F399069

General Info

Members Datasets Scaffolds Average Seq Length
307 178 614 142

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100858155|Ga0070706_1008581551
Length 158
Sequence MVTAPIHLGQEILPLQRQTGFQNWNRFAAVNNEFVPIHMDDDAGRAAGYPTAFGMGSLQWSFLHTMLREWIGDEGRILRVACQFRAANTKGMTVAARGRITAIRETGSEIEVDLDVWTESDDGRSLAPGSATVALPTTHWRVGTPSGAATQKASGRTA

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
116 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
117 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
118 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
178 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.91
Nodule 0
Rhizoplane 14.98
Rhizosphere 68.73
Stem 0
Stem Tuber 0
Unclassified 6.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100858155 3300005467 Unclassified 839
2 JGI24741J21665_1000676 3300001915 Bacteria 10262
3 JGI24740J21852_10000019 3300001979 Bacteria 54662
4 rootH2_10037206 3300003320 Bacteria 6691
5 Ga0070676_10128192 3300005328 Bacteria 1601
6 Ga0070666_10723973 3300005335 Bacteria 730
7 Ga0070682_100570092 3300005337 Bacteria 889
8 Ga0070691_10285920 3300005341 Unclassified 896
9 Ga0070668_100031718 3300005347 Bacteria 4021
10 Ga0070669_100113575 3300005353 Bacteria 2058
11 Ga0070671_100001478 3300005355 Bacteria 17555
12 Ga0070674_101458314 3300005356 Bacteria 614
13 Ga0070667_100272706 3300005367 Bacteria 1517
14 Ga0070667_100286595 3300005367 Bacteria 1480
15 Ga0070667_100625693 3300005367 Bacteria 993
16 Ga0070667_102015090 3300005367 Bacteria 544
17 Ga0070709_10062905 3300005434 Bacteria 2368
18 Ga0070714_100116994 3300005435 Bacteria 2367
19 Ga0070714_100209244 3300005435 Bacteria 1787
20 Ga0070714_100795252 3300005435 Bacteria 916
21 Ga0070713_100044710 3300005436 Bacteria 3626
22 Ga0070713_100055156 3300005436 Bacteria 3301
23 Ga0070713_100157181 3300005436 Bacteria 2027
24 Ga0070713_100592519 3300005436 Unclassified 1053
25 Ga0070710_10099764 3300005437 Bacteria 1727
26 Ga0070711_100189131 3300005439 Bacteria 1581
27 Ga0070663_100000022 3300005455 Bacteria 111612
28 Ga0070678_100092274 3300005456 Bacteria 2326
29 Ga0070706_100591981 3300005467 Unclassified 1031
30 Ga0070706_100595884 3300005467 Bacteria 1027
31 Ga0070707_100052849 3300005468 Bacteria 3895
32 Ga0070699_101740851 3300005518 Bacteria 571
33 Ga0070684_100864565 3300005535 Bacteria 847
34 Ga0070665_100000944 3300005548 Bacteria 37066
35 Ga0070665_100535663 3300005548 Bacteria 1183
36 Ga0070665_100708004 3300005548 Bacteria 1020
37 Ga0068857_100125344 3300005577 Bacteria 2314
38 Ga0068856_100000041 3300005614 Bacteria 112613
39 Ga0070702_101043594 3300005615 Bacteria 650
40 Ga0068852_100299016 3300005616 Bacteria 1557
41 Ga0068859_100036390 3300005617 Bacteria 4942
42 Ga0068859_101050477 3300005617 Bacteria 895
43 Ga0068864_100376119 3300005618 Bacteria 1345
44 Ga0068864_102702006 3300005618 Unclassified 502
45 Ga0068870_10977310 3300005840 Bacteria 602
46 Ga0068863_100015960 3300005841 Bacteria 7203
47 Ga0068858_100000004 3300005842 Bacteria 336234
48 Ga0068858_100004997 3300005842 Bacteria 12992
49 Ga0068860_100018588 3300005843 Bacteria 6760
50 Ga0068862_100000066 3300005844 Bacteria 124095
51 Ga0068862_101556216 3300005844 Bacteria 667
52 Ga0081455_10175063 3300005937 Bacteria 1630
53 Ga0081539_10040050 3300005985 Bacteria 2756
54 Ga0081539_10078825 3300005985 Bacteria 1738
55 Ga0070717_10004287 3300006028 Bacteria 10281
56 Ga0070717_10101068 3300006028 Bacteria 2449
57 Ga0070717_10259190 3300006028 Bacteria 1538
58 Ga0075365_11140474 3300006038 Bacteria 549
59 Ga0075363_100179847 3300006048 Bacteria 1203
60 Ga0075363_100301181 3300006048 Bacteria 930
61 Ga0075364_10132725 3300006051 Bacteria 1672
62 Ga0070716_100736316 3300006173 Bacteria 757
63 Ga0070712_100010380 3300006175 Bacteria 5875
64 Ga0070712_100194569 3300006175 Bacteria 1589
65 Ga0075362_10077655 3300006177 Bacteria 1526
66 Ga0075366_10019134 3300006195 Bacteria 3958
67 Ga0075370_10078477 3300006353 Bacteria 1896
68 Ga0075433_10520049 3300006852 Bacteria 1047
69 Ga0097620_100028119 3300006931 Bacteria 5637
70 Ga0097620_100036391 3300006931 Bacteria 4942
71 Ga0097620_101050511 3300006931 Bacteria 895
72 Ga0105251_10004387 3300009011 Bacteria 9614
73 Ga0105251_10490896 3300009011 Bacteria 573
74 Ga0105250_10124744 3300009092 Unclassified 1060
75 Ga0105240_10002453 3300009093 Bacteria 29792
76 Ga0105240_10419160 3300009093 Bacteria 1504
77 Ga0105240_12263265 3300009093 Bacteria 563
78 Ga0111539_12406311 3300009094 Bacteria 611
79 Ga0105247_10006926 3300009101 Bacteria 6980
80 Ga0105247_10055533 3300009101 Bacteria 2443
81 Ga0105247_10123907 3300009101 Bacteria 1677
82 Ga0105247_10610508 3300009101 Bacteria 810
83 Ga0105243_10624641 3300009148 Bacteria 1040
84 Ga0105243_11486779 3300009148 Unclassified 701
85 Ga0105243_11521777 3300009148 Bacteria 693
86 Ga0105241_10000037 3300009174 Bacteria 115452
87 Ga0105241_10852692 3300009174 Bacteria 843
88 Ga0105242_11974092 3300009176 Bacteria 625
89 Ga0105248_10000241 3300009177 Bacteria 63198
90 Ga0105248_10021606 3300009177 Bacteria 7128
91 Ga0105248_10030875 3300009177 Bacteria 5986
92 Ga0105248_11199649 3300009177 Bacteria 858
93 Ga0105237_10324112 3300009545 Bacteria 1544
94 Ga0105237_10865401 3300009545 Bacteria 911
95 Ga0105238_10000192 3300009551 Bacteria 67306
96 Ga0105238_11998634 3300009551 Unclassified 613
97 Ga0105249_10018086 3300009553 Bacteria 6264
98 Ga0105249_11671643 3300009553 Bacteria 709
99 Ga0099796_10422681 3300010159 Unclassified 588
100 Ga0105239_10513844 3300010375 Bacteria 1362
101 Ga0105239_10536074 3300010375 Bacteria 1332
102 Ga0105246_10140726 3300011119 Bacteria 1814
103 Ga0105246_11477176 3300011119 Unclassified 637
104 Ga0157373_10000046 3300013100 Bacteria 112179
105 Ga0157370_10000071 3300013104 Bacteria 111640
106 Ga0157378_11520966 3300013297 Bacteria 714
107 Ga0163162_11935128 3300013306 Bacteria 675
108 Ga0157372_11674300 3300013307 Bacteria 732
109 Ga0157375_12684861 3300013308 Bacteria 595
110 Ga0163163_10022529 3300014325 Bacteria 5967
111 Ga0163163_10098380 3300014325 Bacteria 2947
112 Ga0163163_10414775 3300014325 Bacteria 1405
113 Ga0157380_10406632 3300014326 Bacteria 1293
114 Ga0157377_10514601 3300014745 Unclassified 839
115 Ga0157379_10000001 3300014968 Bacteria 180484
116 Ga0157379_10001767 3300014968 Bacteria 17874
117 Ga0157379_10003727 3300014968 Bacteria 12965
118 Ga0157379_10637007 3300014968 Bacteria 997
119 Ga0157379_11305927 3300014968 Bacteria 701
120 Ga0207710_10000556 3300025900 Bacteria 22299
121 Ga0207710_10000571 3300025900 Bacteria 22034
122 Ga0207710_10003500 3300025900 Bacteria 6734
123 Ga0207710_10028064 3300025900 Bacteria 2441
124 Ga0207688_10289139 3300025901 Bacteria 1000
125 Ga0207680_10508375 3300025903 Bacteria 858
126 Ga0207699_10101729 3300025906 Bacteria 1825
127 Ga0207684_10492841 3300025910 Unclassified 1051
128 Ga0207684_10522302 3300025910 Bacteria 1017
129 Ga0207684_11495477 3300025910 Unclassified 550
130 Ga0207654_10000032 3300025911 Bacteria 120553
131 Ga0207695_10019043 3300025913 Bacteria 7918
132 Ga0207695_10300221 3300025913 Bacteria 1497
133 Ga0207693_10003143 3300025915 Bacteria 14192
134 Ga0207646_10004357 3300025922 Bacteria 15415
135 Ga0207681_10026454 3300025923 Bacteria 3742
136 Ga0207694_10000812 3300025924 Bacteria 27924
137 Ga0207687_10443634 3300025927 Unclassified 1075
138 Ga0207700_10149715 3300025928 Bacteria 1927
139 Ga0207700_10183668 3300025928 Bacteria 1753
140 Ga0207700_10584605 3300025928 Bacteria 993
141 Ga0207700_10763035 3300025928 Unclassified 864
142 Ga0207664_10099442 3300025929 Bacteria 2400
143 Ga0207644_10003315 3300025931 Bacteria 10394
144 Ga0207709_10579685 3300025935 Bacteria 886
145 Ga0207665_10378766 3300025939 Bacteria 1073
146 Ga0207691_10907503 3300025940 Bacteria 737
147 Ga0207711_10001302 3300025941 Bacteria 23615
148 Ga0207711_10001871 3300025941 Bacteria 19185
149 Ga0207711_10033345 3300025941 Bacteria 4356
150 Ga0207711_10892624 3300025941 Bacteria 826
151 Ga0207689_11145964 3300025942 Bacteria 655
152 Ga0207661_10785250 3300025944 Bacteria 877
153 Ga0207712_10018603 3300025961 Bacteria 4528
154 Ga0207668_10012516 3300025972 Bacteria 5196
155 Ga0207658_10284400 3300025986 Bacteria 1419
156 Ga0207658_10399925 3300025986 Bacteria 1207
157 Ga0207658_10785674 3300025986 Bacteria 864
158 Ga0207658_10890884 3300025986 Bacteria 810
159 Ga0207677_10278701 3300026023 Bacteria 1371
160 Ga0207703_10000011 3300026035 Bacteria 336248
161 Ga0207703_10000071 3300026035 Bacteria 121299
162 Ga0207678_10000038 3300026067 Bacteria 101262
163 Ga0207702_10000061 3300026078 Bacteria 125368
164 Ga0207641_10047850 3300026088 Bacteria 3607
165 Ga0207648_11214933 3300026089 Bacteria 708
166 Ga0207676_10495747 3300026095 Bacteria 1159
167 Ga0207674_10264653 3300026116 Bacteria 1667
168 Ga0207683_10858720 3300026121 Bacteria 843
169 Ga0207698_11641846 3300026142 Bacteria 658
170 Ga0268266_10004289 3300028379 Bacteria 13724
171 Ga0268266_11160668 3300028379 Bacteria 747
172 Ga0268265_10000062 3300028380 Bacteria 148317
173 Ga0268265_11207319 3300028380 Bacteria 754
174 Ga0268264_10023640 3300028381 Bacteria 5013
175 Ga0268264_12017009 3300028381 Bacteria 586
176 Ga0265327_10008334 3300031251 Bacteria 7748
177 Ga0265327_10020911 3300031251 Bacteria 3969
178 Ga0265327_10469017 3300031251 Bacteria 543
179 Ga0307513_10000353 3300031456 Bacteria 67041
180 Ga0307513_10004704 3300031456 Bacteria 18152
181 Ga0316578_10268158 3300031728 Bacteria 1023
182 Ga0316578_10274560 3300031728 Bacteria 1010
183 Ga0307516_10000022 3300031730 Bacteria 191854
184 Ga0373930_0009716 3300034816 Bacteria 1707
185 Ga0373950_0031525 3300034818 Bacteria 984
186 Ga0373928_0003623 3300035084 Bacteria 2943
187 Ga0373949_0270165 3300035090 Bacteria 531
188 Ga0373932_0012435 3300035112 Bacteria 2096
189 Ga0373932_0324726 3300035112 Bacteria 580
190 Ga0316574_0005385 3300035398 Bacteria 6822
191 Ga0373931_0000010 3300035691 Bacteria 334069
192 Ga0373931_0000171 3300035691 Bacteria 28305
193 Ga0373931_0086354 3300035691 Bacteria 1741
194 Ga0316584_0010524 3300036712 Bacteria 6470
195 Ga0451793_1510656 3300041452 Bacteria 545
196 Ga0451853_4028580 3300041512 Bacteria 794
197 Ga0466967_0205929 3300045976 Bacteria 1865
198 Ga0495651_0302337 3300046462 Bacteria 1073
199 Ga0495628_0495698 3300046516 Bacteria 883
200 Ga0495630_0095150 3300046517 Bacteria 2252
201 Ga0495642_0169980 3300046528 Bacteria 947
202 Ga0495635_0646215 3300046663 Bacteria 688
203 Ga0495604_0473305 3300047317 Bacteria 816
204 Ga0495674_1155786 3300047319 Bacteria 587
205 Ga0495672_0299055 3300047320 Bacteria 763
206 Ga0495680_0425797 3300047322 Bacteria 912
207 Ga0495680_0444031 3300047322 Bacteria 889
208 Ga0495686_0155848 3300047472 Bacteria 1338
209 Ga0495602_0668424 3300048088 Bacteria 708
210 Ga0496100_0029919 3300048903 Bacteria 3373
211 Ga0496100_0050335 3300048903 Bacteria 2699
212 Ga0496101_0007079 3300048904 Bacteria 7253
213 Ga0496101_0014309 3300048904 Bacteria 5328
214 Ga0496101_0033864 3300048904 Bacteria 3606
215 Ga0496102_0000405 3300048905 Bacteria 50258
216 Ga0496102_0018762 3300048905 Bacteria 6083
217 Ga0496102_0031124 3300048905 Bacteria 4784
218 Ga0496102_0102374 3300048905 Bacteria 2662
219 Ga0496102_0218207 3300048905 Unclassified 1798
220 Ga0496102_0461845 3300048905 Bacteria 1191
221 Ga0496102_1840267 3300048905 Unclassified 522
222 Ga0496103_0000254 3300048906 Bacteria 51276
223 Ga0496103_0000265 3300048906 Bacteria 50238
224 Ga0496103_0020138 3300048906 Bacteria 4005
225 Ga0496103_0262714 3300048906 Bacteria 1111
226 Ga0496104_0018931 3300048907 Bacteria 6290
227 Ga0496104_0033949 3300048907 Bacteria 4756
228 Ga0496104_0693821 3300048907 Unclassified 926
229 Ga0496104_1605971 3300048907 Bacteria 553
230 Ga0496105_0004170 3300048908 Bacteria 10853
231 Ga0496105_0009695 3300048908 Bacteria 7541
232 Ga0496105_0187209 3300048908 Bacteria 1694
233 Ga0496105_0493716 3300048908 Bacteria 962
234 Ga0496106_0083558 3300048909 Bacteria 2456
235 Ga0496106_0101400 3300048909 Bacteria 2233
236 Ga0496106_0122819 3300048909 Bacteria 2031
237 Ga0496107_0015628 3300048910 Bacteria 5321
238 Ga0496107_0132864 3300048910 Bacteria 1838
239 Ga0496107_0198315 3300048910 Bacteria 1492
240 Ga0496108_0084976 3300048911 Bacteria 2686
241 Ga0496108_0201654 3300048911 Bacteria 1726
242 Ga0496108_0252589 3300048911 Bacteria 1534
243 Ga0496108_1280429 3300048911 Bacteria 617
244 Ga0496108_1744383 3300048911 Bacteria 511
245 Ga0496109_0305605 3300048912 Bacteria 1500
246 Ga0496110_0338680 3300048913 Bacteria 1370
247 Ga0496110_0761528 3300048913 Bacteria 872
248 Ga0496110_0803825 3300048913 Unclassified 845
249 Ga0496111_0474453 3300048914 Bacteria 922
250 Ga0496111_1028925 3300048914 Bacteria 589
251 Ga0496112_0116640 3300048915 Bacteria 2640
252 Ga0496113_0167744 3300048916 Bacteria 1738
253 Ga0496115_0010409 3300048918 Bacteria 6947
254 Ga0496115_0986430 3300048918 Bacteria 645
255 Ga0496116_0000479 3300048919 Bacteria 55101
256 Ga0496116_0000522 3300048919 Bacteria 51808
257 Ga0496117_0000776 3300048920 Bacteria 50280
258 Ga0496117_0160166 3300048920 Bacteria 1319
259 Ga0496118_0000798 3300048921 Bacteria 50327
260 Ga0496118_0038087 3300048921 Bacteria 3858
261 Ga0496118_0041056 3300048921 Bacteria 3669
262 Ga0496118_0190053 3300048921 Bacteria 1229
263 Ga0496118_0293294 3300048921 Bacteria 897
264 Ga0496119_0005125 3300048922 Bacteria 12698
265 Ga0496119_0007540 3300048922 Bacteria 9776
266 Ga0496119_0011479 3300048922 Bacteria 7327
267 Ga0496119_0016773 3300048922 Bacteria 5549
268 Ga0496119_0020187 3300048922 Bacteria 4868
269 Ga0496119_0020590 3300048922 Bacteria 4806
270 Ga0496119_0035453 3300048922 Bacteria 3269
271 Ga0496120_0000965 3300048923 Bacteria 39237
272 Ga0496120_0003678 3300048923 Bacteria 13707
273 Ga0496120_0065167 3300048923 Bacteria 2020
274 Ga0496121_0012454 3300048924 Bacteria 9269
275 Ga0496121_0019684 3300048924 Bacteria 6734
276 Ga0496121_0041326 3300048924 Bacteria 4031
277 Ga0496121_0061077 3300048924 Bacteria 3095
278 Ga0496121_0088895 3300048924 Bacteria 2420
279 Ga0496121_0410238 3300048924 Unclassified 884
280 Ga0496124_0020899 3300048927 Bacteria 6039
281 Ga0496124_0249835 3300048927 Bacteria 1313
282 Ga0496125_0015967 3300048928 Bacteria 7231
283 Ga0496126_0001073 3300048929 Bacteria 45979
284 Ga0496126_0019213 3300048929 Bacteria 6734
285 Ga0496126_0152770 3300048929 Bacteria 1978
286 Ga0501034_0066147 3300049571 Bacteria 3627
287 Ga0501034_0588596 3300049571 Bacteria 1019
288 Ga0501039_0827535 3300049575 Bacteria 722
289 Ga0501043_0072811 3300049579 Bacteria 2699
290 Ga0501043_0286105 3300049579 Bacteria 1263
291 Ga0501046_0022180 3300049580 Bacteria 5233
292 Ga0501047_0011748 3300049581 Bacteria 8281
293 Ga0501047_0480931 3300049581 Bacteria 1069
294 Ga0501070_0025528 3300049586 Bacteria 4956
295 Ga0501070_0993068 3300049586 Bacteria 651
296 Ga0501073_0251031 3300049589 Bacteria 1221
297 Ga0501044_0109800 3300049823 Bacteria 2767
298 nmdc:mga03n38_254459_c1 3300050490 Bacteria 929
299 nmdc:mga00v17_236519_c1 3300050491 Bacteria 1184
300 nmdc:mga07m45_119278_c1 3300050496 Bacteria 1523
301 Ga0495619_0053526 3300053085 Bacteria 2670
302 Ga0500604_0028398 3300053151 Bacteria 1625
303 Ga0500616_0000920 3300053153 Bacteria 32166
304 Ga0501084_0475942 3300054114 Bacteria 1056
305 Ga0501082_0431523 3300060353 Bacteria 1151
306 2816507133 2816332139 Bacteria 9138787
307 2974315766 2974315732 Bacteria 4602776
308 Ga0070706_100858155
309 JGI24741J21665_1000676
310 JGI24740J21852_10000019
311 rootH2_10037206
312 Ga0070676_10128192
313 Ga0070666_10723973
314 Ga0070682_100570092
315 Ga0070691_10285920
316 Ga0070668_100031718
317 Ga0070669_100113575
318 Ga0070671_100001478
319 Ga0070674_101458314
320 Ga0070667_100272706
321 Ga0070667_100286595
322 Ga0070667_100625693
323 Ga0070667_102015090
324 Ga0070709_10062905
325 Ga0070714_100116994
326 Ga0070714_100209244
327 Ga0070714_100795252
328 Ga0070713_100044710
329 Ga0070713_100055156
330 Ga0070713_100157181
331 Ga0070713_100592519
332 Ga0070710_10099764
333 Ga0070711_100189131
334 Ga0070663_100000022
335 Ga0070678_100092274
336 Ga0070706_100591981
337 Ga0070706_100595884
338 Ga0070707_100052849
339 Ga0070699_101740851
340 Ga0070684_100864565
341 Ga0070665_100000944
342 Ga0070665_100535663
343 Ga0070665_100708004
344 Ga0068857_100125344
345 Ga0068856_100000041
346 Ga0070702_101043594
347 Ga0068852_100299016
348 Ga0068859_100036390
349 Ga0068859_101050477
350 Ga0068864_100376119
351 Ga0068864_102702006
352 Ga0068870_10977310
353 Ga0068863_100015960
354 Ga0068858_100000004
355 Ga0068858_100004997
356 Ga0068860_100018588
357 Ga0068862_100000066
358 Ga0068862_101556216
359 Ga0081455_10175063
360 Ga0081539_10040050
361 Ga0081539_10078825
362 Ga0070717_10004287
363 Ga0070717_10101068
364 Ga0070717_10259190
365 Ga0075365_11140474
366 Ga0075363_100179847
367 Ga0075363_100301181
368 Ga0075364_10132725
369 Ga0070716_100736316
370 Ga0070712_100010380
371 Ga0070712_100194569
372 Ga0075362_10077655
373 Ga0075366_10019134
374 Ga0075370_10078477
375 Ga0075433_10520049
376 Ga0097620_100028119
377 Ga0097620_100036391
378 Ga0097620_101050511
379 Ga0105251_10004387
380 Ga0105251_10490896
381 Ga0105250_10124744
382 Ga0105240_10002453
383 Ga0105240_10419160
384 Ga0105240_12263265
385 Ga0111539_12406311
386 Ga0105247_10006926
387 Ga0105247_10055533
388 Ga0105247_10123907
389 Ga0105247_10610508
390 Ga0105243_10624641
391 Ga0105243_11486779
392 Ga0105243_11521777
393 Ga0105241_10000037
394 Ga0105241_10852692
395 Ga0105242_11974092
396 Ga0105248_10000241
397 Ga0105248_10021606
398 Ga0105248_10030875
399 Ga0105248_11199649
400 Ga0105237_10324112
401 Ga0105237_10865401
402 Ga0105238_10000192
403 Ga0105238_11998634
404 Ga0105249_10018086
405 Ga0105249_11671643
406 Ga0099796_10422681
407 Ga0105239_10513844
408 Ga0105239_10536074
409 Ga0105246_10140726
410 Ga0105246_11477176
411 Ga0157373_10000046
412 Ga0157370_10000071
413 Ga0157378_11520966
414 Ga0163162_11935128
415 Ga0157372_11674300
416 Ga0157375_12684861
417 Ga0163163_10022529
418 Ga0163163_10098380
419 Ga0163163_10414775
420 Ga0157380_10406632
421 Ga0157377_10514601
422 Ga0157379_10000001
423 Ga0157379_10001767
424 Ga0157379_10003727
425 Ga0157379_10637007
426 Ga0157379_11305927
427 Ga0207710_10000556
428 Ga0207710_10000571
429 Ga0207710_10003500
430 Ga0207710_10028064
431 Ga0207688_10289139
432 Ga0207680_10508375
433 Ga0207699_10101729
434 Ga0207684_10492841
435 Ga0207684_10522302
436 Ga0207684_11495477
437 Ga0207654_10000032
438 Ga0207695_10019043
439 Ga0207695_10300221
440 Ga0207693_10003143
441 Ga0207646_10004357
442 Ga0207681_10026454
443 Ga0207694_10000812
444 Ga0207687_10443634
445 Ga0207700_10149715
446 Ga0207700_10183668
447 Ga0207700_10584605
448 Ga0207700_10763035
449 Ga0207664_10099442
450 Ga0207644_10003315
451 Ga0207709_10579685
452 Ga0207665_10378766
453 Ga0207691_10907503
454 Ga0207711_10001302
455 Ga0207711_10001871
456 Ga0207711_10033345
457 Ga0207711_10892624
458 Ga0207689_11145964
459 Ga0207661_10785250
460 Ga0207712_10018603
461 Ga0207668_10012516
462 Ga0207658_10284400
463 Ga0207658_10399925
464 Ga0207658_10785674
465 Ga0207658_10890884
466 Ga0207677_10278701
467 Ga0207703_10000011
468 Ga0207703_10000071
469 Ga0207678_10000038
470 Ga0207702_10000061
471 Ga0207641_10047850
472 Ga0207648_11214933
473 Ga0207676_10495747
474 Ga0207674_10264653
475 Ga0207683_10858720
476 Ga0207698_11641846
477 Ga0268266_10004289
478 Ga0268266_11160668
479 Ga0268265_10000062
480 Ga0268265_11207319
481 Ga0268264_10023640
482 Ga0268264_12017009
483 Ga0265327_10008334
484 Ga0265327_10020911
485 Ga0265327_10469017
486 Ga0307513_10000353
487 Ga0307513_10004704
488 Ga0316578_10268158
489 Ga0316578_10274560
490 Ga0307516_10000022
491 Ga0373930_0009716
492 Ga0373950_0031525
493 Ga0373928_0003623
494 Ga0373949_0270165
495 Ga0373932_0012435
496 Ga0373932_0324726
497 Ga0316574_0005385
498 Ga0373931_0000010
499 Ga0373931_0000171
500 Ga0373931_0086354
501 Ga0316584_0010524
502 Ga0451793_1510656
503 Ga0451853_4028580
504 Ga0466967_0205929
505 Ga0495651_0302337
506 Ga0495628_0495698
507 Ga0495630_0095150
508 Ga0495642_0169980
509 Ga0495635_0646215
510 Ga0495604_0473305
511 Ga0495674_1155786
512 Ga0495672_0299055
513 Ga0495680_0425797
514 Ga0495680_0444031
515 Ga0495686_0155848
516 Ga0495602_0668424
517 Ga0496100_0029919
518 Ga0496100_0050335
519 Ga0496101_0007079
520 Ga0496101_0014309
521 Ga0496101_0033864
522 Ga0496102_0000405
523 Ga0496102_0018762
524 Ga0496102_0031124
525 Ga0496102_0102374
526 Ga0496102_0218207
527 Ga0496102_0461845
528 Ga0496102_1840267
529 Ga0496103_0000254
530 Ga0496103_0000265
531 Ga0496103_0020138
532 Ga0496103_0262714
533 Ga0496104_0018931
534 Ga0496104_0033949
535 Ga0496104_0693821
536 Ga0496104_1605971
537 Ga0496105_0004170
538 Ga0496105_0009695
539 Ga0496105_0187209
540 Ga0496105_0493716
541 Ga0496106_0083558
542 Ga0496106_0101400
543 Ga0496106_0122819
544 Ga0496107_0015628
545 Ga0496107_0132864
546 Ga0496107_0198315
547 Ga0496108_0084976
548 Ga0496108_0201654
549 Ga0496108_0252589
550 Ga0496108_1280429
551 Ga0496108_1744383
552 Ga0496109_0305605
553 Ga0496110_0338680
554 Ga0496110_0761528
555 Ga0496110_0803825
556 Ga0496111_0474453
557 Ga0496111_1028925
558 Ga0496112_0116640
559 Ga0496113_0167744
560 Ga0496115_0010409
561 Ga0496115_0986430
562 Ga0496116_0000479
563 Ga0496116_0000522
564 Ga0496117_0000776
565 Ga0496117_0160166
566 Ga0496118_0000798
567 Ga0496118_0038087
568 Ga0496118_0041056
569 Ga0496118_0190053
570 Ga0496118_0293294
571 Ga0496119_0005125
572 Ga0496119_0007540
573 Ga0496119_0011479
574 Ga0496119_0016773
575 Ga0496119_0020187
576 Ga0496119_0020590
577 Ga0496119_0035453
578 Ga0496120_0000965
579 Ga0496120_0003678
580 Ga0496120_0065167
581 Ga0496121_0012454
582 Ga0496121_0019684
583 Ga0496121_0041326
584 Ga0496121_0061077
585 Ga0496121_0088895
586 Ga0496121_0410238
587 Ga0496124_0020899
588 Ga0496124_0249835
589 Ga0496125_0015967
590 Ga0496126_0001073
591 Ga0496126_0019213
592 Ga0496126_0152770
593 Ga0501034_0066147
594 Ga0501034_0588596
595 Ga0501039_0827535
596 Ga0501043_0072811
597 Ga0501043_0286105
598 Ga0501046_0022180
599 Ga0501047_0011748
600 Ga0501047_0480931
601 Ga0501070_0025528
602 Ga0501070_0993068
603 Ga0501073_0251031
604 Ga0501044_0109800
605 nmdc:mga03n38_254459_c1
606 nmdc:mga00v17_236519_c1
607 nmdc:mga07m45_119278_c1
608 Ga0495619_0053526
609 Ga0500604_0028398
610 Ga0500616_0000920
611 Ga0501084_0475942
612 Ga0501082_0431523
613 2816507133
614 2974315766

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.893 6 143
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.875 10 140
3hdu-assembly1.cif.gz_A crystal structure of a putative thioesterase (syn_01977) from syntrophus aciditrophicus sb at 2.50 a resolution 0.8717 79 141
3cjy-assembly1.cif.gz_A-2 crystal structure of putative thioesterase (yp_496845.1) from novosphingobium aromaticivorans dsm 12444 at 1.70 a resolution 0.8515 57 140
4w78-assembly1.cif.gz_F crystal structure of the chsh1-chsh2 complex from mycobacterium tuberculosis 0.8474 11 140
ID Description Score Start End Superfamily
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.893 6 143 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.875 10 140 3.10.129.10
4w78F00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8474 11 140 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8448 10 140 3.10.129.10
af_Q9FJI2_19_158_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8339 2 142 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1F2SL04-F1-model_v4 MaoC-like domain-containing protein 0.9608 60 146
AF-X1JQ02-F1-model_v4 MaoC-like domain-containing protein 0.9526 57 143
AF-A0A1F2SL04-F1-model_v4 MaoC-like domain-containing protein 0.9398 60 146
AF-A0A6B1HG79-F1-model_v4 Uncharacterized protein 0.9356 4 140
AF-A0A7X4BZ94-F1-model_v4 MaoC-like domain-containing protein 0.9337 4 143

Map