F399090

General Info

Members Datasets Scaffolds Average Seq Length
307 196 614 221

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100660853|Ga0068855_1006608532
Length 256
Sequence MTDVSACAAGPRRDAANATTAGAPGLRRLGPSLTMSTGYSAAVPDDTALIDLLGALAYGELTAFDRLADDARMAPTLSGRAALCEMAAVEIGHYRLLANRIIDLGAIPEEAMAPFVPALDGFHEMTSPSTWLEGLVKAYVGDGLAADFYREIAEFVDPSTRELILEVLADSGSSAFAVREVRAAIASEPALADRLSLWGRRLVGEAISQTQHVLAERDALTELLVAGTGDLLGVAALISRITDRHADRMRQLGLSG

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
137 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 9.45
Rhizosphere 86.97
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100660853 3300005563 Bacteria 1122
2 Ga0070683_100391962 3300005329 Bacteria 1324
3 Ga0070690_100378103 3300005330 Bacteria 1035
4 Ga0068869_100022830 3300005334 Bacteria 4315
5 Ga0070666_10013561 3300005335 Bacteria 5174
6 Ga0070682_100002942 3300005337 Bacteria 9450
7 Ga0068868_100007377 3300005338 Bacteria 7833
8 Ga0070692_10004804 3300005345 Bacteria 5681
9 Ga0070668_100003259 3300005347 Bacteria 11970
10 Ga0070668_100007011 3300005347 Bacteria 8349
11 Ga0070668_100852262 3300005347 Bacteria 812
12 Ga0070669_100015202 3300005353 Bacteria 5481
13 Ga0070675_100396684 3300005354 Bacteria 1230
14 Ga0070671_100342054 3300005355 Unclassified 1276
15 Ga0070673_100043850 3300005364 Bacteria 3460
16 Ga0070688_100020303 3300005365 Bacteria 3861
17 Ga0070659_100031120 3300005366 Bacteria 4132
18 Ga0070667_100001130 3300005367 Bacteria 24307
19 Ga0070667_100005251 3300005367 Bacteria 10829
20 Ga0070667_100041134 3300005367 Bacteria 3878
21 Ga0070667_100186195 3300005367 Bacteria 1837
22 Ga0070703_10006024 3300005406 Bacteria 3394
23 Ga0070714_100000008 3300005435 Bacteria 278734
24 Ga0070714_100015986 3300005435 Bacteria 6050
25 Ga0070714_100882389 3300005435 Bacteria 868
26 Ga0070713_100068361 3300005436 Bacteria 2993
27 Ga0070713_100264859 3300005436 Bacteria 1572
28 Ga0070710_10008109 3300005437 Bacteria 5106
29 Ga0070701_10005885 3300005438 Bacteria 5114
30 Ga0070711_100003494 3300005439 Bacteria 9164
31 Ga0070705_100052310 3300005440 Bacteria 2385
32 Ga0070700_100013252 3300005441 Bacteria 4629
33 Ga0070694_100014759 3300005444 Bacteria 4895
34 Ga0070663_100013148 3300005455 Bacteria 5263
35 Ga0070663_100245314 3300005455 Bacteria 1416
36 Ga0070678_100253177 3300005456 Bacteria 1477
37 Ga0070662_100032054 3300005457 Bacteria 3692
38 Ga0070698_100955741 3300005471 Bacteria 803
39 Ga0070697_100168413 3300005536 Bacteria 1853
40 Ga0068853_100015003 3300005539 Bacteria 6364
41 Ga0070672_100065481 3300005543 Bacteria 2875
42 Ga0070686_100057402 3300005544 Bacteria 2500
43 Ga0070695_100004890 3300005545 Bacteria 7894
44 Ga0070693_100021581 3300005547 Bacteria 3412
45 Ga0070665_100008679 3300005548 Bacteria 10288
46 Ga0070665_100026310 3300005548 Bacteria 5859
47 Ga0070665_100337366 3300005548 Bacteria 1512
48 Ga0070704_100004681 3300005549 Bacteria 7915
49 Ga0068855_100254111 3300005563 Bacteria 1960
50 Ga0070664_100506767 3300005564 Bacteria 1113
51 Ga0068857_100447136 3300005577 Bacteria 1208
52 Ga0068854_100055765 3300005578 Bacteria 2846
53 Ga0068854_100135270 3300005578 Bacteria 1886
54 Ga0068856_100024024 3300005614 Bacteria 5930
55 Ga0068856_100106284 3300005614 Bacteria 2801
56 Ga0068856_100156605 3300005614 Bacteria 2288
57 Ga0068856_100248501 3300005614 Bacteria 1794
58 Ga0070702_100001515 3300005615 Bacteria 9545
59 Ga0068852_100018474 3300005616 Bacteria 5494
60 Ga0068852_100060654 3300005616 Bacteria 3284
61 Ga0068859_100007784 3300005617 Bacteria 10878
62 Ga0068859_100061738 3300005617 Bacteria 3776
63 Ga0068866_10005463 3300005718 Bacteria 5246
64 Ga0068861_100048631 3300005719 Bacteria 3207
65 Ga0068863_100012582 3300005841 Bacteria 8165
66 Ga0068858_100010610 3300005842 Bacteria 8719
67 Ga0068858_100063600 3300005842 Bacteria 3414
68 Ga0068860_100000067 3300005843 Bacteria 180176
69 Ga0068860_100051304 3300005843 Bacteria 3925
70 Ga0081455_10004407 3300005937 Bacteria 15817
71 Ga0081540_1034333 3300005983 Bacteria 2738
72 Ga0070717_10006515 3300006028 Bacteria 8590
73 Ga0075432_10016554 3300006058 Bacteria 2516
74 Ga0070715_10007796 3300006163 Bacteria 3701
75 Ga0070716_100009714 3300006173 Bacteria 4802
76 Ga0070712_100017323 3300006175 Bacteria 4663
77 Ga0068871_100022111 3300006358 Bacteria 4900
78 Ga0075433_10050461 3300006852 Bacteria 3622
79 Ga0068865_100081103 3300006881 Bacteria 2329
80 Ga0075436_100007869 3300006914 Bacteria 7293
81 Ga0097620_100007784 3300006931 Bacteria 10878
82 Ga0097620_100061740 3300006931 Bacteria 3776
83 Ga0075435_100004445 3300007076 Bacteria 9634
84 Ga0105251_10234381 3300009011 Bacteria 827
85 Ga0105240_10059242 3300009093 Bacteria 4780
86 Ga0105240_10064060 3300009093 Bacteria 4569
87 Ga0105245_10007549 3300009098 Bacteria 9527
88 Ga0105245_10017737 3300009098 Bacteria 6213
89 Ga0105247_10001103 3300009101 Bacteria 20106
90 Ga0105247_10050253 3300009101 Bacteria 2565
91 Ga0105243_10003216 3300009148 Bacteria 13353
92 Ga0105241_10010681 3300009174 Bacteria 6736
93 Ga0105241_10119354 3300009174 Bacteria 2121
94 Ga0105242_10018199 3300009176 Bacteria 5490
95 Ga0105248_10097219 3300009177 Bacteria 3318
96 Ga0105237_10015529 3300009545 Bacteria 7922
97 Ga0105237_10020954 3300009545 Bacteria 6729
98 Ga0105238_10039143 3300009551 Bacteria 4809
99 Ga0105238_10383885 3300009551 Bacteria 1396
100 Ga0105249_10021697 3300009553 Bacteria 5749
101 Ga0105239_10037047 3300010375 Bacteria 5350
102 Ga0105239_10308788 3300010375 Bacteria 1782
103 Ga0105246_10009226 3300011119 Bacteria 6075
104 Ga0157371_10014368 3300013102 Bacteria 5978
105 Ga0157370_10014450 3300013104 Bacteria 8070
106 Ga0157370_10101510 3300013104 Bacteria 2695
107 Ga0157374_10027562 3300013296 Bacteria 5128
108 Ga0157374_10565585 3300013296 Bacteria 1145
109 Ga0157378_10020569 3300013297 Bacteria 5803
110 Ga0163162_10007059 3300013306 Bacteria 10891
111 Ga0163163_10055525 3300014325 Bacteria 3915
112 Ga0163163_10289683 3300014325 Bacteria 1689
113 Ga0163163_10391560 3300014325 Bacteria 1448
114 Ga0157380_10227687 3300014326 Bacteria 1672
115 Ga0157379_10004147 3300014968 Bacteria 12370
116 Ga0157379_10024019 3300014968 Bacteria 5410
117 Ga0157376_10025492 3300014969 Bacteria 4658
118 Ga0163161_10022933 3300017792 Bacteria 4398
119 Ga0206353_11093092 3300020082 Archaea 746
120 Ga0207653_10009644 3300025885 Bacteria 3009
121 Ga0207692_10022651 3300025898 Bacteria 2894
122 Ga0207710_10023706 3300025900 Bacteria 2638
123 Ga0207710_10052723 3300025900 Bacteria 1829
124 Ga0207688_10004534 3300025901 Bacteria 7564
125 Ga0207680_10001372 3300025903 Bacteria 11532
126 Ga0207680_10116932 3300025903 Bacteria 1738
127 Ga0207647_10154306 3300025904 Bacteria 1341
128 Ga0207699_10079457 3300025906 Bacteria 2029
129 Ga0207654_10037653 3300025911 Bacteria 2709
130 Ga0207654_10251548 3300025911 Bacteria 1185
131 Ga0207695_10102349 3300025913 Bacteria 2857
132 Ga0207695_10229509 3300025913 Bacteria 1761
133 Ga0207671_10042003 3300025914 Bacteria 3385
134 Ga0207693_10001430 3300025915 Bacteria 21147
135 Ga0207663_10220620 3300025916 Bacteria 1379
136 Ga0207662_10019494 3300025918 Bacteria 3862
137 Ga0207657_10024498 3300025919 Bacteria 5584
138 Ga0207681_10046501 3300025923 Bacteria 2919
139 Ga0207694_10016640 3300025924 Bacteria 5556
140 Ga0207694_10814395 3300025924 Bacteria 789
141 Ga0207659_10325752 3300025926 Bacteria 1269
142 Ga0207687_10036214 3300025927 Bacteria 3361
143 Ga0207687_10061465 3300025927 Bacteria 2653
144 Ga0207700_10814127 3300025928 Bacteria 835
145 Ga0207664_10000002 3300025929 Bacteria 657053
146 Ga0207664_10066567 3300025929 Bacteria 2888
147 Ga0207664_10612561 3300025929 Bacteria 978
148 Ga0207644_10146521 3300025931 Bacteria 1823
149 Ga0207644_10269030 3300025931 Bacteria 1365
150 Ga0207690_10287977 3300025932 Bacteria 1281
151 Ga0207706_10002272 3300025933 Bacteria 18763
152 Ga0207686_10234749 3300025934 Bacteria 1332
153 Ga0207709_10123095 3300025935 Bacteria 1755
154 Ga0207665_10003150 3300025939 Bacteria 11054
155 Ga0207711_10109846 3300025941 Bacteria 2451
156 Ga0207689_10010568 3300025942 Bacteria 7948
157 Ga0207667_10175600 3300025949 Bacteria 2201
158 Ga0207667_10409860 3300025949 Bacteria 1380
159 Ga0207651_10012221 3300025960 Bacteria 4848
160 Ga0207712_10177537 3300025961 Bacteria 1670
161 Ga0207668_10015509 3300025972 Bacteria 4736
162 Ga0207668_10015530 3300025972 Bacteria 4733
163 Ga0207658_10002185 3300025986 Bacteria 14538
164 Ga0207658_10034657 3300025986 Bacteria 3609
165 Ga0207658_10090722 3300025986 Bacteria 2369
166 Ga0207658_10156820 3300025986 Bacteria 1861
167 Ga0207677_10014314 3300026023 Bacteria 4629
168 Ga0207703_10165645 3300026035 Bacteria 1939
169 Ga0207639_10037267 3300026041 Bacteria 3611
170 Ga0207678_10002975 3300026067 Bacteria 15334
171 Ga0207678_10123360 3300026067 Bacteria 2211
172 Ga0207708_10008207 3300026075 Bacteria 7735
173 Ga0207702_10082771 3300026078 Bacteria 2791
174 Ga0207702_10153562 3300026078 Bacteria 2096
175 Ga0207702_10298367 3300026078 Bacteria 1529
176 Ga0207641_10002225 3300026088 Bacteria 18198
177 Ga0207641_10310415 3300026088 Bacteria 1492
178 Ga0207676_10081291 3300026095 Bacteria 2632
179 Ga0207674_10181286 3300026116 Bacteria 2057
180 Ga0207674_10210880 3300026116 Bacteria 1891
181 Ga0207675_100040426 3300026118 Bacteria 4355
182 Ga0207683_10001774 3300026121 Bacteria 19108
183 Ga0207698_10043477 3300026142 Bacteria 3366
184 Ga0207428_10182683 3300027907 Bacteria 1584
185 Ga0268266_10009773 3300028379 Bacteria 8438
186 Ga0268266_10079692 3300028379 Bacteria 2852
187 Ga0268266_10344241 3300028379 Bacteria 1400
188 Ga0268264_10000114 3300028381 Bacteria 203211
189 Ga0265327_10000019 3300031251 Bacteria 427653
190 Ga0265327_10001706 3300031251 Bacteria 26244
191 Ga0265327_10013514 3300031251 Bacteria 5418
192 Ga0373938_0001862 3300034957 Bacteria 3371
193 Ga0373940_0001722 3300035088 Bacteria 4055
194 Ga0373960_0003159 3300035121 Bacteria 3724
195 Ga0373942_0008474 3300035207 Bacteria 2398
196 Ga0373961_0010944 3300035241 Bacteria 2244
197 Ga0373962_0004719 3300035242 Bacteria 3288
198 Ga0373931_0021163 3300035691 Bacteria 3261
199 Ga0436365_0500566 3300039437 Bacteria 1751
200 Ga0466969_0092778 3300044656 Bacteria 1429
201 Ga0466972_0010324 3300044658 Bacteria 4689
202 Ga0466972_0040332 3300044658 Bacteria 2275
203 Ga0466965_0006299 3300044683 Bacteria 5375
204 Ga0466966_0008062 3300044684 Bacteria 6981
205 Ga0466966_0068910 3300044684 Bacteria 2220
206 Ga0466966_0086185 3300044684 Bacteria 1952
207 Ga0466966_0325821 3300044684 Bacteria 923
208 Ga0466961_0008497 3300044693 Bacteria 6540
209 Ga0466961_0022791 3300044693 Bacteria 4028
210 Ga0466961_0043726 3300044693 Bacteria 2868
211 Ga0466961_0081882 3300044693 Bacteria 2042
212 Ga0466961_0098219 3300044693 Bacteria 1846
213 Ga0466963_0003549 3300044694 Bacteria 8955
214 Ga0466963_0006384 3300044694 Bacteria 6973
215 Ga0466963_0077442 3300044694 Bacteria 2247
216 Ga0466963_0112809 3300044694 Bacteria 1867
217 Ga0466963_0289432 3300044694 Bacteria 1151
218 Ga0466963_0305372 3300044694 Bacteria 1119
219 Ga0466964_0000839 3300044706 Bacteria 10080
220 Ga0466971_0013194 3300044719 Bacteria 3626
221 Ga0466971_0019140 3300044719 Bacteria 3039
222 Ga0466971_0144470 3300044719 Bacteria 1109
223 Ga0466970_0008472 3300044765 Bacteria 5177
224 Ga0466970_0106936 3300044765 Bacteria 1526
225 Ga0466970_0240458 3300044765 Bacteria 1013
226 Ga0466957_0005526 3300044842 Bacteria 7100
227 Ga0466957_0172658 3300044842 Bacteria 1409
228 Ga0466960_0010098 3300044901 Bacteria 3913
229 Ga0466960_0046474 3300044901 Bacteria 2079
230 Ga0466960_0075615 3300044901 Bacteria 1685
231 Ga0466960_0160902 3300044901 Bacteria 1205
232 Ga0466959_0030134 3300045049 Bacteria 4018
233 Ga0466959_0049164 3300045049 Bacteria 3098
234 Ga0466959_0122854 3300045049 Bacteria 1844
235 Ga0466959_0249700 3300045049 Bacteria 1224
236 Ga0466959_0419256 3300045049 Bacteria 909
237 Ga0466958_0004679 3300045836 Bacteria 7262
238 Ga0466958_0147162 3300045836 Bacteria 1485
239 Ga0466958_0170327 3300045836 Bacteria 1378
240 Ga0466967_0010512 3300045976 Bacteria 6949
241 Ga0466967_0013845 3300045976 Bacteria 6254
242 Ga0466967_0048772 3300045976 Bacteria 3700
243 Ga0466967_0052196 3300045976 Bacteria 3588
244 Ga0466967_0188505 3300045976 Bacteria 1948
245 Ga0466967_0326927 3300045976 Bacteria 1480
246 Ga0466967_0347725 3300045976 Bacteria 1435
247 Ga0466967_0361923 3300045976 Bacteria 1406
248 Ga0496100_0013933 3300048903 Bacteria 4654
249 Ga0496101_0035293 3300048904 Bacteria 3536
250 Ga0496101_0041700 3300048904 Bacteria 3274
251 Ga0496102_0000059 3300048905 Bacteria 168633
252 Ga0496102_0125965 3300048905 Bacteria 2394
253 Ga0496102_0354846 3300048905 Bacteria 1380
254 Ga0496103_0000063 3300048906 Bacteria 128503
255 Ga0496103_0256460 3300048906 Bacteria 1125
256 Ga0496104_0092086 3300048907 Bacteria 2898
257 Ga0496104_0191435 3300048907 Bacteria 1957
258 Ga0496104_0589230 3300048907 Bacteria 1022
259 Ga0496106_0013002 3300048909 Bacteria 6140
260 Ga0496106_0834480 3300048909 Bacteria 730
261 Ga0496107_0010765 3300048910 Bacteria 6360
262 Ga0496108_0041275 3300048911 Bacteria 3851
263 Ga0496108_0052391 3300048911 Bacteria 3419
264 Ga0496109_0008722 3300048912 Bacteria 8634
265 Ga0496109_0046178 3300048912 Bacteria 3955
266 Ga0496110_0021784 3300048913 Bacteria 5432
267 Ga0496110_0085066 3300048913 Bacteria 2823
268 Ga0496111_0033014 3300048914 Bacteria 3691
269 Ga0496111_0189152 3300048914 Bacteria 1530
270 Ga0496112_0220574 3300048915 Bacteria 1852
271 Ga0496113_0016850 3300048916 Bacteria 5057
272 Ga0496113_0024274 3300048916 Bacteria 4306
273 Ga0496114_0113039 3300048917 Bacteria 2328
274 Ga0496114_0165086 3300048917 Bacteria 1927
275 Ga0496115_0049551 3300048918 Bacteria 3363
276 Ga0496115_0060307 3300048918 Bacteria 3056
277 Ga0496117_0080392 3300048920 Bacteria 2144
278 Ga0496118_0066967 3300048921 Bacteria 2619
279 Ga0496118_0199968 3300048921 Bacteria 1185
280 Ga0496119_0000571 3300048922 Bacteria 49743
281 Ga0496119_0043078 3300048922 Bacteria 2856
282 Ga0496120_0001391 3300048923 Bacteria 29334
283 Ga0496121_0054192 3300048924 Bacteria 3354
284 Ga0496126_0000026 3300048929 Bacteria 422310
285 Ga0496126_0078810 3300048929 Bacteria 2918
286 Ga0501034_0060545 3300049571 Bacteria 3803
287 Ga0501034_0165298 3300049571 Bacteria 2182
288 Ga0501036_0068661 3300049572 Bacteria 2999
289 Ga0501037_0035032 3300049573 Bacteria 3703
290 Ga0501038_0008212 3300049574 Bacteria 9604
291 Ga0501042_0628773 3300049578 Bacteria 780
292 Ga0501043_0341697 3300049579 Bacteria 1138
293 Ga0501047_0010572 3300049581 Bacteria 8729
294 Ga0501048_0015520 3300049582 Bacteria 5626
295 Ga0501070_0017304 3300049586 Bacteria 6053
296 Ga0501073_0092181 3300049589 Bacteria 2106
297 Ga0501035_0140244 3300049822 Bacteria 2102
298 Ga0501035_0253563 3300049822 Bacteria 1493
299 Ga0501035_0419442 3300049822 Bacteria 1111
300 nmdc:mga0n895_19700_c1 3300050512 Bacteria 6274
301 nmdc:mga0rr50_7894_c1 3300050513 Bacteria 6600
302 nmdc:mga08x19_136713_c1 3300050514 Bacteria 1653
303 nmdc:mga0a205_32604_c1 3300050515 Bacteria 4995
304 Ga0495619_0644468 3300053085 Bacteria 723
305 Ga0500568_0002204 3300053139 Bacteria 11712
306 Ga0466962_0002278 3300061719 Bacteria 9095
307 Ga0466962_0017330 3300061719 Bacteria 3468
308 Ga0068855_100660853
309 Ga0070683_100391962
310 Ga0070690_100378103
311 Ga0068869_100022830
312 Ga0070666_10013561
313 Ga0070682_100002942
314 Ga0068868_100007377
315 Ga0070692_10004804
316 Ga0070668_100003259
317 Ga0070668_100007011
318 Ga0070668_100852262
319 Ga0070669_100015202
320 Ga0070675_100396684
321 Ga0070671_100342054
322 Ga0070673_100043850
323 Ga0070688_100020303
324 Ga0070659_100031120
325 Ga0070667_100001130
326 Ga0070667_100005251
327 Ga0070667_100041134
328 Ga0070667_100186195
329 Ga0070703_10006024
330 Ga0070714_100000008
331 Ga0070714_100015986
332 Ga0070714_100882389
333 Ga0070713_100068361
334 Ga0070713_100264859
335 Ga0070710_10008109
336 Ga0070701_10005885
337 Ga0070711_100003494
338 Ga0070705_100052310
339 Ga0070700_100013252
340 Ga0070694_100014759
341 Ga0070663_100013148
342 Ga0070663_100245314
343 Ga0070678_100253177
344 Ga0070662_100032054
345 Ga0070698_100955741
346 Ga0070697_100168413
347 Ga0068853_100015003
348 Ga0070672_100065481
349 Ga0070686_100057402
350 Ga0070695_100004890
351 Ga0070693_100021581
352 Ga0070665_100008679
353 Ga0070665_100026310
354 Ga0070665_100337366
355 Ga0070704_100004681
356 Ga0068855_100254111
357 Ga0070664_100506767
358 Ga0068857_100447136
359 Ga0068854_100055765
360 Ga0068854_100135270
361 Ga0068856_100024024
362 Ga0068856_100106284
363 Ga0068856_100156605
364 Ga0068856_100248501
365 Ga0070702_100001515
366 Ga0068852_100018474
367 Ga0068852_100060654
368 Ga0068859_100007784
369 Ga0068859_100061738
370 Ga0068866_10005463
371 Ga0068861_100048631
372 Ga0068863_100012582
373 Ga0068858_100010610
374 Ga0068858_100063600
375 Ga0068860_100000067
376 Ga0068860_100051304
377 Ga0081455_10004407
378 Ga0081540_1034333
379 Ga0070717_10006515
380 Ga0075432_10016554
381 Ga0070715_10007796
382 Ga0070716_100009714
383 Ga0070712_100017323
384 Ga0068871_100022111
385 Ga0075433_10050461
386 Ga0068865_100081103
387 Ga0075436_100007869
388 Ga0097620_100007784
389 Ga0097620_100061740
390 Ga0075435_100004445
391 Ga0105251_10234381
392 Ga0105240_10059242
393 Ga0105240_10064060
394 Ga0105245_10007549
395 Ga0105245_10017737
396 Ga0105247_10001103
397 Ga0105247_10050253
398 Ga0105243_10003216
399 Ga0105241_10010681
400 Ga0105241_10119354
401 Ga0105242_10018199
402 Ga0105248_10097219
403 Ga0105237_10015529
404 Ga0105237_10020954
405 Ga0105238_10039143
406 Ga0105238_10383885
407 Ga0105249_10021697
408 Ga0105239_10037047
409 Ga0105239_10308788
410 Ga0105246_10009226
411 Ga0157371_10014368
412 Ga0157370_10014450
413 Ga0157370_10101510
414 Ga0157374_10027562
415 Ga0157374_10565585
416 Ga0157378_10020569
417 Ga0163162_10007059
418 Ga0163163_10055525
419 Ga0163163_10289683
420 Ga0163163_10391560
421 Ga0157380_10227687
422 Ga0157379_10004147
423 Ga0157379_10024019
424 Ga0157376_10025492
425 Ga0163161_10022933
426 Ga0206353_11093092
427 Ga0207653_10009644
428 Ga0207692_10022651
429 Ga0207710_10023706
430 Ga0207710_10052723
431 Ga0207688_10004534
432 Ga0207680_10001372
433 Ga0207680_10116932
434 Ga0207647_10154306
435 Ga0207699_10079457
436 Ga0207654_10037653
437 Ga0207654_10251548
438 Ga0207695_10102349
439 Ga0207695_10229509
440 Ga0207671_10042003
441 Ga0207693_10001430
442 Ga0207663_10220620
443 Ga0207662_10019494
444 Ga0207657_10024498
445 Ga0207681_10046501
446 Ga0207694_10016640
447 Ga0207694_10814395
448 Ga0207659_10325752
449 Ga0207687_10036214
450 Ga0207687_10061465
451 Ga0207700_10814127
452 Ga0207664_10000002
453 Ga0207664_10066567
454 Ga0207664_10612561
455 Ga0207644_10146521
456 Ga0207644_10269030
457 Ga0207690_10287977
458 Ga0207706_10002272
459 Ga0207686_10234749
460 Ga0207709_10123095
461 Ga0207665_10003150
462 Ga0207711_10109846
463 Ga0207689_10010568
464 Ga0207667_10175600
465 Ga0207667_10409860
466 Ga0207651_10012221
467 Ga0207712_10177537
468 Ga0207668_10015509
469 Ga0207668_10015530
470 Ga0207658_10002185
471 Ga0207658_10034657
472 Ga0207658_10090722
473 Ga0207658_10156820
474 Ga0207677_10014314
475 Ga0207703_10165645
476 Ga0207639_10037267
477 Ga0207678_10002975
478 Ga0207678_10123360
479 Ga0207708_10008207
480 Ga0207702_10082771
481 Ga0207702_10153562
482 Ga0207702_10298367
483 Ga0207641_10002225
484 Ga0207641_10310415
485 Ga0207676_10081291
486 Ga0207674_10181286
487 Ga0207674_10210880
488 Ga0207675_100040426
489 Ga0207683_10001774
490 Ga0207698_10043477
491 Ga0207428_10182683
492 Ga0268266_10009773
493 Ga0268266_10079692
494 Ga0268266_10344241
495 Ga0268264_10000114
496 Ga0265327_10000019
497 Ga0265327_10001706
498 Ga0265327_10013514
499 Ga0373938_0001862
500 Ga0373940_0001722
501 Ga0373960_0003159
502 Ga0373942_0008474
503 Ga0373961_0010944
504 Ga0373962_0004719
505 Ga0373931_0021163
506 Ga0436365_0500566
507 Ga0466969_0092778
508 Ga0466972_0010324
509 Ga0466972_0040332
510 Ga0466965_0006299
511 Ga0466966_0008062
512 Ga0466966_0068910
513 Ga0466966_0086185
514 Ga0466966_0325821
515 Ga0466961_0008497
516 Ga0466961_0022791
517 Ga0466961_0043726
518 Ga0466961_0081882
519 Ga0466961_0098219
520 Ga0466963_0003549
521 Ga0466963_0006384
522 Ga0466963_0077442
523 Ga0466963_0112809
524 Ga0466963_0289432
525 Ga0466963_0305372
526 Ga0466964_0000839
527 Ga0466971_0013194
528 Ga0466971_0019140
529 Ga0466971_0144470
530 Ga0466970_0008472
531 Ga0466970_0106936
532 Ga0466970_0240458
533 Ga0466957_0005526
534 Ga0466957_0172658
535 Ga0466960_0010098
536 Ga0466960_0046474
537 Ga0466960_0075615
538 Ga0466960_0160902
539 Ga0466959_0030134
540 Ga0466959_0049164
541 Ga0466959_0122854
542 Ga0466959_0249700
543 Ga0466959_0419256
544 Ga0466958_0004679
545 Ga0466958_0147162
546 Ga0466958_0170327
547 Ga0466967_0010512
548 Ga0466967_0013845
549 Ga0466967_0048772
550 Ga0466967_0052196
551 Ga0466967_0188505
552 Ga0466967_0326927
553 Ga0466967_0347725
554 Ga0466967_0361923
555 Ga0496100_0013933
556 Ga0496101_0035293
557 Ga0496101_0041700
558 Ga0496102_0000059
559 Ga0496102_0125965
560 Ga0496102_0354846
561 Ga0496103_0000063
562 Ga0496103_0256460
563 Ga0496104_0092086
564 Ga0496104_0191435
565 Ga0496104_0589230
566 Ga0496106_0013002
567 Ga0496106_0834480
568 Ga0496107_0010765
569 Ga0496108_0041275
570 Ga0496108_0052391
571 Ga0496109_0008722
572 Ga0496109_0046178
573 Ga0496110_0021784
574 Ga0496110_0085066
575 Ga0496111_0033014
576 Ga0496111_0189152
577 Ga0496112_0220574
578 Ga0496113_0016850
579 Ga0496113_0024274
580 Ga0496114_0113039
581 Ga0496114_0165086
582 Ga0496115_0049551
583 Ga0496115_0060307
584 Ga0496117_0080392
585 Ga0496118_0066967
586 Ga0496118_0199968
587 Ga0496119_0000571
588 Ga0496119_0043078
589 Ga0496120_0001391
590 Ga0496121_0054192
591 Ga0496126_0000026
592 Ga0496126_0078810
593 Ga0501034_0060545
594 Ga0501034_0165298
595 Ga0501036_0068661
596 Ga0501037_0035032
597 Ga0501038_0008212
598 Ga0501042_0628773
599 Ga0501043_0341697
600 Ga0501047_0010572
601 Ga0501048_0015520
602 Ga0501070_0017304
603 Ga0501073_0092181
604 Ga0501035_0140244
605 Ga0501035_0253563
606 Ga0501035_0419442
607 nmdc:mga0n895_19700_c1
608 nmdc:mga0rr50_7894_c1
609 nmdc:mga08x19_136713_c1
610 nmdc:mga0a205_32604_c1
611 Ga0495619_0644468
612 Ga0500568_0002204
613 Ga0466962_0002278
614 Ga0466962_0017330

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13794

MiaE_2

tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)-like

44

227

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ez0-assembly2.cif.gz_C crystal structure of protein of unknown function with ferritin-like fold (yp_832262.1) from arthrobacter sp. fb24 at 2.33 a resolution 0.9341 15 222
3ez0-assembly1.cif.gz_B crystal structure of protein of unknown function with ferritin-like fold (yp_832262.1) from arthrobacter sp. fb24 at 2.33 a resolution 0.9306 15 222
3ez0-assembly2.cif.gz_D crystal structure of protein of unknown function with ferritin-like fold (yp_832262.1) from arthrobacter sp. fb24 at 2.33 a resolution 0.9258 17 222
3ez0-assembly2.cif.gz_C crystal structure of protein of unknown function with ferritin-like fold (yp_832262.1) from arthrobacter sp. fb24 at 2.33 a resolution 0.917 15 222
3ez0-assembly1.cif.gz_B crystal structure of protein of unknown function with ferritin-like fold (yp_832262.1) from arthrobacter sp. fb24 at 2.33 a resolution 0.8849 15 222
ID Description Score Start End Superfamily
af_O05856_13_231_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9656 12 223 1.20.1260.10
af_O05856_13_231_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9313 12 223 1.20.1260.10
3ez0C00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9286 13 222 1.20.1260.10
3ez0C00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9198 13 222 1.20.1260.10
3ez0D00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9191 17 222 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A6B3EYS9-F1-model_v4 tRNA 2-methylthio-N6-isopentenyl adenosine(37) hydroxylase MiaE-like protein 1.004 14 105
AF-A0A6B3GE83-F1-model_v4 tRNA 2-methylthio-N6-isopentenyl adenosine(37) hydroxylase MiaE-like protein 1.002 16 105
AF-A0A0H5CUW4-F1-model_v4 Hydroxylase 0.9777 19 222
AF-D9VXY3-F1-model_v4 tRNA 2-methylthio-N6-isopentenyl adenosine(37) hydroxylase MiaE-like protein 0.9765 16 173
AF-A0A7K2XMQ5-F1-model_v4 tRNA 2-methylthio-N6-isopentenyl adenosine(37) hydroxylase MiaE-like protein 0.9757 16 173

Map