F399315

General Info

Members Datasets Scaffolds Average Seq Length
307 178 614 273

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0273943|Ga0466966_0273943_25_981
Length 318
Sequence VTTATPDRSTRPHRFEEASMQAANAASAASLGDPTTDPAAESDTDIRRLARRAKRRRTTWLWVARLGFAVFIIGGWQLATAQGWVDKFFFGQPTMIWRALVHLFTKGSEFGSVWSDIGVTLKEALYGFFLGTGAGVLMGLLLGQNRFLADVLSPYIKIVNAIPRIILGVIFVVAFGLGTFPKVLLAAVLVFFIVFFNAFQGVREVNPNLVANVKVLGASPVQVARHVTIPSALTWIIASLHTAFGFAIIGALVGEVLGSQRGMGLVIVQAQNRFDPNTVFAGMAIMAAITLAAEFLITLLEKRVLSWRPPSHSDAPGI

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
94 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
97 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
165 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
166 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
167 2643221647 Streptomyces sp. Root369 Isolate Unclassified
168 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
169 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
170 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
171 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
172 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
173 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
174 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
175 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
176 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
177 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
178 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.18
Metatranscriptomes 3.26
Isolates 4.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.93
Nodule 0
Rhizoplane 7.49
Rhizosphere 86.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0273943 3300044684 Bacteria 1015
2 JGI24740J21852_10004604 3300001979 Bacteria 5929
3 Ga0055542_1000019 3300003762 Bacteria 341174
4 Ga0055529_1000008 3300003763 Bacteria 394786
5 Ga0070658_10031400 3300005327 Bacteria 4265
6 Ga0070658_10118657 3300005327 Bacteria 2197
7 Ga0070683_100088790 3300005329 Bacteria 2901
8 Ga0070661_100007341 3300005344 Bacteria 7603
9 Ga0070675_100251136 3300005354 Bacteria 1548
10 Ga0070671_100017595 3300005355 Bacteria 5793
11 Ga0070674_100031953 3300005356 Bacteria 3493
12 Ga0070659_100045909 3300005366 Bacteria 3424
13 Ga0070714_100239419 3300005435 Bacteria 1674
14 Ga0070714_100366259 3300005435 Bacteria 1356
15 Ga0070713_100209125 3300005436 Bacteria 1765
16 Ga0070713_100476508 3300005436 Bacteria 1175
17 Ga0070708_100012359 3300005445 Bacteria 6965
18 Ga0070663_100054051 3300005455 Bacteria 2869
19 Ga0070662_100118669 3300005457 Bacteria 2025
20 Ga0070681_10271277 3300005458 Bacteria 1608
21 Ga0068867_100074664 3300005459 Bacteria 2542
22 Ga0070706_100136767 3300005467 Bacteria 2287
23 Ga0070707_100089988 3300005468 Bacteria 2970
24 Ga0070698_100005336 3300005471 Bacteria 14070
25 Ga0070698_100104115 3300005471 Bacteria 2808
26 Ga0070699_100009001 3300005518 Bacteria 8649
27 Ga0070679_100255052 3300005530 Bacteria 1709
28 Ga0070679_100334394 3300005530 Bacteria 1463
29 Ga0070684_100221009 3300005535 Bacteria 1728
30 Ga0068853_100012459 3300005539 Bacteria 6919
31 Ga0070672_100048819 3300005543 Bacteria 3290
32 Ga0070665_100062878 3300005548 Bacteria 3722
33 Ga0068855_100000449 3300005563 Bacteria 50848
34 Ga0068855_100022278 3300005563 Bacteria 7592
35 Ga0068855_100022424 3300005563 Bacteria 7569
36 Ga0068855_100098306 3300005563 Bacteria 3372
37 Ga0068855_100454906 3300005563 Bacteria 1396
38 Ga0068857_100181662 3300005577 Bacteria 1915
39 Ga0068856_100159299 3300005614 Bacteria 2267
40 Ga0068864_100008065 3300005618 Bacteria 8685
41 Ga0068864_100023370 3300005618 Bacteria 5190
42 Ga0068851_10000015 3300005834 Bacteria 145191
43 Ga0068863_100062187 3300005841 Bacteria 3531
44 Ga0070717_10038532 3300006028 Bacteria 3886
45 Ga0070712_100361895 3300006175 Bacteria 1190
46 Ga0105240_10003008 3300009093 Bacteria 26523
47 Ga0105245_10079853 3300009098 Bacteria 2988
48 Ga0105247_10013062 3300009101 Bacteria 4980
49 Ga0105241_10002848 3300009174 Bacteria 12912
50 Ga0105248_10001838 3300009177 Bacteria 23503
51 Ga0105248_10006016 3300009177 Bacteria 13316
52 Ga0105248_10033860 3300009177 Bacteria 5708
53 Ga0105237_10000308 3300009545 Bacteria 67971
54 Ga0105237_10015844 3300009545 Bacteria 7840
55 Ga0105238_10001673 3300009551 Bacteria 22275
56 Ga0105239_10074772 3300010375 Bacteria 3725
57 Ga0105239_10112444 3300010375 Bacteria 3019
58 Ga0105239_10167792 3300010375 Bacteria 2455
59 Ga0157371_10009750 3300013102 Bacteria 7535
60 Ga0157370_10008338 3300013104 Bacteria 11178
61 Ga0157370_10019715 3300013104 Bacteria 6753
62 Ga0157369_10257045 3300013105 Bacteria 1822
63 Ga0157369_10519048 3300013105 Bacteria 1232
64 Ga0157374_10062923 3300013296 Bacteria 3479
65 Ga0157374_10185286 3300013296 Bacteria 2035
66 Ga0157372_10145976 3300013307 Bacteria 2728
67 Ga0157372_10805386 3300013307 Bacteria 1091
68 Ga0157375_10167959 3300013308 Bacteria 2340
69 Ga0163163_10002913 3300014325 Bacteria 14479
70 Ga0163163_10005649 3300014325 Bacteria 10842
71 Ga0197907_10051520 3300020069 Bacteria 2511
72 Ga0206356_11571740 3300020070 Bacteria 1113
73 Ga0206354_10622000 3300020081 Bacteria 7569
74 Ga0206353_10501761 3300020082 Bacteria 5305
75 Ga0206353_10626207 3300020082 Bacteria 1437
76 Ga0206353_10891584 3300020082 Bacteria 3896
77 Ga0206353_10984424 3300020082 Bacteria 2748
78 Ga0206353_11047899 3300020082 Bacteria 1128
79 Ga0154015_1233883 3300020610 Bacteria 1539
80 Ga0209672_100011 3300025228 Bacteria 856297
81 Ga0209258_102301 3300025242 Bacteria 5084
82 Ga0209677_100909 3300025253 Bacteria 14474
83 Ga0209148_1000023 3300025254 Bacteria 680511
84 Ga0209233_1000309 3300025261 Bacteria 56841
85 Ga0209455_1000023 3300025272 Bacteria 680449
86 Ga0207656_10000001 3300025321 Bacteria 1323684
87 Ga0207710_10005179 3300025900 Bacteria 5637
88 Ga0207647_10055103 3300025904 Bacteria 2444
89 Ga0207647_10078641 3300025904 Bacteria 1981
90 Ga0207647_10174174 3300025904 Bacteria 1252
91 Ga0207705_10000001 3300025909 Bacteria 2061880
92 Ga0207705_10016139 3300025909 Bacteria 5360
93 Ga0207705_10022631 3300025909 Bacteria 4482
94 Ga0207705_10269884 3300025909 Bacteria 1301
95 Ga0207684_10017994 3300025910 Bacteria 6056
96 Ga0207654_10000001 3300025911 Bacteria 1816198
97 Ga0207695_10000921 3300025913 Bacteria 52654
98 Ga0207695_10009503 3300025913 Bacteria 12025
99 Ga0207671_10000001 3300025914 Bacteria 1318881
100 Ga0207671_10013211 3300025914 Bacteria 6588
101 Ga0207671_10031320 3300025914 Bacteria 3962
102 Ga0207671_10184558 3300025914 Bacteria 1624
103 Ga0207663_10272624 3300025916 Bacteria 1254
104 Ga0207657_10105182 3300025919 Bacteria 2337
105 Ga0207649_10004534 3300025920 Bacteria 7540
106 Ga0207652_10074497 3300025921 Bacteria 2956
107 Ga0207646_10123176 3300025922 Bacteria 2330
108 Ga0207646_10127070 3300025922 Bacteria 2293
109 Ga0207694_10000052 3300025924 Bacteria 157700
110 Ga0207694_10165129 3300025924 Bacteria 1790
111 Ga0207659_10174038 3300025926 Bacteria 1700
112 Ga0207687_10012284 3300025927 Bacteria 5600
113 Ga0207700_10277764 3300025928 Bacteria 1440
114 Ga0207664_10337696 3300025929 Bacteria 1332
115 Ga0207644_10075883 3300025931 Bacteria 2471
116 Ga0207706_10151279 3300025933 Bacteria 2041
117 Ga0207691_10040072 3300025940 Bacteria 4330
118 Ga0207711_10000299 3300025941 Bacteria 53150
119 Ga0207711_10004095 3300025941 Bacteria 12503
120 Ga0207661_10303847 3300025944 Bacteria 1431
121 Ga0207661_10580889 3300025944 Bacteria 1028
122 Ga0207667_10000895 3300025949 Bacteria 37988
123 Ga0207667_10043016 3300025949 Bacteria 4796
124 Ga0207667_10082329 3300025949 Bacteria 3334
125 Ga0207667_10088372 3300025949 Bacteria 3205
126 Ga0207667_10099894 3300025949 Bacteria 2994
127 Ga0207639_10008853 3300026041 Bacteria 6922
128 Ga0207639_10116340 3300026041 Bacteria 2189
129 Ga0207641_10400486 3300026088 Bacteria 1318
130 Ga0207676_10003681 3300026095 Bacteria 10837
131 Ga0207676_10037237 3300026095 Bacteria 3706
132 Ga0207674_10004473 3300026116 Bacteria 16806
133 Ga0207674_10010189 3300026116 Bacteria 10679
134 Ga0207674_10044205 3300026116 Bacteria 4588
135 Ga0207674_10082858 3300026116 Bacteria 3208
136 Ga0207698_10013145 3300026142 Bacteria 5450
137 Ga0207698_10222112 3300026142 Bacteria 1708
138 Ga0268266_10288493 3300028379 Bacteria 1528
139 Ga0265339_10024860 3300031249 Bacteria 3446
140 Ga0265313_10037962 3300031595 Bacteria 2403
141 Ga0316575_10062789 3300031665 Bacteria 1486
142 Ga0265342_10023593 3300031712 Bacteria 3892
143 Ga0307518_10051676 3300031838 Bacteria 2987
144 Ga0316583_10072650 3300032133 Bacteria 1203
145 Ga0373937_0160561 3300036401 Bacteria 2107
146 Ga0373925_0508353 3300037068 Bacteria 989
147 Ga0395899_0000203 3300037312 Bacteria 87248
148 Ga0395899_0001334 3300037312 Bacteria 21192
149 Ga0395899_0011817 3300037312 Bacteria 6684
150 Ga0395899_0046239 3300037312 Bacteria 3242
151 Ga0395899_0048169 3300037312 Bacteria 3172
152 Ga0395899_0093577 3300037312 Bacteria 2175
153 Ga0395899_0130439 3300037312 Bacteria 1795
154 Ga0395900_0000233 3300037418 Bacteria 87254
155 Ga0395900_0004859 3300037418 Bacteria 14159
156 Ga0395900_0005293 3300037418 Bacteria 13525
157 Ga0395900_0014444 3300037418 Bacteria 8060
158 Ga0395900_0065807 3300037418 Bacteria 3724
159 Ga0395900_0129275 3300037418 Bacteria 2589
160 Ga0395900_0165734 3300037418 Bacteria 2252
161 Ga0395900_0266519 3300037418 Bacteria 1709
162 Ga0395900_0272666 3300037418 Bacteria 1686
163 Ga0395900_0498000 3300037418 Bacteria 1169
164 Ga0395898_0001716 3300037466 Bacteria 29025
165 Ga0395898_0026321 3300037466 Bacteria 5855
166 Ga0395898_0047138 3300037466 Bacteria 4230
167 Ga0395898_0064146 3300037466 Bacteria 3563
168 Ga0395898_0107053 3300037466 Bacteria 2681
169 Ga0395898_0137129 3300037466 Bacteria 2343
170 Ga0395898_0177605 3300037466 Bacteria 2035
171 Ga0395898_0245981 3300037466 Bacteria 1706
172 Ga0395898_0398333 3300037466 Bacteria 1312
173 Ga0395901_0001071 3300038443 Bacteria 29319
174 Ga0395901_0024811 3300038443 Bacteria 6154
175 Ga0395901_0106328 3300038443 Bacteria 2945
176 Ga0395901_0357136 3300038443 Bacteria 1507
177 Ga0395901_0361725 3300038443 Bacteria 1496
178 Ga0395901_0542609 3300038443 Bacteria 1179
179 Ga0466969_0082945 3300044656 Bacteria 1527
180 Ga0466966_0000063 3300044684 Bacteria 74180
181 Ga0466966_0006933 3300044684 Bacteria 7503
182 Ga0466966_0046874 3300044684 Bacteria 2758
183 Ga0466966_0049977 3300044684 Bacteria 2661
184 Ga0466966_0073279 3300044684 Bacteria 2142
185 Ga0466961_0000088 3300044693 Bacteria 58528
186 Ga0466961_0010720 3300044693 Bacteria 5855
187 Ga0466961_0010947 3300044693 Bacteria 5795
188 Ga0466961_0017876 3300044693 Bacteria 4557
189 Ga0466961_0029106 3300044693 Bacteria 3551
190 Ga0466961_0033890 3300044693 Bacteria 3281
191 Ga0466961_0087276 3300044693 Bacteria 1971
192 Ga0466961_0089742 3300044693 Bacteria 1941
193 Ga0466961_0116088 3300044693 Bacteria 1682
194 Ga0466963_0003353 3300044694 Bacteria 9146
195 Ga0466963_0029873 3300044694 Bacteria 3512
196 Ga0466963_0302086 3300044694 Bacteria 1126
197 Ga0466964_0002766 3300044706 Bacteria 6298
198 Ga0466964_0005154 3300044706 Bacteria 4842
199 Ga0466971_0009573 3300044719 Bacteria 4229
200 Ga0466971_0013352 3300044719 Bacteria 3607
201 Ga0466971_0037135 3300044719 Bacteria 2184
202 Ga0466971_0083077 3300044719 Bacteria 1462
203 Ga0466970_0000103 3300044765 Bacteria 37060
204 Ga0466970_0022596 3300044765 Bacteria 3283
205 Ga0466970_0049733 3300044765 Bacteria 2235
206 Ga0466970_0050121 3300044765 Bacteria 2227
207 Ga0466970_0059938 3300044765 Bacteria 2038
208 Ga0466970_0244884 3300044765 Bacteria 1004
209 Ga0466957_0007153 3300044842 Bacteria 6310
210 Ga0466957_0027876 3300044842 Bacteria 3359
211 Ga0466957_0119443 3300044842 Bacteria 1679
212 Ga0466960_0031478 3300044901 Bacteria 2449
213 Ga0466959_0001958 3300045049 Bacteria 12977
214 Ga0466959_0009203 3300045049 Bacteria 7015
215 Ga0466959_0013284 3300045049 Bacteria 5964
216 Ga0466959_0027792 3300045049 Bacteria 4195
217 Ga0466959_0038956 3300045049 Bacteria 3512
218 Ga0466959_0075946 3300045049 Bacteria 2427
219 Ga0466958_0001882 3300045836 Bacteria 10252
220 Ga0466958_0004496 3300045836 Bacteria 7365
221 Ga0466958_0008192 3300045836 Bacteria 5788
222 Ga0466958_0021315 3300045836 Bacteria 3785
223 Ga0466958_0027119 3300045836 Bacteria 3390
224 Ga0466967_0007620 3300045976 Bacteria 7832
225 Ga0466967_0011952 3300045976 Bacteria 6614
226 Ga0466967_0012996 3300045976 Bacteria 6406
227 Ga0466967_0016167 3300045976 Bacteria 5875
228 Ga0466967_0056671 3300045976 Bacteria 3456
229 Ga0466967_0071678 3300045976 Bacteria 3103
230 Ga0466967_0075571 3300045976 Bacteria 3028
231 Ga0466967_0398649 3300045976 Bacteria 1338
232 Ga0495653_0009051 3300046463 Bacteria 8145
233 Ga0495580_0201787 3300046472 Bacteria 1370
234 Ga0495582_0180782 3300046473 Bacteria 1202
235 Ga0495662_0059287 3300046476 Bacteria 1848
236 Ga0495664_0003712 3300046477 Bacteria 8330
237 Ga0495607_0022071 3300046501 Bacteria 4002
238 Ga0495665_0000550 3300046531 Bacteria 19031
239 Ga0495586_0006305 3300046535 Bacteria 6336
240 Ga0495587_0005808 3300046536 Bacteria 8035
241 Ga0495645_0026814 3300046543 Bacteria 4184
242 Ga0495667_0005505 3300046559 Bacteria 8556
243 Ga0495635_0373325 3300046663 Bacteria 950
244 Ga0495588_0005231 3300046674 Bacteria 5767
245 Ga0495658_0131268 3300046683 Bacteria 1525
246 Ga0495581_0004038 3300047315 Bacteria 8449
247 Ga0495680_0080276 3300047322 Bacteria 2465
248 Ga0495683_0000166 3300047323 Bacteria 64470
249 Ga0495684_0151438 3300047471 Bacteria 1734
250 Ga0495593_0051986 3300047673 Bacteria 2167
251 Ga0496100_0236893 3300048903 Bacteria 1345
252 Ga0496101_0021455 3300048904 Bacteria 4438
253 Ga0496102_0000638 3300048905 Bacteria 35704
254 Ga0496102_0036220 3300048905 Bacteria 4445
255 Ga0496102_0693052 3300048905 Bacteria 942
256 Ga0496103_0012890 3300048906 Bacteria 4958
257 Ga0496103_0092894 3300048906 Bacteria 1905
258 Ga0496104_0004751 3300048907 Bacteria 11828
259 Ga0496104_0034760 3300048907 Bacteria 4701
260 Ga0496105_0017076 3300048908 Bacteria 5810
261 Ga0496105_0113036 3300048908 Bacteria 2241
262 Ga0496107_0276988 3300048910 Bacteria 1249
263 Ga0496108_0011399 3300048911 Bacteria 7225
264 Ga0496109_0075979 3300048912 Bacteria 3089
265 Ga0496110_0050860 3300048913 Bacteria 3640
266 Ga0496110_0120066 3300048913 Bacteria 2368
267 Ga0496111_0130557 3300048914 Bacteria 1859
268 Ga0496112_0004443 3300048915 Bacteria 11883
269 Ga0496113_0000330 3300048916 Bacteria 22492
270 Ga0496113_0019981 3300048916 Bacteria 4699
271 Ga0496114_0023330 3300048917 Bacteria 5048
272 Ga0496115_0035172 3300048918 Bacteria 3962
273 Ga0496115_0119535 3300048918 Bacteria 2167
274 Ga0496120_0083366 3300048923 Bacteria 1726
275 Ga0496121_0100328 3300048924 Bacteria 2235
276 Ga0496126_0118579 3300048929 Bacteria 2297
277 Ga0501031_0027169 3300049568 Bacteria 3731
278 Ga0501033_0111240 3300049570 Bacteria 1993
279 Ga0501034_0039483 3300049571 Bacteria 4781
280 Ga0501034_0459006 3300049571 Bacteria 1191
281 Ga0501036_0081783 3300049572 Bacteria 2730
282 Ga0501038_0006877 3300049574 Bacteria 10505
283 Ga0501043_0013953 3300049579 Bacteria 6287
284 Ga0501047_0075715 3300049581 Bacteria 3238
285 Ga0501035_0012521 3300049822 Bacteria 7835
286 Ga0501035_0033437 3300049822 Bacteria 4677
287 Ga0501035_0048897 3300049822 Bacteria 3791
288 Ga0501044_0043921 3300049823 Bacteria 4641
289 Ga0501044_0107395 3300049823 Bacteria 2802
290 Ga0500635_0003362 3300053080 Bacteria 4017
291 Ga0495619_0326614 3300053085 Bacteria 1062
292 Ga0587107_003496 3300059652 Bacteria 1528
293 Ga0466962_0004001 3300061719 Bacteria 7056
294 2585313136 2582581314 Bacteria 11452267
295 2616693362 2616644814 Bacteria 11555299
296 2644269853 2643221647 Bacteria 10741251
297 2723878193 2721755763 Bacteria 4464185
298 2862181958 2862178590 Bacteria 8583590
299 2877682139 2877676314 Bacteria 9512378
300 2891674512 2891670763 Bacteria 4967099
301 2946061716 2946059875 Bacteria 4386623
302 2954693122 2954691527 Bacteria 10720516
303 2954708221 2954701450 Bacteria 10834262
304 2995466203 2995463766 Bacteria 8577691
305 8004022653 8004021418 Bacteria 4313954
306 8055433212 8055431914 Bacteria 4551896
307 8056836162 8056829672 Bacteria 9045328
308 Ga0466966_0273943
309 JGI24740J21852_10004604
310 Ga0055542_1000019
311 Ga0055529_1000008
312 Ga0070658_10031400
313 Ga0070658_10118657
314 Ga0070683_100088790
315 Ga0070661_100007341
316 Ga0070675_100251136
317 Ga0070671_100017595
318 Ga0070674_100031953
319 Ga0070659_100045909
320 Ga0070714_100239419
321 Ga0070714_100366259
322 Ga0070713_100209125
323 Ga0070713_100476508
324 Ga0070708_100012359
325 Ga0070663_100054051
326 Ga0070662_100118669
327 Ga0070681_10271277
328 Ga0068867_100074664
329 Ga0070706_100136767
330 Ga0070707_100089988
331 Ga0070698_100005336
332 Ga0070698_100104115
333 Ga0070699_100009001
334 Ga0070679_100255052
335 Ga0070679_100334394
336 Ga0070684_100221009
337 Ga0068853_100012459
338 Ga0070672_100048819
339 Ga0070665_100062878
340 Ga0068855_100000449
341 Ga0068855_100022278
342 Ga0068855_100022424
343 Ga0068855_100098306
344 Ga0068855_100454906
345 Ga0068857_100181662
346 Ga0068856_100159299
347 Ga0068864_100008065
348 Ga0068864_100023370
349 Ga0068851_10000015
350 Ga0068863_100062187
351 Ga0070717_10038532
352 Ga0070712_100361895
353 Ga0105240_10003008
354 Ga0105245_10079853
355 Ga0105247_10013062
356 Ga0105241_10002848
357 Ga0105248_10001838
358 Ga0105248_10006016
359 Ga0105248_10033860
360 Ga0105237_10000308
361 Ga0105237_10015844
362 Ga0105238_10001673
363 Ga0105239_10074772
364 Ga0105239_10112444
365 Ga0105239_10167792
366 Ga0157371_10009750
367 Ga0157370_10008338
368 Ga0157370_10019715
369 Ga0157369_10257045
370 Ga0157369_10519048
371 Ga0157374_10062923
372 Ga0157374_10185286
373 Ga0157372_10145976
374 Ga0157372_10805386
375 Ga0157375_10167959
376 Ga0163163_10002913
377 Ga0163163_10005649
378 Ga0197907_10051520
379 Ga0206356_11571740
380 Ga0206354_10622000
381 Ga0206353_10501761
382 Ga0206353_10626207
383 Ga0206353_10891584
384 Ga0206353_10984424
385 Ga0206353_11047899
386 Ga0154015_1233883
387 Ga0209672_100011
388 Ga0209258_102301
389 Ga0209677_100909
390 Ga0209148_1000023
391 Ga0209233_1000309
392 Ga0209455_1000023
393 Ga0207656_10000001
394 Ga0207710_10005179
395 Ga0207647_10055103
396 Ga0207647_10078641
397 Ga0207647_10174174
398 Ga0207705_10000001
399 Ga0207705_10016139
400 Ga0207705_10022631
401 Ga0207705_10269884
402 Ga0207684_10017994
403 Ga0207654_10000001
404 Ga0207695_10000921
405 Ga0207695_10009503
406 Ga0207671_10000001
407 Ga0207671_10013211
408 Ga0207671_10031320
409 Ga0207671_10184558
410 Ga0207663_10272624
411 Ga0207657_10105182
412 Ga0207649_10004534
413 Ga0207652_10074497
414 Ga0207646_10123176
415 Ga0207646_10127070
416 Ga0207694_10000052
417 Ga0207694_10165129
418 Ga0207659_10174038
419 Ga0207687_10012284
420 Ga0207700_10277764
421 Ga0207664_10337696
422 Ga0207644_10075883
423 Ga0207706_10151279
424 Ga0207691_10040072
425 Ga0207711_10000299
426 Ga0207711_10004095
427 Ga0207661_10303847
428 Ga0207661_10580889
429 Ga0207667_10000895
430 Ga0207667_10043016
431 Ga0207667_10082329
432 Ga0207667_10088372
433 Ga0207667_10099894
434 Ga0207639_10008853
435 Ga0207639_10116340
436 Ga0207641_10400486
437 Ga0207676_10003681
438 Ga0207676_10037237
439 Ga0207674_10004473
440 Ga0207674_10010189
441 Ga0207674_10044205
442 Ga0207674_10082858
443 Ga0207698_10013145
444 Ga0207698_10222112
445 Ga0268266_10288493
446 Ga0265339_10024860
447 Ga0265313_10037962
448 Ga0316575_10062789
449 Ga0265342_10023593
450 Ga0307518_10051676
451 Ga0316583_10072650
452 Ga0373937_0160561
453 Ga0373925_0508353
454 Ga0395899_0000203
455 Ga0395899_0001334
456 Ga0395899_0011817
457 Ga0395899_0046239
458 Ga0395899_0048169
459 Ga0395899_0093577
460 Ga0395899_0130439
461 Ga0395900_0000233
462 Ga0395900_0004859
463 Ga0395900_0005293
464 Ga0395900_0014444
465 Ga0395900_0065807
466 Ga0395900_0129275
467 Ga0395900_0165734
468 Ga0395900_0266519
469 Ga0395900_0272666
470 Ga0395900_0498000
471 Ga0395898_0001716
472 Ga0395898_0026321
473 Ga0395898_0047138
474 Ga0395898_0064146
475 Ga0395898_0107053
476 Ga0395898_0137129
477 Ga0395898_0177605
478 Ga0395898_0245981
479 Ga0395898_0398333
480 Ga0395901_0001071
481 Ga0395901_0024811
482 Ga0395901_0106328
483 Ga0395901_0357136
484 Ga0395901_0361725
485 Ga0395901_0542609
486 Ga0466969_0082945
487 Ga0466966_0000063
488 Ga0466966_0006933
489 Ga0466966_0046874
490 Ga0466966_0049977
491 Ga0466966_0073279
492 Ga0466961_0000088
493 Ga0466961_0010720
494 Ga0466961_0010947
495 Ga0466961_0017876
496 Ga0466961_0029106
497 Ga0466961_0033890
498 Ga0466961_0087276
499 Ga0466961_0089742
500 Ga0466961_0116088
501 Ga0466963_0003353
502 Ga0466963_0029873
503 Ga0466963_0302086
504 Ga0466964_0002766
505 Ga0466964_0005154
506 Ga0466971_0009573
507 Ga0466971_0013352
508 Ga0466971_0037135
509 Ga0466971_0083077
510 Ga0466970_0000103
511 Ga0466970_0022596
512 Ga0466970_0049733
513 Ga0466970_0050121
514 Ga0466970_0059938
515 Ga0466970_0244884
516 Ga0466957_0007153
517 Ga0466957_0027876
518 Ga0466957_0119443
519 Ga0466960_0031478
520 Ga0466959_0001958
521 Ga0466959_0009203
522 Ga0466959_0013284
523 Ga0466959_0027792
524 Ga0466959_0038956
525 Ga0466959_0075946
526 Ga0466958_0001882
527 Ga0466958_0004496
528 Ga0466958_0008192
529 Ga0466958_0021315
530 Ga0466958_0027119
531 Ga0466967_0007620
532 Ga0466967_0011952
533 Ga0466967_0012996
534 Ga0466967_0016167
535 Ga0466967_0056671
536 Ga0466967_0071678
537 Ga0466967_0075571
538 Ga0466967_0398649
539 Ga0495653_0009051
540 Ga0495580_0201787
541 Ga0495582_0180782
542 Ga0495662_0059287
543 Ga0495664_0003712
544 Ga0495607_0022071
545 Ga0495665_0000550
546 Ga0495586_0006305
547 Ga0495587_0005808
548 Ga0495645_0026814
549 Ga0495667_0005505
550 Ga0495635_0373325
551 Ga0495588_0005231
552 Ga0495658_0131268
553 Ga0495581_0004038
554 Ga0495680_0080276
555 Ga0495683_0000166
556 Ga0495684_0151438
557 Ga0495593_0051986
558 Ga0496100_0236893
559 Ga0496101_0021455
560 Ga0496102_0000638
561 Ga0496102_0036220
562 Ga0496102_0693052
563 Ga0496103_0012890
564 Ga0496103_0092894
565 Ga0496104_0004751
566 Ga0496104_0034760
567 Ga0496105_0017076
568 Ga0496105_0113036
569 Ga0496107_0276988
570 Ga0496108_0011399
571 Ga0496109_0075979
572 Ga0496110_0050860
573 Ga0496110_0120066
574 Ga0496111_0130557
575 Ga0496112_0004443
576 Ga0496113_0000330
577 Ga0496113_0019981
578 Ga0496114_0023330
579 Ga0496115_0035172
580 Ga0496115_0119535
581 Ga0496120_0083366
582 Ga0496121_0100328
583 Ga0496126_0118579
584 Ga0501031_0027169
585 Ga0501033_0111240
586 Ga0501034_0039483
587 Ga0501034_0459006
588 Ga0501036_0081783
589 Ga0501038_0006877
590 Ga0501043_0013953
591 Ga0501047_0075715
592 Ga0501035_0012521
593 Ga0501035_0033437
594 Ga0501035_0048897
595 Ga0501044_0043921
596 Ga0501044_0107395
597 Ga0500635_0003362
598 Ga0495619_0326614
599 Ga0587107_003496
600 Ga0466962_0004001
601 2585313136
602 2616693362
603 2644269853
604 2723878193
605 2862181958
606 2877682139
607 2891674512
608 2946061716
609 2954693122
610 2954708221
611 2995466203
612 8004022653
613 8055433212
614 8056836162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

131

306

0.96

Map