F399332
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 307 | 200 | 307 | 384 |
Family's Representative Sequence
| Representative Sequence | 3300046472|Ga0495580_0001787|Ga0495580_0001787_4056_5327 |
| Length | 423 |
| Sequence | MIVAGVMSGTSADGINVALVRVRESQTLGSRRRSAKSVGQECPTHMGLGSAKLELLGHAEFAYPAGVRRAVLGAMNAPRARVADLARLNFRLGELYADAVLAAQKKLRVKAELVGCHGQTLYHQGTAATFLSKKLAVTWQTGEAAVIAARVGVPVVSDFRPGDMAAGGQGAPLVPYLDYILYRDPKVGRIAQNIGGIANLTAIPAGASRDDIIALDTGPGNMVIDALSERLFGTRFDRDGEIAGSGRVRDEAVTRFLRGSFFRQKPPKTAGREEFGREFAWEFLRVCRMSQPLNNAKGGAAGSASALSRKIETCDVMATATAFTARSISDAIERFVLPEGKYSELIVSGGGAKNATLMAMLANEVRDLGLRLRSSDEFGIPSEAKEAVAFALLAFETWNRRPSNVPSATGARRAAVLGKVAYP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 59 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 85 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 86 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 87 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 128 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 133 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 134 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 135 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 136 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 138 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 139 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 140 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 143 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 144 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 145 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 147 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 150 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 154 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 155 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 158 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 159 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 160 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 161 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 162 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 163 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 164 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 165 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 166 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 185 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 186 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 187 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 190 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 191 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 192 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 193 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 194 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.05 |
| Metatranscriptomes | 1.95 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.89 |
| Rhizosphere | 94.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10110409 | 3300005327 | Unclassified | 2278 |
| 2 | Ga0070683_100004635 | 3300005329 | Bacteria | 11354 |
| 3 | Ga0070683_100020788 | 3300005329 | Bacteria | 5847 |
| 4 | Ga0070670_100014084 | 3300005331 | Bacteria | 6860 |
| 5 | Ga0070677_10021467 | 3300005333 | Bacteria | 2369 |
| 6 | Ga0070666_10024735 | 3300005335 | Bacteria | 3914 |
| 7 | Ga0068868_100098498 | 3300005338 | Bacteria | 2364 |
| 8 | Ga0068868_100261427 | 3300005338 | Bacteria | 1460 |
| 9 | Ga0070660_100000802 | 3300005339 | Bacteria | 20852 |
| 10 | Ga0070689_100002279 | 3300005340 | Bacteria | 12479 |
| 11 | Ga0070661_100033903 | 3300005344 | Bacteria | 3701 |
| 12 | Ga0070661_100067440 | 3300005344 | Bacteria | 2629 |
| 13 | Ga0070669_100014103 | 3300005353 | Bacteria | 5685 |
| 14 | Ga0070674_100238838 | 3300005356 | Bacteria | 1421 |
| 15 | Ga0070688_100000324 | 3300005365 | Bacteria | 24448 |
| 16 | Ga0070659_100045544 | 3300005366 | Bacteria | 3436 |
| 17 | Ga0070709_10027145 | 3300005434 | Bacteria | 3402 |
| 18 | Ga0070714_100000060 | 3300005435 | Bacteria | 100913 |
| 19 | Ga0070714_100113705 | 3300005435 | Bacteria | 2400 |
| 20 | Ga0070714_100166645 | 3300005435 | Bacteria | 1997 |
| 21 | Ga0070713_100001036 | 3300005436 | Bacteria | 17798 |
| 22 | Ga0070713_100002374 | 3300005436 | Bacteria | 12270 |
| 23 | Ga0070713_100035038 | 3300005436 | Bacteria | 4038 |
| 24 | Ga0070713_100068175 | 3300005436 | Bacteria | 2998 |
| 25 | Ga0070710_10001002 | 3300005437 | Bacteria | 13435 |
| 26 | Ga0070710_10001259 | 3300005437 | Bacteria | 12036 |
| 27 | Ga0070710_10007741 | 3300005437 | Bacteria | 5211 |
| 28 | Ga0070710_10023313 | 3300005437 | Bacteria | 3252 |
| 29 | Ga0070701_10052418 | 3300005438 | Bacteria | 2119 |
| 30 | Ga0070711_100000948 | 3300005439 | Bacteria | 15349 |
| 31 | Ga0070711_100004411 | 3300005439 | Bacteria | 8302 |
| 32 | Ga0070708_100001252 | 3300005445 | Bacteria | 19517 |
| 33 | Ga0070708_100006873 | 3300005445 | Bacteria | 9076 |
| 34 | Ga0070708_100046927 | 3300005445 | Bacteria | 3814 |
| 35 | Ga0070708_100073284 | 3300005445 | Unclassified | 3086 |
| 36 | Ga0070663_100226734 | 3300005455 | Bacteria | 1469 |
| 37 | Ga0070662_100021084 | 3300005457 | Bacteria | 4446 |
| 38 | Ga0070681_10045318 | 3300005458 | Bacteria | 4400 |
| 39 | Ga0068867_100006056 | 3300005459 | Bacteria | 8571 |
| 40 | Ga0070706_100004861 | 3300005467 | Bacteria | 12871 |
| 41 | Ga0070706_100069388 | 3300005467 | Unclassified | 3260 |
| 42 | Ga0070707_100098145 | 3300005468 | Bacteria | 2837 |
| 43 | Ga0070707_100128253 | 3300005468 | Bacteria | 2465 |
| 44 | Ga0070698_100003126 | 3300005471 | Bacteria | 18238 |
| 45 | Ga0070699_100001451 | 3300005518 | Bacteria | 21740 |
| 46 | Ga0070699_100109792 | 3300005518 | Bacteria | 2421 |
| 47 | Ga0070679_100063015 | 3300005530 | Bacteria | 3696 |
| 48 | Ga0070684_100003436 | 3300005535 | Bacteria | 11890 |
| 49 | Ga0070684_100282970 | 3300005535 | Bacteria | 1519 |
| 50 | Ga0070697_100000069 | 3300005536 | Bacteria | 82627 |
| 51 | Ga0070697_100000656 | 3300005536 | Bacteria | 26071 |
| 52 | Ga0070697_100098435 | 3300005536 | Bacteria | 2427 |
| 53 | Ga0068853_100060451 | 3300005539 | Bacteria | 3274 |
| 54 | Ga0070672_100014807 | 3300005543 | Bacteria | 5534 |
| 55 | Ga0070696_100032578 | 3300005546 | Bacteria | 3576 |
| 56 | Ga0068855_100030202 | 3300005563 | Bacteria | 6482 |
| 57 | Ga0070664_100071862 | 3300005564 | Bacteria | 2966 |
| 58 | Ga0068857_100004889 | 3300005577 | Bacteria | 11367 |
| 59 | Ga0068854_100233269 | 3300005578 | Bacteria | 1462 |
| 60 | Ga0068852_100089617 | 3300005616 | Bacteria | 2749 |
| 61 | Ga0068859_100085365 | 3300005617 | Bacteria | 3202 |
| 62 | Ga0068864_100017734 | 3300005618 | Bacteria | 5938 |
| 63 | Ga0068866_10039580 | 3300005718 | Bacteria | 2328 |
| 64 | Ga0068851_10003975 | 3300005834 | Bacteria | 6624 |
| 65 | Ga0068870_10037373 | 3300005840 | Bacteria | 2503 |
| 66 | Ga0068863_100029017 | 3300005841 | Bacteria | 5285 |
| 67 | Ga0068863_100050544 | 3300005841 | Bacteria | 3940 |
| 68 | Ga0068858_100014594 | 3300005842 | Bacteria | 7400 |
| 69 | Ga0068860_100176106 | 3300005843 | Bacteria | 2067 |
| 70 | Ga0070717_10018677 | 3300006028 | Bacteria | 5421 |
| 71 | Ga0070717_10073870 | 3300006028 | Bacteria | 2850 |
| 72 | Ga0070715_10012674 | 3300006163 | Bacteria | 3076 |
| 73 | Ga0070715_10019418 | 3300006163 | Unclassified | 2606 |
| 74 | Ga0070716_100084570 | 3300006173 | Unclassified | 1903 |
| 75 | Ga0070712_100000010 | 3300006175 | Bacteria | 143560 |
| 76 | Ga0070712_100001607 | 3300006175 | Bacteria | 13809 |
| 77 | Ga0070712_100004072 | 3300006175 | Bacteria | 8973 |
| 78 | Ga0070712_100030616 | 3300006175 | Unclassified | 3619 |
| 79 | Ga0068871_100093353 | 3300006358 | Bacteria | 2510 |
| 80 | Ga0075433_10001506 | 3300006852 | Bacteria | 17214 |
| 81 | Ga0075434_100000104 | 3300006871 | Bacteria | 47845 |
| 82 | Ga0068865_100008192 | 3300006881 | Bacteria | 6452 |
| 83 | Ga0075436_100007882 | 3300006914 | Bacteria | 7288 |
| 84 | Ga0075436_100070030 | 3300006914 | Bacteria | 2424 |
| 85 | Ga0097620_100085359 | 3300006931 | Bacteria | 3202 |
| 86 | Ga0075435_100000354 | 3300007076 | Bacteria | 28199 |
| 87 | Ga0099795_10016560 | 3300007788 | Unclassified | 2333 |
| 88 | Ga0105245_10051484 | 3300009098 | Bacteria | 3691 |
| 89 | Ga0105245_10082428 | 3300009098 | Bacteria | 2942 |
| 90 | Ga0105241_10062049 | 3300009174 | Bacteria | 2880 |
| 91 | Ga0105248_10439678 | 3300009177 | Bacteria | 1469 |
| 92 | Ga0105237_10045407 | 3300009545 | Bacteria | 4422 |
| 93 | Ga0105238_10030986 | 3300009551 | Bacteria | 5444 |
| 94 | Ga0105249_10062460 | 3300009553 | Bacteria | 3421 |
| 95 | Ga0105249_10178849 | 3300009553 | Bacteria | 2062 |
| 96 | Ga0099796_10009958 | 3300010159 | Unclassified | 2594 |
| 97 | Ga0105239_10024109 | 3300010375 | Bacteria | 6701 |
| 98 | Ga0105239_10040621 | 3300010375 | Bacteria | 5097 |
| 99 | Ga0105246_10052837 | 3300011119 | Bacteria | 2794 |
| 100 | Ga0157373_10003491 | 3300013100 | Bacteria | 11888 |
| 101 | Ga0157371_10002263 | 3300013102 | Bacteria | 18560 |
| 102 | Ga0157374_10018087 | 3300013296 | Bacteria | 6216 |
| 103 | Ga0157374_10206708 | 3300013296 | Bacteria | 1924 |
| 104 | Ga0163162_10391768 | 3300013306 | Bacteria | 1522 |
| 105 | Ga0157372_10002166 | 3300013307 | Bacteria | 21379 |
| 106 | Ga0157372_10066357 | 3300013307 | Bacteria | 4054 |
| 107 | Ga0157375_10099654 | 3300013308 | Bacteria | 2985 |
| 108 | Ga0163163_10019291 | 3300014325 | Bacteria | 6403 |
| 109 | Ga0163163_10021772 | 3300014325 | Bacteria | 6056 |
| 110 | Ga0157380_10019640 | 3300014326 | Bacteria | 5038 |
| 111 | Ga0182008_10004248 | 3300014497 | Bacteria | 8398 |
| 112 | Ga0157377_10015610 | 3300014745 | Bacteria | 3891 |
| 113 | Ga0157379_10177935 | 3300014968 | Bacteria | 1921 |
| 114 | Ga0157376_10009054 | 3300014969 | Bacteria | 7212 |
| 115 | Ga0157376_10017166 | 3300014969 | Bacteria | 5513 |
| 116 | Ga0182007_10015020 | 3300015262 | Bacteria | 2902 |
| 117 | Ga0182005_1009903 | 3300015265 | Bacteria | 2755 |
| 118 | Ga0163161_10001086 | 3300017792 | Bacteria | 20609 |
| 119 | Ga0213874_10001758 | 3300021377 | Unclassified | 4553 |
| 120 | Ga0224570_100055 | 3300022730 | Bacteria | 5938 |
| 121 | Ga0228598_1003045 | 3300024227 | Bacteria | 3632 |
| 122 | Ga0228598_1007838 | 3300024227 | Unclassified | 2166 |
| 123 | Ga0207697_10005002 | 3300025315 | Bacteria | 6237 |
| 124 | Ga0207692_10000836 | 3300025898 | Bacteria | 11035 |
| 125 | Ga0207647_10013514 | 3300025904 | Bacteria | 5654 |
| 126 | Ga0207685_10007053 | 3300025905 | Bacteria | 3106 |
| 127 | Ga0207699_10008604 | 3300025906 | Bacteria | 5044 |
| 128 | Ga0207699_10011585 | 3300025906 | Unclassified | 4460 |
| 129 | Ga0207699_10014790 | 3300025906 | Bacteria | 4036 |
| 130 | Ga0207645_10000273 | 3300025907 | Bacteria | 42696 |
| 131 | Ga0207643_10005517 | 3300025908 | Bacteria | 6762 |
| 132 | Ga0207705_10248463 | 3300025909 | Bacteria | 1356 |
| 133 | Ga0207684_10000677 | 3300025910 | Bacteria | 40393 |
| 134 | Ga0207684_10049869 | 3300025910 | Unclassified | 3551 |
| 135 | Ga0207707_10001602 | 3300025912 | Bacteria | 20874 |
| 136 | Ga0207693_10000029 | 3300025915 | Bacteria | 118724 |
| 137 | Ga0207693_10000985 | 3300025915 | Bacteria | 25547 |
| 138 | Ga0207693_10023281 | 3300025915 | Bacteria | 4919 |
| 139 | Ga0207657_10000845 | 3300025919 | Bacteria | 32438 |
| 140 | Ga0207657_10021886 | 3300025919 | Bacteria | 6004 |
| 141 | Ga0207649_10004928 | 3300025920 | Bacteria | 7216 |
| 142 | Ga0207646_10003352 | 3300025922 | Bacteria | 18172 |
| 143 | Ga0207650_10000036 | 3300025925 | Bacteria | 214579 |
| 144 | Ga0207659_10039532 | 3300025926 | Bacteria | 3291 |
| 145 | Ga0207700_10000428 | 3300025928 | Bacteria | 24716 |
| 146 | Ga0207700_10021061 | 3300025928 | Bacteria | 4444 |
| 147 | Ga0207700_10102135 | 3300025928 | Bacteria | 2289 |
| 148 | Ga0207664_10000017 | 3300025929 | Bacteria | 230967 |
| 149 | Ga0207664_10003445 | 3300025929 | Bacteria | 10545 |
| 150 | Ga0207664_10356105 | 3300025929 | Unclassified | 1296 |
| 151 | Ga0207644_10134249 | 3300025931 | Bacteria | 1898 |
| 152 | Ga0207690_10039972 | 3300025932 | Bacteria | 3063 |
| 153 | Ga0207706_10000697 | 3300025933 | Bacteria | 35077 |
| 154 | Ga0207706_10005630 | 3300025933 | Bacteria | 11671 |
| 155 | Ga0207669_10082709 | 3300025937 | Unclassified | 2062 |
| 156 | Ga0207704_10216716 | 3300025938 | Bacteria | 1413 |
| 157 | Ga0207665_10007153 | 3300025939 | Bacteria | 7384 |
| 158 | Ga0207665_10033968 | 3300025939 | Bacteria | 3384 |
| 159 | Ga0207665_10074587 | 3300025939 | Bacteria | 2322 |
| 160 | Ga0207665_10197249 | 3300025939 | Unclassified | 1465 |
| 161 | Ga0207691_10006241 | 3300025940 | Bacteria | 11513 |
| 162 | Ga0207711_10106481 | 3300025941 | Bacteria | 2488 |
| 163 | Ga0207689_10001841 | 3300025942 | Bacteria | 20076 |
| 164 | Ga0207661_10000527 | 3300025944 | Bacteria | 24587 |
| 165 | Ga0207679_10001832 | 3300025945 | Bacteria | 13227 |
| 166 | Ga0207679_10033592 | 3300025945 | Bacteria | 3611 |
| 167 | Ga0207658_10120551 | 3300025986 | Bacteria | 2090 |
| 168 | Ga0207678_10000543 | 3300026067 | Bacteria | 34457 |
| 169 | Ga0207702_10058152 | 3300026078 | Bacteria | 3290 |
| 170 | Ga0207641_10000009 | 3300026088 | Bacteria | 407901 |
| 171 | Ga0207648_10001467 | 3300026089 | Bacteria | 25947 |
| 172 | Ga0207676_10000092 | 3300026095 | Bacteria | 80704 |
| 173 | Ga0207676_10118311 | 3300026095 | Bacteria | 2230 |
| 174 | Ga0207674_10000016 | 3300026116 | Bacteria | 182470 |
| 175 | Ga0207683_10000359 | 3300026121 | Bacteria | 41891 |
| 176 | Ga0207698_10034063 | 3300026142 | Bacteria | 3709 |
| 177 | Ga0207698_10251432 | 3300026142 | Bacteria | 1618 |
| 178 | Ga0265356_1000162 | 3300028017 | Bacteria | 12140 |
| 179 | Ga0268266_10018145 | 3300028379 | Bacteria | 5998 |
| 180 | Ga0265318_10009264 | 3300028577 | Bacteria | 4341 |
| 181 | Ga0265338_10019275 | 3300028800 | Bacteria | 7252 |
| 182 | Ga0265338_10034403 | 3300028800 | Bacteria | 4898 |
| 183 | Ga0265338_10132316 | 3300028800 | Bacteria | 1967 |
| 184 | Ga0265762_1000235 | 3300030760 | Bacteria | 8982 |
| 185 | Ga0265762_1001269 | 3300030760 | Bacteria | 4592 |
| 186 | Ga0265762_1003043 | 3300030760 | Bacteria | 2998 |
| 187 | Ga0265760_10004887 | 3300031090 | Bacteria | 3837 |
| 188 | Ga0265760_10006939 | 3300031090 | Bacteria | 3247 |
| 189 | Ga0265760_10008151 | 3300031090 | Bacteria | 2994 |
| 190 | Ga0265330_10011112 | 3300031235 | Bacteria | 4226 |
| 191 | Ga0265328_10042872 | 3300031239 | Bacteria | 1665 |
| 192 | Ga0265320_10030684 | 3300031240 | Bacteria | 2769 |
| 193 | Ga0265325_10003980 | 3300031241 | Bacteria | 9454 |
| 194 | Ga0265325_10004207 | 3300031241 | Bacteria | 9142 |
| 195 | Ga0265325_10087521 | 3300031241 | Unclassified | 1539 |
| 196 | Ga0265340_10004587 | 3300031247 | Bacteria | 7693 |
| 197 | Ga0265340_10012107 | 3300031247 | Bacteria | 4562 |
| 198 | Ga0265340_10057897 | 3300031247 | Bacteria | 1861 |
| 199 | Ga0265339_10017547 | 3300031249 | Bacteria | 4236 |
| 200 | Ga0265339_10047072 | 3300031249 | Bacteria | 2369 |
| 201 | Ga0265339_10051682 | 3300031249 | Bacteria | 2241 |
| 202 | Ga0265339_10052050 | 3300031249 | Bacteria | 2232 |
| 203 | Ga0265331_10018283 | 3300031250 | Bacteria | 3640 |
| 204 | Ga0265331_10027335 | 3300031250 | Bacteria | 2860 |
| 205 | Ga0265327_10012412 | 3300031251 | Bacteria | 5754 |
| 206 | Ga0265316_10011925 | 3300031344 | Bacteria | 7814 |
| 207 | Ga0265316_10233950 | 3300031344 | Bacteria | 1352 |
| 208 | Ga0265313_10021592 | 3300031595 | Bacteria | 3517 |
| 209 | Ga0265314_10003195 | 3300031711 | Bacteria | 16042 |
| 210 | Ga0265314_10008894 | 3300031711 | Bacteria | 8567 |
| 211 | Ga0265314_10063789 | 3300031711 | Bacteria | 2498 |
| 212 | Ga0265342_10007050 | 3300031712 | Bacteria | 8287 |
| 213 | Ga0265342_10021341 | 3300031712 | Unclassified | 4139 |
| 214 | Ga0373926_0025141 | 3300035083 | Unclassified | 2077 |
| 215 | Ga0373934_0018377 | 3300035086 | Bacteria | 2674 |
| 216 | Ga0373923_0033244 | 3300035111 | Unclassified | 2088 |
| 217 | Ga0373936_0009819 | 3300035113 | Bacteria | 3611 |
| 218 | Ga0373936_0021553 | 3300035113 | Bacteria | 2506 |
| 219 | Ga0373953_0006362 | 3300035117 | Bacteria | 3888 |
| 220 | Ga0373956_0003888 | 3300035119 | Bacteria | 6004 |
| 221 | Ga0373943_0005454 | 3300035170 | Bacteria | 5723 |
| 222 | Ga0373943_0024591 | 3300035170 | Bacteria | 2809 |
| 223 | Ga0373946_0063409 | 3300035171 | Unclassified | 1578 |
| 224 | Ga0373955_0022640 | 3300035172 | Unclassified | 3190 |
| 225 | Ga0373955_0058885 | 3300035172 | Bacteria | 2114 |
| 226 | Ga0373955_0113500 | 3300035172 | Bacteria | 1568 |
| 227 | Ga0373935_0048925 | 3300035692 | Unclassified | 2679 |
| 228 | Ga0373935_0070358 | 3300035692 | Unclassified | 2255 |
| 229 | Ga0373927_0004063 | 3300035695 | Bacteria | 10327 |
| 230 | Ga0373927_0049778 | 3300035695 | Bacteria | 2709 |
| 231 | Ga0373927_0079182 | 3300035695 | Bacteria | 2129 |
| 232 | Ga0373927_0109973 | 3300035695 | Bacteria | 1795 |
| 233 | Ga0373947_0057794 | 3300035725 | Unclassified | 2348 |
| 234 | Ga0373947_0062780 | 3300035725 | Bacteria | 2262 |
| 235 | Ga0373937_0108577 | 3300036401 | Bacteria | 2580 |
| 236 | Ga0373937_0134555 | 3300036401 | Bacteria | 2310 |
| 237 | Ga0373925_0036420 | 3300037068 | Bacteria | 3631 |
| 238 | Ga0373925_0040002 | 3300037068 | Bacteria | 3470 |
| 239 | Ga0373925_0051151 | 3300037068 | Unclassified | 3083 |
| 240 | Ga0373925_0057532 | 3300037068 | Bacteria | 2913 |
| 241 | Ga0395905_0008810 | 3300037471 | Bacteria | 9914 |
| 242 | Ga0436365_1054972 | 3300039437 | Bacteria | 2144 |
| 243 | Ga0436363_0575896 | 3300039450 | Bacteria | 9060 |
| 244 | Ga0451577_0000157 | 3300042876 | Bacteria | 151953 |
| 245 | Ga0466963_0000567 | 3300044694 | Bacteria | 17458 |
| 246 | Ga0466963_0005107 | 3300044694 | Bacteria | 7667 |
| 247 | Ga0453684_0000324 | 3300044712 | Bacteria | 201431 |
| 248 | Ga0466957_0136121 | 3300044842 | Unclassified | 1579 |
| 249 | Ga0466959_0020125 | 3300045049 | Bacteria | 4914 |
| 250 | Ga0466967_0003579 | 3300045976 | Bacteria | 10194 |
| 251 | Ga0466967_0008652 | 3300045976 | Bacteria | 7484 |
| 252 | Ga0466967_0060960 | 3300045976 | Bacteria | 3345 |
| 253 | Ga0466967_0104922 | 3300045976 | Bacteria | 2588 |
| 254 | Ga0466967_0127484 | 3300045976 | Unclassified | 2359 |
| 255 | Ga0495592_0135944 | 3300046454 | Bacteria | 1714 |
| 256 | Ga0495580_0000264 | 3300046472 | Bacteria | 41999 |
| 257 | Ga0495580_0001787 | 3300046472 | Bacteria | 18892 |
| 258 | Ga0495580_0010787 | 3300046472 | Bacteria | 7096 |
| 259 | Ga0495580_0035910 | 3300046472 | Bacteria | 3563 |
| 260 | Ga0495580_0070402 | 3300046472 | Unclassified | 2443 |
| 261 | Ga0495580_0300537 | 3300046472 | Bacteria | 1093 |
| 262 | Ga0495582_0000791 | 3300046473 | Bacteria | 17527 |
| 263 | Ga0495582_0002367 | 3300046473 | Bacteria | 10551 |
| 264 | Ga0495628_0005236 | 3300046516 | Bacteria | 11385 |
| 265 | Ga0495628_0023093 | 3300046516 | Bacteria | 5106 |
| 266 | Ga0495630_0101238 | 3300046517 | Bacteria | 2179 |
| 267 | Ga0495652_0006059 | 3300046529 | Bacteria | 11308 |
| 268 | Ga0495652_0075675 | 3300046529 | Bacteria | 2795 |
| 269 | Ga0495665_0069483 | 3300046531 | Unclassified | 1856 |
| 270 | Ga0495640_0168567 | 3300046533 | Bacteria | 1400 |
| 271 | Ga0495586_0037098 | 3300046535 | Bacteria | 2616 |
| 272 | Ga0495645_0009704 | 3300046543 | Bacteria | 6732 |
| 273 | Ga0495645_0194058 | 3300046543 | Unclassified | 1382 |
| 274 | Ga0495657_0113949 | 3300046675 | Bacteria | 1710 |
| 275 | Ga0495599_0000794 | 3300046678 | Bacteria | 17733 |
| 276 | Ga0495599_0008293 | 3300046678 | Bacteria | 6319 |
| 277 | Ga0495669_0014400 | 3300046684 | Bacteria | 3381 |
| 278 | Ga0495669_0029357 | 3300046684 | Bacteria | 2411 |
| 279 | Ga0495624_0083910 | 3300046690 | Unclassified | 1970 |
| 280 | Ga0495581_0047846 | 3300047315 | Bacteria | 2471 |
| 281 | Ga0495674_0022498 | 3300047319 | Bacteria | 5815 |
| 282 | Ga0495674_0057037 | 3300047319 | Unclassified | 3419 |
| 283 | Ga0495674_0102307 | 3300047319 | Bacteria | 2436 |
| 284 | Ga0495674_0181799 | 3300047319 | Bacteria | 1751 |
| 285 | Ga0496100_0014249 | 3300048903 | Bacteria | 4612 |
| 286 | Ga0496101_0161618 | 3300048904 | Bacteria | 1718 |
| 287 | Ga0496104_0010688 | 3300048907 | Bacteria | 8206 |
| 288 | Ga0496106_0396990 | 3300048909 | Bacteria | 1108 |
| 289 | Ga0496107_0074383 | 3300048910 | Bacteria | 2472 |
| 290 | Ga0496108_0000477 | 3300048911 | Bacteria | 32062 |
| 291 | Ga0496108_0079740 | 3300048911 | Bacteria | 2772 |
| 292 | Ga0496109_0000020 | 3300048912 | Bacteria | 189962 |
| 293 | Ga0496110_0004805 | 3300048913 | Bacteria | 10525 |
| 294 | Ga0496110_0547722 | 3300048913 | Bacteria | 1051 |
| 295 | Ga0496111_0003429 | 3300048914 | Bacteria | 9805 |
| 296 | Ga0496112_0000402 | 3300048915 | Bacteria | 28279 |
| 297 | Ga0496113_0001283 | 3300048916 | Bacteria | 13863 |
| 298 | Ga0496113_0016185 | 3300048916 | Bacteria | 5147 |
| 299 | Ga0496115_0133268 | 3300048918 | Bacteria | 2048 |
| 300 | Ga0501073_0009046 | 3300049589 | Bacteria | 7354 |
| 301 | Ga0501077_0085230 | 3300049593 | Bacteria | 2003 |
| 302 | nmdc:mga0n895_279_c1 | 3300050512 | Bacteria | 33669 |
| 303 | nmdc:mga0rr50_267_c1 | 3300050513 | Bacteria | 28320 |
| 304 | nmdc:mga08x19_221285_c1 | 3300050514 | Unclassified | 1301 |
| 305 | nmdc:mga0a205_379_c1 | 3300050515 | Bacteria | 33748 |
| 306 | Ga0495601_0003324 | 3300053077 | Bacteria | 9202 |
| 307 | Ga0495601_0036654 | 3300053077 | Unclassified | 3064 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046535 | Ga0495586_0037098 | Ga0495586_0037098_336_1229 | 276 |
| 2 | 3300046472 | Ga0495580_0300537 | Ga0495580_0300537_116_1066 | 310 |
| 3 | 3300035172 | Ga0373955_0113500 | Ga0373955_0113500_456_1466 | 314 |
| 4 | 3300037068 | Ga0373925_0057532 | Ga0373925_0057532_76_1086 | 314 |
| 5 | 3300047319 | Ga0495674_0102307 | Ga0495674_0102307_29_1039 | 314 |
| 6 | 3300048913 | Ga0496110_0547722 | Ga0496110_0547722_19_987 | 322 |
| 7 | 3300009553 | Ga0105249_10178849 | Ga0105249_101788492 | 328 |
| 8 | 3300013307 | Ga0157372_10002166 | Ga0157372_1000216619 | 328 |
| 9 | 3300048909 | Ga0496106_0396990 | Ga0496106_0396990_59_1045 | 328 |
| 10 | 3300046472 | Ga0495580_0035910 | Ga0495580_0035910_1838_2947 | 333 |
| 11 | 3300046533 | Ga0495640_0168567 | Ga0495640_0168567_129_1238 | 333 |
| 12 | 3300047319 | Ga0495674_0022498 | Ga0495674_0022498_3007_4116 | 333 |
| 13 | 3300035113 | Ga0373936_0021553 | Ga0373936_0021553_187_1341 | 346 |
| 14 | 3300035170 | Ga0373943_0005454 | Ga0373943_0005454_3807_4961 | 346 |
| 15 | 3300037068 | Ga0373925_0040002 | Ga0373925_0040002_58_1212 | 346 |
| 16 | 3300035171 | Ga0373946_0063409 | Ga0373946_0063409_75_1136 | 348 |
| 17 | 3300035695 | Ga0373927_0109973 | Ga0373927_0109973_39_1100 | 348 |
| 18 | 3300046454 | Ga0495592_0135944 | Ga0495592_0135944_461_1573 | 349 |
| 19 | 3300046516 | Ga0495628_0005236 | Ga0495628_0005236_5461_6573 | 349 |
| 20 | 3300046516 | Ga0495628_0023093 | Ga0495628_0023093_1394_2458 | 349 |
| 21 | 3300046529 | Ga0495652_0006059 | Ga0495652_0006059_7804_8868 | 349 |
| 22 | 3300046529 | Ga0495652_0075675 | Ga0495652_0075675_229_1341 | 349 |
| 23 | 3300046543 | Ga0495645_0009704 | Ga0495645_0009704_4900_5964 | 349 |
| 24 | 3300046678 | Ga0495599_0000794 | Ga0495599_0000794_2476_3540 | 349 |
| 25 | 3300046678 | Ga0495599_0008293 | Ga0495599_0008293_376_1488 | 349 |
| 26 | 3300053077 | Ga0495601_0003324 | Ga0495601_0003324_3965_5077 | 349 |
| 27 | 3300005536 | Ga0070697_100000069 | Ga0070697_10000006918 | 352 |
| 28 | 3300006358 | Ga0068871_100093353 | Ga0068871_1000933532 | 354 |
| 29 | 3300014969 | Ga0157376_10009054 | Ga0157376_100090543 | 354 |
| 30 | 3300035086 | Ga0373934_0018377 | Ga0373934_0018377_1408_2598 | 360 |
| 31 | 3300035117 | Ga0373953_0006362 | Ga0373953_0006362_653_1843 | 360 |
| 32 | 3300036401 | Ga0373937_0134555 | Ga0373937_0134555_94_1284 | 360 |
| 33 | 3300045976 | Ga0466967_0060960 | Ga0466967_0060960_1742_2947 | 361 |
| 34 | 3300006852 | Ga0075433_10001506 | Ga0075433_100015068 | 362 |
| 35 | 3300006871 | Ga0075434_100000104 | Ga0075434_10000010433 | 362 |
| 36 | 3300006914 | Ga0075436_100007882 | Ga0075436_1000078825 | 362 |
| 37 | 3300007076 | Ga0075435_100000354 | Ga0075435_10000035417 | 362 |
| 38 | 3300050512 | nmdc:mga0n895_279_c1 | nmdc:mga0n895_279_c1_24197_25342 | 362 |
| 39 | 3300050513 | nmdc:mga0rr50_267_c1 | nmdc:mga0rr50_267_c1_25748_26893 | 362 |
| 40 | 3300050515 | nmdc:mga0a205_379_c1 | nmdc:mga0a205_379_c1_15881_17026 | 362 |
| 41 | 3300044694 | Ga0466963_0005107 | Ga0466963_0005107_5712_6866 | 363 |
| 42 | 3300044842 | Ga0466957_0136121 | Ga0466957_0136121_314_1468 | 363 |
| 43 | 3300005435 | Ga0070714_100000060 | Ga0070714_10000006085 | 365 |
| 44 | 3300025929 | Ga0207664_10000017 | Ga0207664_10000017201 | 365 |
| 45 | 3300031241 | Ga0265325_10004207 | Ga0265325_100042076 | 365 |
| 46 | 3300028800 | Ga0265338_10034403 | Ga0265338_100344033 | 366 |
| 47 | 3300031241 | Ga0265325_10087521 | Ga0265325_100875211 | 367 |
| 48 | 3300031247 | Ga0265340_10057897 | Ga0265340_100578972 | 367 |
| 49 | 3300045976 | Ga0466967_0127484 | Ga0466967_0127484_1065_2249 | 368 |
| 50 | 3300005518 | Ga0070699_100109792 | Ga0070699_1001097922 | 369 |
| 51 | 3300006028 | Ga0070717_10018677 | Ga0070717_100186772 | 369 |
| 52 | 3300006914 | Ga0075436_100070030 | Ga0075436_1000700302 | 369 |
| 53 | 3300035119 | Ga0373956_0003888 | Ga0373956_0003888_102_1247 | 369 |
| 54 | 3300035172 | Ga0373955_0058885 | Ga0373955_0058885_901_2046 | 369 |
| 55 | 3300035695 | Ga0373927_0049778 | Ga0373927_0049778_669_1940 | 369 |
| 56 | 3300035695 | Ga0373927_0079182 | Ga0373927_0079182_653_1798 | 369 |
| 57 | 3300035725 | Ga0373947_0062780 | Ga0373947_0062780_18_1145 | 369 |
| 58 | 3300036401 | Ga0373937_0108577 | Ga0373937_0108577_727_1872 | 369 |
| 59 | 3300005436 | Ga0070713_100068175 | Ga0070713_1000681752 | 370 |
| 60 | 3300006175 | Ga0070712_100030616 | Ga0070712_1000306162 | 370 |
| 61 | 3300025906 | Ga0207699_10011585 | Ga0207699_100115854 | 370 |
| 62 | 3300025915 | Ga0207693_10023281 | Ga0207693_100232813 | 370 |
| 63 | 3300025928 | Ga0207700_10102135 | Ga0207700_101021352 | 370 |
| 64 | 3300025939 | Ga0207665_10007153 | Ga0207665_100071533 | 370 |
| 65 | 3300025939 | Ga0207665_10197249 | Ga0207665_101972491 | 370 |
| 66 | 3300028800 | Ga0265338_10019275 | Ga0265338_100192753 | 370 |
| 67 | 3300031249 | Ga0265339_10051682 | Ga0265339_100516822 | 370 |
| 68 | 3300035083 | Ga0373926_0025141 | Ga0373926_0025141_22_1284 | 370 |
| 69 | 3300035692 | Ga0373935_0070358 | Ga0373935_0070358_86_1363 | 370 |
| 70 | 3300035725 | Ga0373947_0057794 | Ga0373947_0057794_937_2214 | 370 |
| 71 | 3300037068 | Ga0373925_0051151 | Ga0373925_0051151_491_1768 | 370 |
| 72 | 3300046472 | Ga0495580_0070402 | Ga0495580_0070402_298_1575 | 370 |
| 73 | 3300046473 | Ga0495582_0002367 | Ga0495582_0002367_8609_9871 | 370 |
| 74 | 3300046531 | Ga0495665_0069483 | Ga0495665_0069483_488_1750 | 370 |
| 75 | 3300050514 | nmdc:mga08x19_221285_c1 | nmdc:mga08x19_221285_c1_19_1281 | 370 |
| 76 | 3300005436 | Ga0070713_100001036 | Ga0070713_1000010368 | 371 |
| 77 | 3300005437 | Ga0070710_10007741 | Ga0070710_100077412 | 371 |
| 78 | 3300005439 | Ga0070711_100004411 | Ga0070711_1000044115 | 371 |
| 79 | 3300006163 | Ga0070715_10019418 | Ga0070715_100194182 | 371 |
| 80 | 3300006175 | Ga0070712_100000010 | Ga0070712_10000001071 | 371 |
| 81 | 3300007788 | Ga0099795_10016560 | Ga0099795_100165602 | 371 |
| 82 | 3300010159 | Ga0099796_10009958 | Ga0099796_100099582 | 371 |
| 83 | 3300025906 | Ga0207699_10008604 | Ga0207699_100086043 | 371 |
| 84 | 3300025915 | Ga0207693_10000029 | Ga0207693_1000002974 | 371 |
| 85 | 3300025928 | Ga0207700_10000428 | Ga0207700_1000042814 | 371 |
| 86 | 3300049589 | Ga0501073_0009046 | Ga0501073_0009046_158_1276 | 371 |
| 87 | 3300049593 | Ga0501077_0085230 | Ga0501077_0085230_748_1866 | 371 |
| 88 | 3300005439 | Ga0070711_100000948 | Ga0070711_1000009487 | 372 |
| 89 | 3300006175 | Ga0070712_100004072 | Ga0070712_1000040723 | 372 |
| 90 | 3300025906 | Ga0207699_10014790 | Ga0207699_100147903 | 372 |
| 91 | 3300025915 | Ga0207693_10000985 | Ga0207693_100009855 | 372 |
| 92 | 3300028577 | Ga0265318_10009264 | Ga0265318_100092644 | 372 |
| 93 | 3300031240 | Ga0265320_10030684 | Ga0265320_100306842 | 372 |
| 94 | 3300031249 | Ga0265339_10047072 | Ga0265339_100470722 | 372 |
| 95 | 3300031250 | Ga0265331_10027335 | Ga0265331_100273352 | 372 |
| 96 | 3300031711 | Ga0265314_10063789 | Ga0265314_100637892 | 372 |
| 97 | 3300031712 | Ga0265342_10021341 | Ga0265342_100213413 | 372 |
| 98 | 3300035695 | Ga0373927_0004063 | Ga0373927_0004063_9004_10251 | 372 |
| 99 | 3300046690 | Ga0495624_0083910 | Ga0495624_0083910_183_1421 | 372 |
| 100 | 3300047319 | Ga0495674_0057037 | Ga0495674_0057037_129_1367 | 372 |
| 101 | 3300005435 | Ga0070714_100166645 | Ga0070714_1001666451 | 373 |
| 102 | 3300005437 | Ga0070710_10023313 | Ga0070710_100233132 | 373 |
| 103 | 3300025929 | Ga0207664_10356105 | Ga0207664_103561052 | 373 |
| 104 | 3300030760 | Ga0265762_1000235 | Ga0265762_10002353 | 373 |
| 105 | 3300005436 | Ga0070713_100002374 | Ga0070713_1000023744 | 374 |
| 106 | 3300005546 | Ga0070696_100032578 | Ga0070696_1000325782 | 374 |
| 107 | 3300006173 | Ga0070716_100084570 | Ga0070716_1000845702 | 374 |
| 108 | 3300006175 | Ga0070712_100001607 | Ga0070712_1000016074 | 374 |
| 109 | 3300025928 | Ga0207700_10021061 | Ga0207700_100210612 | 374 |
| 110 | 3300031239 | Ga0265328_10042872 | Ga0265328_100428721 | 374 |
| 111 | 3300031241 | Ga0265325_10003980 | Ga0265325_100039805 | 374 |
| 112 | 3300031247 | Ga0265340_10004587 | Ga0265340_100045874 | 374 |
| 113 | 3300031249 | Ga0265339_10052050 | Ga0265339_100520502 | 374 |
| 114 | 3300031250 | Ga0265331_10018283 | Ga0265331_100182833 | 374 |
| 115 | 3300031251 | Ga0265327_10012412 | Ga0265327_100124122 | 374 |
| 116 | 3300031344 | Ga0265316_10233950 | Ga0265316_102339501 | 374 |
| 117 | 3300031595 | Ga0265313_10021592 | Ga0265313_100215922 | 374 |
| 118 | 3300031712 | Ga0265342_10007050 | Ga0265342_100070504 | 374 |
| 119 | 3300045049 | Ga0466959_0020125 | Ga0466959_0020125_1332_2474 | 374 |
| 120 | 3300005329 | Ga0070683_100004635 | Ga0070683_1000046355 | 375 |
| 121 | 3300005331 | Ga0070670_100014084 | Ga0070670_1000140842 | 375 |
| 122 | 3300005333 | Ga0070677_10021467 | Ga0070677_100214672 | 375 |
| 123 | 3300005335 | Ga0070666_10024735 | Ga0070666_100247352 | 375 |
| 124 | 3300005338 | Ga0068868_100098498 | Ga0068868_1000984982 | 375 |
| 125 | 3300005338 | Ga0068868_100261427 | Ga0068868_1002614271 | 375 |
| 126 | 3300005339 | Ga0070660_100000802 | Ga0070660_10000080213 | 375 |
| 127 | 3300005340 | Ga0070689_100002279 | Ga0070689_1000022792 | 375 |
| 128 | 3300005344 | Ga0070661_100067440 | Ga0070661_1000674402 | 375 |
| 129 | 3300005353 | Ga0070669_100014103 | Ga0070669_1000141033 | 375 |
| 130 | 3300005356 | Ga0070674_100238838 | Ga0070674_1002388381 | 375 |
| 131 | 3300005365 | Ga0070688_100000324 | Ga0070688_1000003243 | 375 |
| 132 | 3300005366 | Ga0070659_100045544 | Ga0070659_1000455442 | 375 |
| 133 | 3300005434 | Ga0070709_10027145 | Ga0070709_100271452 | 375 |
| 134 | 3300005435 | Ga0070714_100113705 | Ga0070714_1001137052 | 375 |
| 135 | 3300005438 | Ga0070701_10052418 | Ga0070701_100524182 | 375 |
| 136 | 3300005455 | Ga0070663_100226734 | Ga0070663_1002267341 | 375 |
| 137 | 3300005459 | Ga0068867_100006056 | Ga0068867_1000060562 | 375 |
| 138 | 3300005530 | Ga0070679_100063015 | Ga0070679_1000630152 | 375 |
| 139 | 3300005535 | Ga0070684_100003436 | Ga0070684_1000034364 | 375 |
| 140 | 3300005539 | Ga0068853_100060451 | Ga0068853_1000604512 | 375 |
| 141 | 3300005543 | Ga0070672_100014807 | Ga0070672_1000148073 | 375 |
| 142 | 3300005564 | Ga0070664_100071862 | Ga0070664_1000718622 | 375 |
| 143 | 3300005577 | Ga0068857_100004889 | Ga0068857_1000048892 | 375 |
| 144 | 3300005616 | Ga0068852_100089617 | Ga0068852_1000896173 | 375 |
| 145 | 3300005617 | Ga0068859_100085365 | Ga0068859_1000853653 | 375 |
| 146 | 3300005618 | Ga0068864_100017734 | Ga0068864_1000177342 | 375 |
| 147 | 3300005718 | Ga0068866_10039580 | Ga0068866_100395802 | 375 |
| 148 | 3300005834 | Ga0068851_10003975 | Ga0068851_100039753 | 375 |
| 149 | 3300005840 | Ga0068870_10037373 | Ga0068870_100373732 | 375 |
| 150 | 3300005841 | Ga0068863_100050544 | Ga0068863_1000505442 | 375 |
| 151 | 3300005842 | Ga0068858_100014594 | Ga0068858_1000145945 | 375 |
| 152 | 3300005843 | Ga0068860_100176106 | Ga0068860_1001761062 | 375 |
| 153 | 3300006881 | Ga0068865_100008192 | Ga0068865_1000081922 | 375 |
| 154 | 3300006931 | Ga0097620_100085359 | Ga0097620_1000853593 | 375 |
| 155 | 3300009098 | Ga0105245_10051484 | Ga0105245_100514842 | 375 |
| 156 | 3300009098 | Ga0105245_10082428 | Ga0105245_100824283 | 375 |
| 157 | 3300009177 | Ga0105248_10439678 | Ga0105248_104396782 | 375 |
| 158 | 3300009553 | Ga0105249_10062460 | Ga0105249_100624601 | 375 |
| 159 | 3300010375 | Ga0105239_10024109 | Ga0105239_100241093 | 375 |
| 160 | 3300011119 | Ga0105246_10052837 | Ga0105246_100528373 | 375 |
| 161 | 3300013100 | Ga0157373_10003491 | Ga0157373_100034915 | 375 |
| 162 | 3300013102 | Ga0157371_10002263 | Ga0157371_1000226313 | 375 |
| 163 | 3300013296 | Ga0157374_10206708 | Ga0157374_102067082 | 375 |
| 164 | 3300013307 | Ga0157372_10066357 | Ga0157372_100663572 | 375 |
| 165 | 3300013308 | Ga0157375_10099654 | Ga0157375_100996542 | 375 |
| 166 | 3300014325 | Ga0163163_10019291 | Ga0163163_100192913 | 375 |
| 167 | 3300014326 | Ga0157380_10019640 | Ga0157380_100196403 | 375 |
| 168 | 3300014745 | Ga0157377_10015610 | Ga0157377_100156102 | 375 |
| 169 | 3300017792 | Ga0163161_10001086 | Ga0163161_100010863 | 375 |
| 170 | 3300021377 | Ga0213874_10001758 | Ga0213874_100017584 | 375 |
| 171 | 3300025315 | Ga0207697_10005002 | Ga0207697_100050023 | 375 |
| 172 | 3300025904 | Ga0207647_10013514 | Ga0207647_100135142 | 375 |
| 173 | 3300025907 | Ga0207645_10000273 | Ga0207645_1000027321 | 375 |
| 174 | 3300025908 | Ga0207643_10005517 | Ga0207643_100055173 | 375 |
| 175 | 3300025909 | Ga0207705_10248463 | Ga0207705_102484631 | 375 |
| 176 | 3300025912 | Ga0207707_10001602 | Ga0207707_1000160219 | 375 |
| 177 | 3300025919 | Ga0207657_10021886 | Ga0207657_100218864 | 375 |
| 178 | 3300025920 | Ga0207649_10004928 | Ga0207649_100049285 | 375 |
| 179 | 3300025925 | Ga0207650_10000036 | Ga0207650_1000003658 | 375 |
| 180 | 3300025926 | Ga0207659_10039532 | Ga0207659_100395322 | 375 |
| 181 | 3300025931 | Ga0207644_10134249 | Ga0207644_101342492 | 375 |
| 182 | 3300025933 | Ga0207706_10000697 | Ga0207706_1000069710 | 375 |
| 183 | 3300025937 | Ga0207669_10082709 | Ga0207669_100827093 | 375 |
| 184 | 3300025938 | Ga0207704_10216716 | Ga0207704_102167162 | 375 |
| 185 | 3300025940 | Ga0207691_10006241 | Ga0207691_1000624110 | 375 |
| 186 | 3300025941 | Ga0207711_10106481 | Ga0207711_101064812 | 375 |
| 187 | 3300025942 | Ga0207689_10001841 | Ga0207689_100018412 | 375 |
| 188 | 3300025944 | Ga0207661_10000527 | Ga0207661_100005275 | 375 |
| 189 | 3300025945 | Ga0207679_10001832 | Ga0207679_100018322 | 375 |
| 190 | 3300025986 | Ga0207658_10120551 | Ga0207658_101205512 | 375 |
| 191 | 3300026067 | Ga0207678_10000543 | Ga0207678_100005437 | 375 |
| 192 | 3300026078 | Ga0207702_10058152 | Ga0207702_100581524 | 375 |
| 193 | 3300026088 | Ga0207641_10000009 | Ga0207641_1000000948 | 375 |
| 194 | 3300026089 | Ga0207648_10001467 | Ga0207648_100014672 | 375 |
| 195 | 3300026095 | Ga0207676_10000092 | Ga0207676_1000009220 | 375 |
| 196 | 3300026116 | Ga0207674_10000016 | Ga0207674_10000016114 | 375 |
| 197 | 3300026121 | Ga0207683_10000359 | Ga0207683_1000035921 | 375 |
| 198 | 3300026142 | Ga0207698_10034063 | Ga0207698_100340632 | 375 |
| 199 | 3300028379 | Ga0268266_10018145 | Ga0268266_100181454 | 375 |
| 200 | 3300037471 | Ga0395905_0008810 | Ga0395905_0008810_8368_9513 | 375 |
| 201 | 3300039437 | Ga0436365_1054972 | Ga0436365_1054972_560_1714 | 375 |
| 202 | 3300039450 | Ga0436363_0575896 | Ga0436363_0575896_2798_3973 | 375 |
| 203 | 3300042876 | Ga0451577_0000157 | Ga0451577_0000157_148308_149468 | 375 |
| 204 | 3300044694 | Ga0466963_0000567 | Ga0466963_0000567_2034_3170 | 375 |
| 205 | 3300044712 | Ga0453684_0000324 | Ga0453684_0000324_157578_158738 | 375 |
| 206 | 3300045976 | Ga0466967_0003579 | Ga0466967_0003579_3876_5012 | 375 |
| 207 | 3300045976 | Ga0466967_0008652 | Ga0466967_0008652_2338_3474 | 375 |
| 208 | 3300046684 | Ga0495669_0014400 | Ga0495669_0014400_1219_2391 | 375 |
| 209 | 3300046684 | Ga0495669_0029357 | Ga0495669_0029357_945_2093 | 375 |
| 210 | 3300048904 | Ga0496101_0161618 | Ga0496101_0161618_54_1181 | 375 |
| 211 | 3300048910 | Ga0496107_0074383 | Ga0496107_0074383_1298_2425 | 375 |
| 212 | 3300048911 | Ga0496108_0000477 | Ga0496108_0000477_20961_22088 | 375 |
| 213 | 3300048912 | Ga0496109_0000020 | Ga0496109_0000020_182223_183350 | 375 |
| 214 | 3300048913 | Ga0496110_0004805 | Ga0496110_0004805_2077_3204 | 375 |
| 215 | 3300048915 | Ga0496112_0000402 | Ga0496112_0000402_26654_27781 | 375 |
| 216 | 3300048916 | Ga0496113_0001283 | Ga0496113_0001283_1799_2926 | 375 |
| 217 | 3300005445 | Ga0070708_100001252 | Ga0070708_1000012529 | 376 |
| 218 | 3300005467 | Ga0070706_100004861 | Ga0070706_1000048617 | 376 |
| 219 | 3300005471 | Ga0070698_100003126 | Ga0070698_10000312611 | 376 |
| 220 | 3300005518 | Ga0070699_100001451 | Ga0070699_1000014519 | 376 |
| 221 | 3300005536 | Ga0070697_100000656 | Ga0070697_10000065614 | 376 |
| 222 | 3300024227 | Ga0228598_1007838 | Ga0228598_10078383 | 376 |
| 223 | 3300025910 | Ga0207684_10000677 | Ga0207684_1000067711 | 376 |
| 224 | 3300025922 | Ga0207646_10003352 | Ga0207646_1000335211 | 376 |
| 225 | 3300025939 | Ga0207665_10033968 | Ga0207665_100339682 | 376 |
| 226 | 3300031090 | Ga0265760_10006939 | Ga0265760_100069392 | 376 |
| 227 | 3300045976 | Ga0466967_0104922 | Ga0466967_0104922_951_2135 | 376 |
| 228 | 3300005436 | Ga0070713_100035038 | Ga0070713_1000350381 | 377 |
| 229 | 3300005445 | Ga0070708_100073284 | Ga0070708_1000732843 | 377 |
| 230 | 3300005467 | Ga0070706_100069388 | Ga0070706_1000693882 | 377 |
| 231 | 3300014969 | Ga0157376_10017166 | Ga0157376_100171663 | 377 |
| 232 | 3300025910 | Ga0207684_10049869 | Ga0207684_100498692 | 377 |
| 233 | 3300028800 | Ga0265338_10132316 | Ga0265338_101323162 | 377 |
| 234 | 3300035172 | Ga0373955_0022640 | Ga0373955_0022640_596_1777 | 377 |
| 235 | 3300048918 | Ga0496115_0133268 | Ga0496115_0133268_383_1558 | 377 |
| 236 | 3300005445 | Ga0070708_100006873 | Ga0070708_1000068733 | 378 |
| 237 | 3300006028 | Ga0070717_10073870 | Ga0070717_100738703 | 378 |
| 238 | 3300025939 | Ga0207665_10074587 | Ga0207665_100745872 | 378 |
| 239 | 3300031090 | Ga0265760_10008151 | Ga0265760_100081512 | 378 |
| 240 | 3300047319 | Ga0495674_0181799 | Ga0495674_0181799_390_1616 | 378 |
| 241 | 3300005468 | Ga0070707_100128253 | Ga0070707_1001282532 | 379 |
| 242 | 3300005536 | Ga0070697_100098435 | Ga0070697_1000984352 | 379 |
| 243 | 3300014968 | Ga0157379_10177935 | Ga0157379_101779352 | 379 |
| 244 | 3300031344 | Ga0265316_10011925 | Ga0265316_100119253 | 379 |
| 245 | 3300031711 | Ga0265314_10003195 | Ga0265314_100031955 | 379 |
| 246 | 3300046472 | Ga0495580_0001787 | Ga0495580_0001787_4056_5327 | 379 |
| 247 | 3300005445 | Ga0070708_100046927 | Ga0070708_1000469271 | 380 |
| 248 | 3300005468 | Ga0070707_100098145 | Ga0070707_1000981452 | 380 |
| 249 | 3300030760 | Ga0265762_1003043 | Ga0265762_10030432 | 380 |
| 250 | 3300031247 | Ga0265340_10012107 | Ga0265340_100121073 | 380 |
| 251 | 3300031249 | Ga0265339_10017547 | Ga0265339_100175476 | 380 |
| 252 | 3300031711 | Ga0265314_10008894 | Ga0265314_100088946 | 380 |
| 253 | 3300046472 | Ga0495580_0010787 | Ga0495580_0010787_3528_4727 | 380 |
| 254 | 3300005437 | Ga0070710_10001259 | Ga0070710_100012596 | 381 |
| 255 | 3300006163 | Ga0070715_10012674 | Ga0070715_100126742 | 381 |
| 256 | 3300025905 | Ga0207685_10007053 | Ga0207685_100070532 | 381 |
| 257 | 3300025929 | Ga0207664_10003445 | Ga0207664_100034453 | 381 |
| 258 | 3300031235 | Ga0265330_10011112 | Ga0265330_100111124 | 381 |
| 259 | 3300035111 | Ga0373923_0033244 | Ga0373923_0033244_585_1799 | 381 |
| 260 | 3300035113 | Ga0373936_0009819 | Ga0373936_0009819_1044_2258 | 381 |
| 261 | 3300035170 | Ga0373943_0024591 | Ga0373943_0024591_93_1307 | 381 |
| 262 | 3300035692 | Ga0373935_0048925 | Ga0373935_0048925_1282_2496 | 381 |
| 263 | 3300037068 | Ga0373925_0036420 | Ga0373925_0036420_1547_2761 | 381 |
| 264 | 3300046472 | Ga0495580_0000264 | Ga0495580_0000264_13705_14919 | 381 |
| 265 | 3300046473 | Ga0495582_0000791 | Ga0495582_0000791_7484_8698 | 381 |
| 266 | 3300046517 | Ga0495630_0101238 | Ga0495630_0101238_93_1307 | 381 |
| 267 | 3300046543 | Ga0495645_0194058 | Ga0495645_0194058_40_1254 | 381 |
| 268 | 3300046675 | Ga0495657_0113949 | Ga0495657_0113949_87_1289 | 381 |
| 269 | 3300047315 | Ga0495581_0047846 | Ga0495581_0047846_1186_2400 | 381 |
| 270 | 3300053077 | Ga0495601_0036654 | Ga0495601_0036654_1314_2528 | 381 |
| 271 | 3300005327 | Ga0070658_10110409 | Ga0070658_101104092 | 382 |
| 272 | 3300005329 | Ga0070683_100020788 | Ga0070683_1000207884 | 382 |
| 273 | 3300005344 | Ga0070661_100033903 | Ga0070661_1000339032 | 382 |
| 274 | 3300005437 | Ga0070710_10001002 | Ga0070710_100010023 | 382 |
| 275 | 3300005457 | Ga0070662_100021084 | Ga0070662_1000210842 | 382 |
| 276 | 3300005458 | Ga0070681_10045318 | Ga0070681_100453181 | 382 |
| 277 | 3300005535 | Ga0070684_100282970 | Ga0070684_1002829702 | 382 |
| 278 | 3300005563 | Ga0068855_100030202 | Ga0068855_1000302023 | 382 |
| 279 | 3300005578 | Ga0068854_100233269 | Ga0068854_1002332692 | 382 |
| 280 | 3300005841 | Ga0068863_100029017 | Ga0068863_1000290173 | 382 |
| 281 | 3300009174 | Ga0105241_10062049 | Ga0105241_100620492 | 382 |
| 282 | 3300009545 | Ga0105237_10045407 | Ga0105237_100454073 | 382 |
| 283 | 3300009551 | Ga0105238_10030986 | Ga0105238_100309862 | 382 |
| 284 | 3300010375 | Ga0105239_10040621 | Ga0105239_100406213 | 382 |
| 285 | 3300013296 | Ga0157374_10018087 | Ga0157374_100180874 | 382 |
| 286 | 3300013306 | Ga0163162_10391768 | Ga0163162_103917682 | 382 |
| 287 | 3300014325 | Ga0163163_10021772 | Ga0163163_100217723 | 382 |
| 288 | 3300014497 | Ga0182008_10004248 | Ga0182008_100042485 | 382 |
| 289 | 3300015262 | Ga0182007_10015020 | Ga0182007_100150203 | 382 |
| 290 | 3300015265 | Ga0182005_1009903 | Ga0182005_10099032 | 382 |
| 291 | 3300022730 | Ga0224570_100055 | Ga0224570_1000555 | 382 |
| 292 | 3300024227 | Ga0228598_1003045 | Ga0228598_10030451 | 382 |
| 293 | 3300025898 | Ga0207692_10000836 | Ga0207692_100008363 | 382 |
| 294 | 3300025919 | Ga0207657_10000845 | Ga0207657_1000084523 | 382 |
| 295 | 3300025932 | Ga0207690_10039972 | Ga0207690_100399722 | 382 |
| 296 | 3300025933 | Ga0207706_10005630 | Ga0207706_100056303 | 382 |
| 297 | 3300025945 | Ga0207679_10033592 | Ga0207679_100335922 | 382 |
| 298 | 3300026095 | Ga0207676_10118311 | Ga0207676_101183112 | 382 |
| 299 | 3300026142 | Ga0207698_10251432 | Ga0207698_102514322 | 382 |
| 300 | 3300028017 | Ga0265356_1000162 | Ga0265356_10001628 | 382 |
| 301 | 3300030760 | Ga0265762_1001269 | Ga0265762_10012693 | 382 |
| 302 | 3300031090 | Ga0265760_10004887 | Ga0265760_100048874 | 382 |
| 303 | 3300048903 | Ga0496100_0014249 | Ga0496100_0014249_1486_2634 | 382 |
| 304 | 3300048907 | Ga0496104_0010688 | Ga0496104_0010688_6892_8040 | 382 |
| 305 | 3300048911 | Ga0496108_0079740 | Ga0496108_0079740_1483_2631 | 382 |
| 306 | 3300048914 | Ga0496111_0003429 | Ga0496111_0003429_2756_3904 | 382 |
| 307 | 3300048916 | Ga0496113_0016185 | Ga0496113_0016185_1567_2715 | 382 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cpb-assembly1.cif.gz_B | 1,6-anhydro-n-actetylmuramic acid kinase (anmk) in complex with amppnp, and anhmurnac at 1.7 angstroms resolution. | 0.9306 | 1 | 382 |
| 8cp9-assembly1.cif.gz_A | 1,6-anhydro-n-actetylmuramic acid kinase (anmk)in complex with non-hydrolyzable amppnp. | 0.9239 | 1 | 382 |
| 3qbw-assembly1.cif.gz_A | crystal structure of pseudomonas aeruginosa 1,6-anhydro-n-actetylmuramic acid kinase (anmk) bound to adenosine diphosphate | 0.9239 | 1 | 379 |
| 3qbw-assembly1.cif.gz_B | crystal structure of pseudomonas aeruginosa 1,6-anhydro-n-actetylmuramic acid kinase (anmk) bound to adenosine diphosphate | 0.921 | 1 | 379 |
| 3qbx-assembly1.cif.gz_A | crystal structure of pseudomonas aeruginosa 1,6-anhydro-n-actetylmuramic acid kinase (anmk) bound to 1,6-anhydro-n-actetylmuramic acid | 0.9185 | 1 | 382 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3cqyB02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9482 | 150 | 341 | 3.30.420.40 |
| 3cqyB02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9382 | 150 | 341 | 3.30.420.40 |
| 4mo4C02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9255 | 150 | 341 | 3.30.420.40 |
| 4mo4C02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9155 | 150 | 341 | 3.30.420.40 |
| af_Q54NM2_164_389_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9108 | 150 | 341 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7ZHV3-F1-model_v4 | Anhydro-N-acetylmuramic acid kinase | 0.979 | 208 | 382 |
GO:0005524
GO:0006040 GO:0009254 GO:0016773 |
| AF-A0A2E1IBH3-F1-model_v4 | deleted | 0.9717 | 154 | 378 |
|
| AF-A0A1Q7ZHV3-F1-model_v4 | Anhydro-N-acetylmuramic acid kinase | 0.9681 | 208 | 382 |
GO:0005524
GO:0006040 GO:0009254 GO:0016773 |
| AF-A0A449A265-F1-model_v4 | Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.170) | 0.9669 | 186 | 382 |
GO:0005524
GO:0006040 GO:0009254 GO:0016301 GO:0016773 |
| AF-A0A2P5TI51-F1-model_v4 | Anhydro-N-acetylmuramic acid kinase | 0.9662 | 94 | 381 |
GO:0005524
GO:0006040 GO:0009254 GO:0016301 GO:0016773 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar