020 3300015262 Bacteria 2902
117 Ga0182005_1009903 3300015265 Bacteria 2755
118 Ga0163161_10001086 3300017792 Bacteria 20609
119 Ga0213874_10001758 3300021377 Unclassified 4553
120 Ga0224570_100055 3300022730 Bacteria 5938
121 Ga0228598_1003045 3300024227 Bacteria 3632
122 Ga0228598_1007838 3300024227 Unclassified 2166
123 Ga0207697_10005002 3300025315 Bacteria 6237
124 Ga0207692_10000836 3300025898 Bacteria 11035
125 Ga0207647_10013514 3300025904 Bacteria 5654
126 Ga0207685_10007053 3300025905 Bacteria 3106
127 Ga0207699_10008604 3300025906 Bacteria 5044
128 Ga0207699_10011585 3300025906 Unclassified 4460
129 Ga0207699_10014790 3300025906 Bacteria 4036
130 Ga0207645_10000273 3300025907 Bacteria 42696
131 Ga0207643_10005517 3300025908 Bacteria 6762
132 Ga0207705_10248463 3300025909 Bacteria 1356
133 Ga0207684_10000677 3300025910 Bacteria 40393
134 Ga0207684_10049869 3300025910 Unclassified 3551
135 Ga0207707_10001602 3300025912 Bacteria 20874
136 Ga0207693_10000029 3300025915 Bacteria 118724
137 Ga0207693_10000985 3300025915 Bacteria 25547
138 Ga0207693_10023281 3300025915 Bacteria 4919
139 Ga0207657_10000845 3300025919 Bacteria 32438
140 Ga0207657_10021886 3300025919 Bacteria 6004
141 Ga0207649_10004928 3300025920 Bacteria 7216
142 Ga0207646_10003352 3300025922 Bacteria 18172
143 Ga0207650_10000036 3300025925 Bacteria 214579
144 Ga0207659_10039532 3300025926 Bacteria 3291
145 Ga0207700_10000428 3300025928 Bacteria 24716
146 Ga0207700_10021061 3300025928 Bacteria 4444
147 Ga0207700_10102135 3300025928 Bacteria 2289
148 Ga0207664_10000017 3300025929 Bacteria 230967
149 Ga0207664_10003445 3300025929 Bacteria 10545
150 Ga0207664_10356105 3300025929 Unclassified 1296
151 Ga0207644_10134249 3300025931 Bacteria 1898
152 Ga0207690_10039972 3300025932 Bacteria 3063
153 Ga0207706_10000697 3300025933 Bacteria 35077
154 Ga0207706_10005630 3300025933 Bacteria 11671
155 Ga0207669_10082709 3300025937 Unclassified 2062
156 Ga0207704_10216716 3300025938 Bacteria 1413
157 Ga0207665_10007153 3300025939 Bacteria 7384
158 Ga0207665_10033968 3300025939 Bacteria 3384
159 Ga0207665_10074587 3300025939 Bacteria 2322
160 Ga0207665_10197249 3300025939 Unclassified 1465
161 Ga0207691_10006241 3300025940 Bacteria 11513
162 Ga0207711_10106481 3300025941 Bacteria 2488
163 Ga0207689_10001841 3300025942 Bacteria 20076
164 Ga0207661_10000527 3300025944 Bacteria 24587
165 Ga0207679_10001832 3300025945 Bacteria 13227
166 Ga0207679_10033592 3300025945 Bacteria 3611
167 Ga0207658_10120551 3300025986 Bacteria 2090
168 Ga0207678_10000543 3300026067 Bacteria 34457
169 Ga0207702_10058152 3300026078 Bacteria 3290
170 Ga0207641_10000009 3300026088 Bacteria 407901
171 Ga0207648_10001467 3300026089 Bacteria 25947
172 Ga0207676_10000092 3300026095 Bacteria 80704
173 Ga0207676_10118311 3300026095 Bacteria 2230
174 Ga0207674_10000016 3300026116 Bacteria 182470
175 Ga0207683_10000359 3300026121 Bacteria 41891
176 Ga0207698_10034063 3300026142 Bacteria 3709
177 Ga0207698_10251432 3300026142 Bacteria 1618
178 Ga0265356_1000162 3300028017 Bacteria 12140
179 Ga0268266_10018145 3300028379 Bacteria 5998
180 Ga0265318_10009264 3300028577 Bacteria 4341
181 Ga0265338_10019275 3300028800 Bacteria 7252
182 Ga0265338_10034403 3300028800 Bacteria 4898
183 Ga0265338_10132316 3300028800 Bacteria 1967
184 Ga0265762_1000235 3300030760 Bacteria 8982
185 Ga0265762_1001269 3300030760 Bacteria 4592
186 Ga0265762_1003043 3300030760 Bacteria 2998
187 Ga0265760_10004887 3300031090 Bacteria 3837
188 Ga0265760_10006939 3300031090 Bacteria 3247
189 Ga0265760_10008151 3300031090 Bacteria 2994
190 Ga0265330_10011112 3300031235 Bacteria 4226
191 Ga0265328_10042872 3300031239 Bacteria 1665
192 Ga0265320_10030684 3300031240 Bacteria 2769
193 Ga0265325_10003980 3300031241 Bacteria 9454
194 Ga0265325_10004207 3300031241 Bacteria 9142
195 Ga0265325_10087521 3300031241 Unclassified 1539
196 Ga0265340_10004587 3300031247 Bacteria 7693
197 Ga0265340_10012107 3300031247 Bacteria 4562
198 Ga0265340_10057897 3300031247 Bacteria 1861
199 Ga0265339_10017547 3300031249 Bacteria 4236
200 Ga0265339_10047072 3300031249 Bacteria 2369
201 Ga0265339_10051682 3300031249 Bacteria 2241
202 Ga0265339_10052050 3300031249 Bacteria 2232
203 Ga0265331_10018283 3300031250 Bacteria 3640
204 Ga0265331_10027335 3300031250 Bacteria 2860
205 Ga0265327_10012412 3300031251 Bacteria 5754
206 Ga0265316_10011925 3300031344 Bacteria 7814
207 Ga0265316_10233950 3300031344 Bacteria 1352
208 Ga0265313_10021592 3300031595 Bacteria 3517
209 Ga0265314_10003195 3300031711 Bacteria 16042
210 Ga0265314_10008894 3300031711 Bacteria 8567
211 Ga0265314_10063789 3300031711 Bacteria 2498
212 Ga0265342_10007050 3300031712 Bacteria 8287
213 Ga0265342_10021341 3300031712 Unclassified 4139
214 Ga0373926_0025141 3300035083 Unclassified 2077
215 Ga0373934_0018377 3300035086 Bacteria 2674
216 Ga0373923_0033244 3300035111 Unclassified 2088
217 Ga0373936_0009819 3300035113 Bacteria 3611
218 Ga0373936_0021553 3300035113 Bacteria 2506
219 Ga0373953_0006362 3300035117 Bacteria 3888
220 Ga0373956_0003888 3300035119 Bacteria 6004
221 Ga0373943_0005454 3300035170 Bacteria 5723
222 Ga0373943_0024591 3300035170 Bacteria 2809
223 Ga0373946_0063409 3300035171 Unclassified 1578
224 Ga0373955_0022640 3300035172 Unclassified 3190
225 Ga0373955_0058885 3300035172 Bacteria 2114
226 Ga0373955_0113500 3300035172 Bacteria 1568
227 Ga0373935_0048925 3300035692 Unclassified 2679
228 Ga0373935_0070358 3300035692 Unclassified 2255
229 Ga0373927_0004063 3300035695 Bacteria 10327
230 Ga0373927_0049778 3300035695 Bacteria 2709
231 Ga0373927_0079182 3300035695 Bacteria 2129
232 Ga0373927_0109973 3300035695 Bacteria 1795
233 Ga0373947_0057794 3300035725 Unclassified 2348
234 Ga0373947_0062780 3300035725 Bacteria 2262
235 Ga0373937_0108577 3300036401 Bacteria 2580
236 Ga0373937_0134555 3300036401 Bacteria 2310
237 Ga0373925_0036420 3300037068 Bacteria 3631
238 Ga0373925_0040002 3300037068 Bacteria 3470
239 Ga0373925_0051151 3300037068 Unclassified 3083
240 Ga0373925_0057532 3300037068 Bacteria 2913
241 Ga0395905_0008810 3300037471 Bacteria 9914
242 Ga0436365_1054972 3300039437 Bacteria 2144
243 Ga0436363_0575896 3300039450 Bacteria 9060
244 Ga0451577_0000157 3300042876 Bacteria 151953
245 Ga0466963_0000567 3300044694 Bacteria 17458
246 Ga0466963_0005107 3300044694 Bacteria 7667
247 Ga0453684_0000324 3300044712 Bacteria 201431
248 Ga0466957_0136121 3300044842 Unclassified 1579
249 Ga0466959_0020125 3300045049 Bacteria 4914
250 Ga0466967_0003579 3300045976 Bacteria 10194
251 Ga0466967_0008652 3300045976 Bacteria 7484
252 Ga0466967_0060960 3300045976 Bacteria 3345
253 Ga0466967_0104922 3300045976 Bacteria 2588
254 Ga0466967_0127484 3300045976 Unclassified 2359
255 Ga0495592_0135944 3300046454 Bacteria 1714
256 Ga0495580_0000264 3300046472 Bacteria 41999
257 Ga0495580_0001787 3300046472 Bacteria 18892
258 Ga0495580_0010787 3300046472 Bacteria 7096
259 Ga0495580_0035910 3300046472 Bacteria 3563
260 Ga0495580_0070402 3300046472 Unclassified 2443
261 Ga0495580_0300537 3300046472 Bacteria 1093
262 Ga0495582_0000791 3300046473 Bacteria 17527
263 Ga0495582_0002367 3300046473 Bacteria 10551
264 Ga0495628_0005236 3300046516 Bacteria 11385
265 Ga0495628_0023093 3300046516 Bacteria 5106
266 Ga0495630_0101238 3300046517 Bacteria 2179
267 Ga0495652_0006059 3300046529 Bacteria 11308
268 Ga0495652_0075675 3300046529 Bacteria 2795
269 Ga0495665_0069483 3300046531 Unclassified 1856
270 Ga0495640_0168567 3300046533 Bacteria 1400
271 Ga0495586_0037098 3300046535 Bacteria 2616
272 Ga0495645_0009704 3300046543 Bacteria 6732
273 Ga0495645_0194058 3300046543 Unclassified 1382
274 Ga0495657_0113949 3300046675 Bacteria 1710
275 Ga0495599_0000794 3300046678 Bacteria 17733
276 Ga0495599_0008293 3300046678 Bacteria 6319
277 Ga0495669_0014400 3300046684 Bacteria 3381
278 Ga0495669_0029357 3300046684 Bacteria 2411
279 Ga0495624_0083910 3300046690 Unclassified 1970
280 Ga0495581_0047846 3300047315 Bacteria 2471
281 Ga0495674_0022498 3300047319 Bacteria 5815
282 Ga0495674_0057037 3300047319 Unclassified 3419
283 Ga0495674_0102307 3300047319 Bacteria 2436
284 Ga0495674_0181799 3300047319 Bacteria 1751
285 Ga0496100_0014249 3300048903 Bacteria 4612
286 Ga0496101_0161618 3300048904 Bacteria 1718
287 Ga0496104_0010688 3300048907 Bacteria 8206
288 Ga0496106_0396990 3300048909 Bacteria 1108
289 Ga0496107_0074383 3300048910 Bacteria 2472
290 Ga0496108_0000477 3300048911 Bacteria 32062
291 Ga0496108_0079740 3300048911 Bacteria 2772
292 Ga0496109_0000020 3300048912 Bacteria 189962
293 Ga0496110_0004805 3300048913 Bacteria 10525
294 Ga0496110_0547722 3300048913 Bacteria 1051
295 Ga0496111_0003429 3300048914 Bacteria 9805
296 Ga0496112_0000402 3300048915 Bacteria 28279
297 Ga0496113_0001283 3300048916 Bacteria 13863
298 Ga0496113_0016185 3300048916 Bacteria 5147
299 Ga0496115_0133268 3300048918 Bacteria 2048
300 Ga0501073_0009046 3300049589 Bacteria 7354
301 Ga0501077_0085230 3300049593 Bacteria 2003
302 nmdc:mga0n895_279_c1 3300050512 Bacteria 33669
303 nmdc:mga0rr50_267_c1 3300050513 Bacteria 28320
304 nmdc:mga08x19_221285_c1 3300050514 Unclassified 1301
305 nmdc:mga0a205_379_c1 3300050515 Bacteria 33748
306 Ga0495601_0003324 3300053077 Bacteria 9202
307 Ga0495601_0036654 3300053077 Unclassified 3064

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046535 Ga0495586_0037098 Ga0495586_0037098_336_1229 276
2 3300046472 Ga0495580_0300537 Ga0495580_0300537_116_1066 310
3 3300035172 Ga0373955_0113500 Ga0373955_0113500_456_1466 314
4 3300037068 Ga0373925_0057532 Ga0373925_0057532_76_1086 314
5 3300047319 Ga0495674_0102307 Ga0495674_0102307_29_1039 314
6 3300048913 Ga0496110_0547722 Ga0496110_0547722_19_987 322
7 3300009553 Ga0105249_10178849 Ga0105249_101788492 328
8 3300013307 Ga0157372_10002166 Ga0157372_1000216619 328
9 3300048909 Ga0496106_0396990 Ga0496106_0396990_59_1045 328
10 3300046472 Ga0495580_0035910 Ga0495580_0035910_1838_2947 333
11 3300046533 Ga0495640_0168567 Ga0495640_0168567_129_1238 333
12 3300047319 Ga0495674_0022498 Ga0495674_0022498_3007_4116 333
13 3300035113 Ga0373936_0021553 Ga0373936_0021553_187_1341 346
14 3300035170 Ga0373943_0005454 Ga0373943_0005454_3807_4961 346
15 3300037068 Ga0373925_0040002 Ga0373925_0040002_58_1212 346
16 3300035171 Ga0373946_0063409 Ga0373946_0063409_75_1136 348
17 3300035695 Ga0373927_0109973 Ga0373927_0109973_39_1100 348
18 3300046454 Ga0495592_0135944 Ga0495592_0135944_461_1573 349
19 3300046516 Ga0495628_0005236 Ga0495628_0005236_5461_6573 349
20 3300046516 Ga0495628_0023093 Ga0495628_0023093_1394_2458 349
21 3300046529 Ga0495652_0006059 Ga0495652_0006059_7804_8868 349
22 3300046529 Ga0495652_0075675 Ga0495652_0075675_229_1341 349
23 3300046543 Ga0495645_0009704 Ga0495645_0009704_4900_5964 349
24 3300046678 Ga0495599_0000794 Ga0495599_0000794_2476_3540 349
25 3300046678 Ga0495599_0008293 Ga0495599_0008293_376_1488 349
26 3300053077 Ga0495601_0003324 Ga0495601_0003324_3965_5077 349
27 3300005536 Ga0070697_100000069 Ga0070697_10000006918 352
28 3300006358 Ga0068871_100093353 Ga0068871_1000933532 354
29 3300014969 Ga0157376_10009054 Ga0157376_100090543 354
30 3300035086 Ga0373934_0018377 Ga0373934_0018377_1408_2598 360
31 3300035117 Ga0373953_0006362 Ga0373953_0006362_653_1843 360
32 3300036401 Ga0373937_0134555 Ga0373937_0134555_94_1284 360
33 3300045976 Ga0466967_0060960 Ga0466967_0060960_1742_2947 361
34 3300006852 Ga0075433_10001506 Ga0075433_100015068 362
35 3300006871 Ga0075434_100000104 Ga0075434_10000010433 362
36 3300006914 Ga0075436_100007882 Ga0075436_1000078825 362
37 3300007076 Ga0075435_100000354 Ga0075435_10000035417 362
38 3300050512 nmdc:mga0n895_279_c1 nmdc:mga0n895_279_c1_24197_25342 362
39 3300050513 nmdc:mga0rr50_267_c1 nmdc:mga0rr50_267_c1_25748_26893 362
40 3300050515 nmdc:mga0a205_379_c1 nmdc:mga0a205_379_c1_15881_17026 362
41 3300044694 Ga0466963_0005107 Ga0466963_0005107_5712_6866 363
42 3300044842 Ga0466957_0136121 Ga0466957_0136121_314_1468 363
43 3300005435 Ga0070714_100000060 Ga0070714_10000006085 365
44 3300025929 Ga0207664_10000017 Ga0207664_10000017201 365
45 3300031241 Ga0265325_10004207 Ga0265325_100042076 365
46 3300028800 Ga0265338_10034403 Ga0265338_100344033 366
47 3300031241 Ga0265325_10087521 Ga0265325_100875211 367
48 3300031247 Ga0265340_10057897 Ga0265340_100578972 367
49 3300045976 Ga0466967_0127484 Ga0466967_0127484_1065_2249 368
50 3300005518 Ga0070699_100109792 Ga0070699_1001097922 369
51 3300006028 Ga0070717_10018677 Ga0070717_100186772 369
52 3300006914 Ga0075436_100070030 Ga0075436_1000700302 369
53 3300035119 Ga0373956_0003888 Ga0373956_0003888_102_1247 369
54 3300035172 Ga0373955_0058885 Ga0373955_0058885_901_2046 369
55 3300035695 Ga0373927_0049778 Ga0373927_0049778_669_1940 369
56 3300035695 Ga0373927_0079182 Ga0373927_0079182_653_1798 369
57 3300035725 Ga0373947_0062780 Ga0373947_0062780_18_1145 369
58 3300036401 Ga0373937_0108577 Ga0373937_0108577_727_1872 369
59 3300005436 Ga0070713_100068175 Ga0070713_1000681752 370
60 3300006175 Ga0070712_100030616 Ga0070712_1000306162 370
61 3300025906 Ga0207699_10011585 Ga0207699_100115854 370
62 3300025915 Ga0207693_10023281 Ga0207693_100232813 370
63 3300025928 Ga0207700_10102135 Ga0207700_101021352 370
64 3300025939 Ga0207665_10007153 Ga0207665_100071533 370
65 3300025939 Ga0207665_10197249 Ga0207665_101972491 370
66 3300028800 Ga0265338_10019275 Ga0265338_100192753 370
67 3300031249 Ga0265339_10051682 Ga0265339_100516822 370
68 3300035083 Ga0373926_0025141 Ga0373926_0025141_22_1284 370
69 3300035692 Ga0373935_0070358 Ga0373935_0070358_86_1363 370
70 3300035725 Ga0373947_0057794 Ga0373947_0057794_937_2214 370
71 3300037068 Ga0373925_0051151 Ga0373925_0051151_491_1768 370
72 3300046472 Ga0495580_0070402 Ga0495580_0070402_298_1575 370
73 3300046473 Ga0495582_0002367 Ga0495582_0002367_8609_9871 370
74 3300046531 Ga0495665_0069483 Ga0495665_0069483_488_1750 370
75 3300050514 nmdc:mga08x19_221285_c1 nmdc:mga08x19_221285_c1_19_1281 370
76 3300005436 Ga0070713_100001036 Ga0070713_1000010368 371
77 3300005437 Ga0070710_10007741 Ga0070710_100077412 371
78 3300005439 Ga0070711_100004411 Ga0070711_1000044115 371
79 3300006163 Ga0070715_10019418 Ga0070715_100194182 371
80 3300006175 Ga0070712_100000010 Ga0070712_10000001071 371
81 3300007788 Ga0099795_10016560 Ga0099795_100165602 371
82 3300010159 Ga0099796_10009958 Ga0099796_100099582 371
83 3300025906 Ga0207699_10008604 Ga0207699_100086043 371
84 3300025915 Ga0207693_10000029 Ga0207693_1000002974 371
85 3300025928 Ga0207700_10000428 Ga0207700_1000042814 371
86 3300049589 Ga0501073_0009046 Ga0501073_0009046_158_1276 371
87 3300049593 Ga0501077_0085230 Ga0501077_0085230_748_1866 371
88 3300005439 Ga0070711_100000948 Ga0070711_1000009487 372
89 3300006175 Ga0070712_100004072 Ga0070712_1000040723 372
90 3300025906 Ga0207699_10014790 Ga0207699_100147903 372
91 3300025915 Ga0207693_10000985 Ga0207693_100009855 372
92 3300028577 Ga0265318_10009264 Ga0265318_100092644 372
93 3300031240 Ga0265320_10030684 Ga0265320_100306842 372
94 3300031249 Ga0265339_10047072 Ga0265339_100470722 372
95 3300031250 Ga0265331_10027335 Ga0265331_100273352 372
96 3300031711 Ga0265314_10063789 Ga0265314_100637892 372
97 3300031712 Ga0265342_10021341 Ga0265342_100213413 372
98 3300035695 Ga0373927_0004063 Ga0373927_0004063_9004_10251 372
99 3300046690 Ga0495624_0083910 Ga0495624_0083910_183_1421 372
100 3300047319 Ga0495674_0057037 Ga0495674_0057037_129_1367 372
101 3300005435 Ga0070714_100166645 Ga0070714_1001666451 373
102 3300005437 Ga0070710_10023313 Ga0070710_100233132 373
103 3300025929 Ga0207664_10356105 Ga0207664_103561052 373
104 3300030760 Ga0265762_1000235 Ga0265762_10002353 373
105 3300005436 Ga0070713_100002374 Ga0070713_1000023744 374
106 3300005546 Ga0070696_100032578 Ga0070696_1000325782 374
107 3300006173 Ga0070716_100084570 Ga0070716_1000845702 374
108 3300006175 Ga0070712_100001607 Ga0070712_1000016074 374
109 3300025928 Ga0207700_10021061 Ga0207700_100210612 374
110 3300031239 Ga0265328_10042872 Ga0265328_100428721 374
111 3300031241 Ga0265325_10003980 Ga0265325_100039805 374
112 3300031247 Ga0265340_10004587 Ga0265340_100045874 374
113 3300031249 Ga0265339_10052050 Ga0265339_100520502 374
114 3300031250 Ga0265331_10018283 Ga0265331_100182833 374
115 3300031251 Ga0265327_10012412 Ga0265327_100124122 374
116 3300031344 Ga0265316_10233950 Ga0265316_102339501 374
117 3300031595 Ga0265313_10021592 Ga0265313_100215922 374
118 3300031712 Ga0265342_10007050 Ga0265342_100070504 374
119 3300045049 Ga0466959_0020125 Ga0466959_0020125_1332_2474 374
120 3300005329 Ga0070683_100004635 Ga0070683_1000046355 375
121 3300005331 Ga0070670_100014084 Ga0070670_1000140842 375
122 3300005333 Ga0070677_10021467 Ga0070677_100214672 375
123 3300005335 Ga0070666_10024735 Ga0070666_100247352 375
124 3300005338 Ga0068868_100098498 Ga0068868_1000984982 375
125 3300005338 Ga0068868_100261427 Ga0068868_1002614271 375
126 3300005339 Ga0070660_100000802 Ga0070660_10000080213 375
127 3300005340 Ga0070689_100002279 Ga0070689_1000022792 375
128 3300005344 Ga0070661_100067440 Ga0070661_1000674402 375
129 3300005353 Ga0070669_100014103 Ga0070669_1000141033 375
130 3300005356 Ga0070674_100238838 Ga0070674_1002388381 375
131 3300005365 Ga0070688_100000324 Ga0070688_1000003243 375
132 3300005366 Ga0070659_100045544 Ga0070659_1000455442 375
133 3300005434 Ga0070709_10027145 Ga0070709_100271452 375
134 3300005435 Ga0070714_100113705 Ga0070714_1001137052 375
135 3300005438 Ga0070701_10052418 Ga0070701_100524182 375
136 3300005455 Ga0070663_100226734 Ga0070663_1002267341 375
137 3300005459 Ga0068867_100006056 Ga0068867_1000060562 375
138 3300005530 Ga0070679_100063015 Ga0070679_1000630152 375
139 3300005535 Ga0070684_100003436 Ga0070684_1000034364 375
140 3300005539 Ga0068853_100060451 Ga0068853_1000604512 375
141 3300005543 Ga0070672_100014807 Ga0070672_1000148073 375
142 3300005564 Ga0070664_100071862 Ga0070664_1000718622 375
143 3300005577 Ga0068857_100004889 Ga0068857_1000048892 375
144 3300005616 Ga0068852_100089617 Ga0068852_1000896173 375
145 3300005617 Ga0068859_100085365 Ga0068859_1000853653 375
146 3300005618 Ga0068864_100017734 Ga0068864_1000177342 375
147 3300005718 Ga0068866_10039580 Ga0068866_100395802 375
148 3300005834 Ga0068851_10003975 Ga0068851_100039753 375
149 3300005840 Ga0068870_10037373 Ga0068870_100373732 375
150 3300005841 Ga0068863_100050544 Ga0068863_1000505442 375
151 3300005842 Ga0068858_100014594 Ga0068858_1000145945 375
152 3300005843 Ga0068860_100176106 Ga0068860_1001761062 375
153 3300006881 Ga0068865_100008192 Ga0068865_1000081922 375
154 3300006931 Ga0097620_100085359 Ga0097620_1000853593 375
155 3300009098 Ga0105245_10051484 Ga0105245_100514842 375
156 3300009098 Ga0105245_10082428 Ga0105245_100824283 375
157 3300009177 Ga0105248_10439678 Ga0105248_104396782 375
158 3300009553 Ga0105249_10062460 Ga0105249_100624601 375
159 3300010375 Ga0105239_10024109 Ga0105239_100241093 375
160 3300011119 Ga0105246_10052837 Ga0105246_100528373 375
161 3300013100 Ga0157373_10003491 Ga0157373_100034915 375
162 3300013102 Ga0157371_10002263 Ga0157371_1000226313 375
163 3300013296 Ga0157374_10206708 Ga0157374_102067082 375
164 3300013307 Ga0157372_10066357 Ga0157372_100663572 375
165 3300013308 Ga0157375_10099654 Ga0157375_100996542 375
166 3300014325 Ga0163163_10019291 Ga0163163_100192913 375
167 3300014326 Ga0157380_10019640 Ga0157380_100196403 375
168 3300014745 Ga0157377_10015610 Ga0157377_100156102 375
169 3300017792 Ga0163161_10001086 Ga0163161_100010863 375
170 3300021377 Ga0213874_10001758 Ga0213874_100017584 375
171 3300025315 Ga0207697_10005002 Ga0207697_100050023 375
172 3300025904 Ga0207647_10013514 Ga0207647_100135142 375
173 3300025907 Ga0207645_10000273 Ga0207645_1000027321 375
174 3300025908 Ga0207643_10005517 Ga0207643_100055173 375
175 3300025909 Ga0207705_10248463 Ga0207705_102484631 375
176 3300025912 Ga0207707_10001602 Ga0207707_1000160219 375
177 3300025919 Ga0207657_10021886 Ga0207657_100218864 375
178 3300025920 Ga0207649_10004928 Ga0207649_100049285 375
179 3300025925 Ga0207650_10000036 Ga0207650_1000003658 375
180 3300025926 Ga0207659_10039532 Ga0207659_100395322 375
181 3300025931 Ga0207644_10134249 Ga0207644_101342492 375
182 3300025933 Ga0207706_10000697 Ga0207706_1000069710 375
183 3300025937 Ga0207669_10082709 Ga0207669_100827093 375
184 3300025938 Ga0207704_10216716 Ga0207704_102167162 375
185 3300025940 Ga0207691_10006241 Ga0207691_1000624110 375
186 3300025941 Ga0207711_10106481 Ga0207711_101064812 375
187 3300025942 Ga0207689_10001841 Ga0207689_100018412 375
188 3300025944 Ga0207661_10000527 Ga0207661_100005275 375
189 3300025945 Ga0207679_10001832 Ga0207679_100018322 375
190 3300025986 Ga0207658_10120551 Ga0207658_101205512 375
191 3300026067 Ga0207678_10000543 Ga0207678_100005437 375
192 3300026078 Ga0207702_10058152 Ga0207702_100581524 375
193 3300026088 Ga0207641_10000009 Ga0207641_1000000948 375
194 3300026089 Ga0207648_10001467 Ga0207648_100014672 375
195 3300026095 Ga0207676_10000092 Ga0207676_1000009220 375
196 3300026116 Ga0207674_10000016 Ga0207674_10000016114 375
197 3300026121 Ga0207683_10000359 Ga0207683_1000035921 375
198 3300026142 Ga0207698_10034063 Ga0207698_100340632 375
199 3300028379 Ga0268266_10018145 Ga0268266_100181454 375
200 3300037471 Ga0395905_0008810 Ga0395905_0008810_8368_9513 375
201 3300039437 Ga0436365_1054972 Ga0436365_1054972_560_1714 375
202 3300039450 Ga0436363_0575896 Ga0436363_0575896_2798_3973 375
203 3300042876 Ga0451577_0000157 Ga0451577_0000157_148308_149468 375
204 3300044694 Ga0466963_0000567 Ga0466963_0000567_2034_3170 375
205 3300044712 Ga0453684_0000324 Ga0453684_0000324_157578_158738 375
206 3300045976 Ga0466967_0003579 Ga0466967_0003579_3876_5012 375
207 3300045976 Ga0466967_0008652 Ga0466967_0008652_2338_3474 375
208 3300046684 Ga0495669_0014400 Ga0495669_0014400_1219_2391 375
209 3300046684 Ga0495669_0029357 Ga0495669_0029357_945_2093 375
210 3300048904 Ga0496101_0161618 Ga0496101_0161618_54_1181 375
211 3300048910 Ga0496107_0074383 Ga0496107_0074383_1298_2425 375
212 3300048911 Ga0496108_0000477 Ga0496108_0000477_20961_22088 375
213 3300048912 Ga0496109_0000020 Ga0496109_0000020_182223_183350 375
214 3300048913 Ga0496110_0004805 Ga0496110_0004805_2077_3204 375
215 3300048915 Ga0496112_0000402 Ga0496112_0000402_26654_27781 375
216 3300048916 Ga0496113_0001283 Ga0496113_0001283_1799_2926 375
217 3300005445 Ga0070708_100001252 Ga0070708_1000012529 376
218 3300005467 Ga0070706_100004861 Ga0070706_1000048617 376
219 3300005471 Ga0070698_100003126 Ga0070698_10000312611 376
220 3300005518 Ga0070699_100001451 Ga0070699_1000014519 376
221 3300005536 Ga0070697_100000656 Ga0070697_10000065614 376
222 3300024227 Ga0228598_1007838 Ga0228598_10078383 376
223 3300025910 Ga0207684_10000677 Ga0207684_1000067711 376
224 3300025922 Ga0207646_10003352 Ga0207646_1000335211 376
225 3300025939 Ga0207665_10033968 Ga0207665_100339682 376
226 3300031090 Ga0265760_10006939 Ga0265760_100069392 376
227 3300045976 Ga0466967_0104922 Ga0466967_0104922_951_2135 376
228 3300005436 Ga0070713_100035038 Ga0070713_1000350381 377
229 3300005445 Ga0070708_100073284 Ga0070708_1000732843 377
230 3300005467 Ga0070706_100069388 Ga0070706_1000693882 377
231 3300014969 Ga0157376_10017166 Ga0157376_100171663 377
232 3300025910 Ga0207684_10049869 Ga0207684_100498692 377
233 3300028800 Ga0265338_10132316 Ga0265338_101323162 377
234 3300035172 Ga0373955_0022640 Ga0373955_0022640_596_1777 377
235 3300048918 Ga0496115_0133268 Ga0496115_0133268_383_1558 377
236 3300005445 Ga0070708_100006873 Ga0070708_1000068733 378
237 3300006028 Ga0070717_10073870 Ga0070717_100738703 378
238 3300025939 Ga0207665_10074587 Ga0207665_100745872 378
239 3300031090 Ga0265760_10008151 Ga0265760_100081512 378
240 3300047319 Ga0495674_0181799 Ga0495674_0181799_390_1616 378
241 3300005468 Ga0070707_100128253 Ga0070707_1001282532 379
242 3300005536 Ga0070697_100098435 Ga0070697_1000984352 379
243 3300014968 Ga0157379_10177935 Ga0157379_101779352 379
244 3300031344 Ga0265316_10011925 Ga0265316_100119253 379
245 3300031711 Ga0265314_10003195 Ga0265314_100031955 379
246 3300046472 Ga0495580_0001787 Ga0495580_0001787_4056_5327 379
247 3300005445 Ga0070708_100046927 Ga0070708_1000469271 380
248 3300005468 Ga0070707_100098145 Ga0070707_1000981452 380
249 3300030760 Ga0265762_1003043 Ga0265762_10030432 380
250 3300031247 Ga0265340_10012107 Ga0265340_100121073 380
251 3300031249 Ga0265339_10017547 Ga0265339_100175476 380
252 3300031711 Ga0265314_10008894 Ga0265314_100088946 380
253 3300046472 Ga0495580_0010787 Ga0495580_0010787_3528_4727 380
254 3300005437 Ga0070710_10001259 Ga0070710_100012596 381
255 3300006163 Ga0070715_10012674 Ga0070715_100126742 381
256 3300025905 Ga0207685_10007053 Ga0207685_100070532 381
257 3300025929 Ga0207664_10003445 Ga0207664_100034453 381
258 3300031235 Ga0265330_10011112 Ga0265330_100111124 381
259 3300035111 Ga0373923_0033244 Ga0373923_0033244_585_1799 381
260 3300035113 Ga0373936_0009819 Ga0373936_0009819_1044_2258 381
261 3300035170 Ga0373943_0024591 Ga0373943_0024591_93_1307 381
262 3300035692 Ga0373935_0048925 Ga0373935_0048925_1282_2496 381
263 3300037068 Ga0373925_0036420 Ga0373925_0036420_1547_2761 381
264 3300046472 Ga0495580_0000264 Ga0495580_0000264_13705_14919 381
265 3300046473 Ga0495582_0000791 Ga0495582_0000791_7484_8698 381
266 3300046517 Ga0495630_0101238 Ga0495630_0101238_93_1307 381
267 3300046543 Ga0495645_0194058 Ga0495645_0194058_40_1254 381
268 3300046675 Ga0495657_0113949 Ga0495657_0113949_87_1289 381
269 3300047315 Ga0495581_0047846 Ga0495581_0047846_1186_2400 381
270 3300053077 Ga0495601_0036654 Ga0495601_0036654_1314_2528 381
271 3300005327 Ga0070658_10110409 Ga0070658_101104092 382
272 3300005329 Ga0070683_100020788 Ga0070683_1000207884 382
273 3300005344 Ga0070661_100033903 Ga0070661_1000339032 382
274 3300005437 Ga0070710_10001002 Ga0070710_100010023 382
275 3300005457 Ga0070662_100021084 Ga0070662_1000210842 382
276 3300005458 Ga0070681_10045318 Ga0070681_100453181 382
277 3300005535 Ga0070684_100282970 Ga0070684_1002829702 382
278 3300005563 Ga0068855_100030202 Ga0068855_1000302023 382
279 3300005578 Ga0068854_100233269 Ga0068854_1002332692 382
280 3300005841 Ga0068863_100029017 Ga0068863_1000290173 382
281 3300009174 Ga0105241_10062049 Ga0105241_100620492 382
282 3300009545 Ga0105237_10045407 Ga0105237_100454073 382
283 3300009551 Ga0105238_10030986 Ga0105238_100309862 382
284 3300010375 Ga0105239_10040621 Ga0105239_100406213 382
285 3300013296 Ga0157374_10018087 Ga0157374_100180874 382
286 3300013306 Ga0163162_10391768 Ga0163162_103917682 382
287 3300014325 Ga0163163_10021772 Ga0163163_100217723 382
288 3300014497 Ga0182008_10004248 Ga0182008_100042485 382
289 3300015262 Ga0182007_10015020 Ga0182007_100150203 382
290 3300015265 Ga0182005_1009903 Ga0182005_10099032 382
291 3300022730 Ga0224570_100055 Ga0224570_1000555 382
292 3300024227 Ga0228598_1003045 Ga0228598_10030451 382
293 3300025898 Ga0207692_10000836 Ga0207692_100008363 382
294 3300025919 Ga0207657_10000845 Ga0207657_1000084523 382
295 3300025932 Ga0207690_10039972 Ga0207690_100399722 382
296 3300025933 Ga0207706_10005630 Ga0207706_100056303 382
297 3300025945 Ga0207679_10033592 Ga0207679_100335922 382
298 3300026095 Ga0207676_10118311 Ga0207676_101183112 382
299 3300026142 Ga0207698_10251432 Ga0207698_102514322 382
300 3300028017 Ga0265356_1000162 Ga0265356_10001628 382
301 3300030760 Ga0265762_1001269 Ga0265762_10012693 382
302 3300031090 Ga0265760_10004887 Ga0265760_100048874 382
303 3300048903 Ga0496100_0014249 Ga0496100_0014249_1486_2634 382
304 3300048907 Ga0496104_0010688 Ga0496104_0010688_6892_8040 382
305 3300048911 Ga0496108_0079740 Ga0496108_0079740_1483_2631 382
306 3300048914 Ga0496111_0003429 Ga0496111_0003429_2756_3904 382
307 3300048916 Ga0496113_0016185 Ga0496113_0016185_1567_2715 382

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03702

AnmK

Anhydro-N-acetylmuramic acid kinase

1

423

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cpb-assembly1.cif.gz_B 1,6-anhydro-n-actetylmuramic acid kinase (anmk) in complex with amppnp, and anhmurnac at 1.7 angstroms resolution. 0.9306 1 382
8cp9-assembly1.cif.gz_A 1,6-anhydro-n-actetylmuramic acid kinase (anmk)in complex with non-hydrolyzable amppnp. 0.9239 1 382
3qbw-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa 1,6-anhydro-n-actetylmuramic acid kinase (anmk) bound to adenosine diphosphate 0.9239 1 379
3qbw-assembly1.cif.gz_B crystal structure of pseudomonas aeruginosa 1,6-anhydro-n-actetylmuramic acid kinase (anmk) bound to adenosine diphosphate 0.921 1 379
3qbx-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa 1,6-anhydro-n-actetylmuramic acid kinase (anmk) bound to 1,6-anhydro-n-actetylmuramic acid 0.9185 1 382
ID Description Score Start End Superfamily
3cqyB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9482 150 341 3.30.420.40
3cqyB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9382 150 341 3.30.420.40
4mo4C02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9255 150 341 3.30.420.40
4mo4C02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9155 150 341 3.30.420.40
af_Q54NM2_164_389_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9108 150 341 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A1Q7ZHV3-F1-model_v4 Anhydro-N-acetylmuramic acid kinase 0.979 208 382 GO:0005524
GO:0006040
GO:0009254
GO:0016773
AF-A0A2E1IBH3-F1-model_v4 deleted 0.9717 154 378
AF-A0A1Q7ZHV3-F1-model_v4 Anhydro-N-acetylmuramic acid kinase 0.9681 208 382 GO:0005524
GO:0006040
GO:0009254
GO:0016773
AF-A0A449A265-F1-model_v4 Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.170) 0.9669 186 382 GO:0005524
GO:0006040
GO:0009254
GO:0016301
GO:0016773
AF-A0A2P5TI51-F1-model_v4 Anhydro-N-acetylmuramic acid kinase 0.9662 94 381 GO:0005524
GO:0006040
GO:0009254
GO:0016301
GO:0016773

Feature Viewer

pLDDT pTM Quality
90.53 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map