F399057
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 307 | 174 | 307 | 271 |
Family's Representative Sequence
| Representative Sequence | 3300005456|Ga0070678_100099056|Ga0070678_1000990562 |
| Length | 291 |
| Sequence | MYSGTTLTPLSGRVMGAHQKLDRLSRGALRVLLSEKDSKFPKMRQILHFEGVNGPDAIKRKSPAHDEPWHYYAPFDENDTQLVDLIGDHYDQLVKALKNEDDVRAAFEAAWLAHAIVDGLTPAHHYPYEEKLAELRGGAGLETRTSVKSKIVMPGASPAEKMSNNWKMWGPRGLLMSHGFFEFGIAFLIKPISARQVAVRPQHIAELQKYGMVELFRRKAKEVSAQGMYDYYQERGWTPRLAWRVRTKLVPAIVHTVALSWYAASIDAGIVPRPDNIASEPKPKHGAERQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 34 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 35 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 36 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 37 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 38 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 39 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 40 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 54 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 55 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 98 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 99 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 100 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 101 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 102 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 103 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 104 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 105 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 106 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 107 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 108 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 118 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 119 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 120 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 121 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 126 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 135 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 139 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 140 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 141 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 142 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 143 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 144 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 145 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 146 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 147 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 148 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 149 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 150 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 151 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 152 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 153 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 154 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 155 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 156 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 157 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 158 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 159 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 160 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 161 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 162 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 163 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 164 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 165 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 166 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 167 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 168 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 169 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 170 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 171 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 172 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 173 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 174 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 30.62 |
| Nodule | 0 |
| Rhizoplane | 0.65 |
| Rhizosphere | 65.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_9233593 | 2162886012 | Bacteria | 1567 |
| 2 | JGI24741J21665_1002514 | 3300001915 | Bacteria | 4738 |
| 3 | JGI24741J21665_1005304 | 3300001915 | Bacteria | 2722 |
| 4 | JGI24740J21852_10017710 | 3300001979 | Unclassified | 2541 |
| 5 | JGI24740J21852_10054616 | 3300001979 | Bacteria | 1127 |
| 6 | JGI24740J21852_10063904 | 3300001979 | Eukaryota | 1006 |
| 7 | JGI24739J22299_10007383 | 3300001989 | Bacteria | 4127 |
| 8 | JGI24737J22298_10000026 | 3300001990 | Bacteria | 43680 |
| 9 | JGI24737J22298_10011178 | 3300001990 | Bacteria | 2945 |
| 10 | JGI24735J21928_10000080 | 3300002067 | Bacteria | 37384 |
| 11 | JGI24735J21928_10000543 | 3300002067 | Bacteria | 13331 |
| 12 | JGI24738J21930_10001470 | 3300002075 | Bacteria | 6539 |
| 13 | rootH1_10015700 | 3300003316 | Bacteria | 38785 |
| 14 | rootH2_10000244 | 3300003320 | Bacteria | 697651 |
| 15 | rootH2_10241977 | 3300003320 | Bacteria | 3402 |
| 16 | rootL2_10153266 | 3300003322 | Bacteria | 3087 |
| 17 | rootH1_10199801 | 3300003323 | Bacteria | 2177 |
| 18 | rootH1_10231137 | 3300003323 | Bacteria | 4238 |
| 19 | rootH1_10268222 | 3300003323 | Unclassified | 1316 |
| 20 | Ga0065715_10002706 | 3300005293 | Bacteria | 4519 |
| 21 | Ga0070658_10000015 | 3300005327 | Bacteria | 230579 |
| 22 | Ga0070658_10000038 | 3300005327 | Bacteria | 137159 |
| 23 | Ga0070658_10000749 | 3300005327 | Bacteria | 27863 |
| 24 | Ga0070683_100000261 | 3300005329 | Bacteria | 36323 |
| 25 | Ga0070683_100357242 | 3300005329 | Bacteria | 1391 |
| 26 | Ga0070680_100006945 | 3300005336 | Bacteria | 8627 |
| 27 | Ga0070680_100488008 | 3300005336 | Bacteria | 1053 |
| 28 | Ga0070682_100008335 | 3300005337 | Bacteria | 5843 |
| 29 | Ga0070660_100000341 | 3300005339 | Bacteria | 31056 |
| 30 | Ga0070661_100020049 | 3300005344 | Bacteria | 4766 |
| 31 | Ga0070661_100249435 | 3300005344 | Bacteria | 1369 |
| 32 | Ga0070668_100050680 | 3300005347 | Bacteria | 3197 |
| 33 | Ga0070675_100249461 | 3300005354 | Bacteria | 1553 |
| 34 | Ga0070671_100000001 | 3300005355 | Bacteria | 1228151 |
| 35 | Ga0070671_100003481 | 3300005355 | Bacteria | 12283 |
| 36 | Ga0070659_100028334 | 3300005366 | Bacteria | 4324 |
| 37 | Ga0070678_100099056 | 3300005456 | Bacteria | 2255 |
| 38 | Ga0070679_100001253 | 3300005530 | Bacteria | 22393 |
| 39 | Ga0070684_100079257 | 3300005535 | Unclassified | 2903 |
| 40 | Ga0068855_100000003 | 3300005563 | Bacteria | 589862 |
| 41 | Ga0068855_100002961 | 3300005563 | Bacteria | 20765 |
| 42 | Ga0070664_100000073 | 3300005564 | Bacteria | 63531 |
| 43 | Ga0070664_100089447 | 3300005564 | Unclassified | 2664 |
| 44 | Ga0068857_100000345 | 3300005577 | Bacteria | 32052 |
| 45 | Ga0068857_100032867 | 3300005577 | Bacteria | 4586 |
| 46 | Ga0068857_100049651 | 3300005577 | Bacteria | 3722 |
| 47 | Ga0068856_100000016 | 3300005614 | Bacteria | 155667 |
| 48 | Ga0068856_100000059 | 3300005614 | Bacteria | 101763 |
| 49 | Ga0068856_100004358 | 3300005614 | Bacteria | 14102 |
| 50 | Ga0068852_100000001 | 3300005616 | Bacteria | 716526 |
| 51 | Ga0068852_100302174 | 3300005616 | Bacteria | 1549 |
| 52 | Ga0068851_10255940 | 3300005834 | Bacteria | 994 |
| 53 | Ga0068860_100314769 | 3300005843 | Bacteria | 1535 |
| 54 | Ga0075365_10000043 | 3300006038 | Bacteria | 41148 |
| 55 | Ga0075365_10002136 | 3300006038 | Bacteria | 9487 |
| 56 | Ga0075368_10000232 | 3300006042 | Bacteria | 15751 |
| 57 | Ga0075363_100000118 | 3300006048 | Bacteria | 18520 |
| 58 | Ga0075364_10001084 | 3300006051 | Bacteria | 14512 |
| 59 | Ga0075364_10003937 | 3300006051 | Bacteria | 8518 |
| 60 | Ga0075364_10006212 | 3300006051 | Bacteria | 7007 |
| 61 | Ga0075364_10034576 | 3300006051 | Bacteria | 3262 |
| 62 | Ga0075364_10116779 | 3300006051 | Unclassified | 1784 |
| 63 | Ga0075364_10189603 | 3300006051 | Unclassified | 1392 |
| 64 | Ga0075362_10000356 | 3300006177 | Bacteria | 13118 |
| 65 | Ga0075367_10000088 | 3300006178 | Bacteria | 24938 |
| 66 | Ga0075367_10000840 | 3300006178 | Bacteria | 12203 |
| 67 | Ga0075367_10122021 | 3300006178 | Bacteria | 1606 |
| 68 | Ga0075367_10150297 | 3300006178 | Bacteria | 1445 |
| 69 | Ga0075369_10000005 | 3300006186 | Bacteria | 147699 |
| 70 | Ga0075369_10000108 | 3300006186 | Bacteria | 22404 |
| 71 | Ga0075369_10053100 | 3300006186 | Bacteria | 1758 |
| 72 | Ga0075366_10000001 | 3300006195 | Bacteria | 569172 |
| 73 | Ga0075366_10000171 | 3300006195 | Bacteria | 27869 |
| 74 | Ga0075366_10000294 | 3300006195 | Bacteria | 22461 |
| 75 | Ga0075366_10000501 | 3300006195 | Bacteria | 18164 |
| 76 | Ga0075366_10016306 | 3300006195 | Bacteria | 4269 |
| 77 | Ga0097621_100000003 | 3300006237 | Bacteria | 164830 |
| 78 | Ga0097621_100000264 | 3300006237 | Bacteria | 35498 |
| 79 | Ga0075370_10005203 | 3300006353 | Bacteria | 6436 |
| 80 | Ga0068871_100000013 | 3300006358 | Bacteria | 102533 |
| 81 | Ga0068871_100001704 | 3300006358 | Bacteria | 14772 |
| 82 | Ga0068871_100058981 | 3300006358 | Unclassified | 3126 |
| 83 | Ga0068865_100003567 | 3300006881 | Bacteria | 9344 |
| 84 | Ga0075435_100434394 | 3300007076 | Unclassified | 1131 |
| 85 | Ga0105240_10000099 | 3300009093 | Bacteria | 177984 |
| 86 | Ga0105240_10013907 | 3300009093 | Bacteria | 11017 |
| 87 | Ga0105240_10111985 | 3300009093 | Bacteria | 3300 |
| 88 | Ga0105245_10000001 | 3300009098 | Bacteria | 939270 |
| 89 | Ga0105245_10000002 | 3300009098 | Bacteria | 634374 |
| 90 | Ga0105245_10247573 | 3300009098 | Bacteria | 1730 |
| 91 | Ga0105243_10003514 | 3300009148 | Bacteria | 12662 |
| 92 | Ga0105241_10000003 | 3300009174 | Bacteria | 839043 |
| 93 | Ga0105241_10012032 | 3300009174 | Bacteria | 6356 |
| 94 | Ga0105241_10031486 | 3300009174 | Bacteria | 3972 |
| 95 | Ga0105241_10070022 | 3300009174 | Bacteria | 2721 |
| 96 | Ga0105241_10076773 | 3300009174 | Bacteria | 2606 |
| 97 | Ga0105241_10182412 | 3300009174 | Bacteria | 1742 |
| 98 | Ga0105241_10321247 | 3300009174 | Bacteria | 1335 |
| 99 | Ga0105248_10230747 | 3300009177 | Bacteria | 2084 |
| 100 | Ga0105237_10000002 | 3300009545 | Bacteria | 702357 |
| 101 | Ga0105238_10009246 | 3300009551 | Bacteria | 9864 |
| 102 | Ga0105238_10249871 | 3300009551 | Bacteria | 1751 |
| 103 | Ga0105238_10450756 | 3300009551 | Bacteria | 1283 |
| 104 | Ga0105033_100300 | 3300009986 | Bacteria | 3890 |
| 105 | Ga0105030_101698 | 3300009987 | Unclassified | 1943 |
| 106 | Ga0105028_100313 | 3300009993 | Bacteria | 5247 |
| 107 | Ga0105239_10000261 | 3300010375 | Bacteria | 78396 |
| 108 | Ga0105239_10013216 | 3300010375 | Bacteria | 9174 |
| 109 | Ga0105239_10132379 | 3300010375 | Bacteria | 2775 |
| 110 | Ga0105246_10001397 | 3300011119 | Bacteria | 14274 |
| 111 | Ga0105246_10080867 | 3300011119 | Bacteria | 2314 |
| 112 | Ga0157373_10000042 | 3300013100 | Bacteria | 113564 |
| 113 | Ga0157373_10057630 | 3300013100 | Bacteria | 2755 |
| 114 | Ga0157373_10204493 | 3300013100 | Bacteria | 1392 |
| 115 | Ga0157373_10204496 | 3300013100 | Bacteria | 1392 |
| 116 | Ga0157371_10001081 | 3300013102 | Bacteria | 29510 |
| 117 | Ga0157371_10004252 | 3300013102 | Bacteria | 12592 |
| 118 | Ga0157371_10007770 | 3300013102 | Bacteria | 8620 |
| 119 | Ga0157370_10109326 | 3300013104 | Bacteria | 2585 |
| 120 | Ga0157370_10338059 | 3300013104 | Bacteria | 1388 |
| 121 | Ga0157370_10348972 | 3300013104 | Bacteria | 1364 |
| 122 | Ga0157369_10000945 | 3300013105 | Bacteria | 36893 |
| 123 | Ga0157369_10419353 | 3300013105 | Bacteria | 1388 |
| 124 | Ga0157369_10419376 | 3300013105 | Bacteria | 1388 |
| 125 | Ga0157374_10000031 | 3300013296 | Bacteria | 204840 |
| 126 | Ga0157374_10000945 | 3300013296 | Bacteria | 25227 |
| 127 | Ga0157374_10576265 | 3300013296 | Unclassified | 1134 |
| 128 | Ga0157372_10000086 | 3300013307 | Bacteria | 96247 |
| 129 | Ga0157372_10148251 | 3300013307 | Bacteria | 2706 |
| 130 | Ga0157372_10327542 | 3300013307 | Bacteria | 1783 |
| 131 | Ga0163163_10001150 | 3300014325 | Bacteria | 22476 |
| 132 | Ga0163163_10109812 | 3300014325 | Bacteria | 2786 |
| 133 | Ga0157380_10068022 | 3300014326 | Bacteria | 2870 |
| 134 | Ga0157377_10000557 | 3300014745 | Bacteria | 15651 |
| 135 | Ga0157377_10004608 | 3300014745 | Bacteria | 6372 |
| 136 | Ga0157379_10279005 | 3300014968 | Bacteria | 1520 |
| 137 | Ga0157376_10000190 | 3300014969 | Bacteria | 42751 |
| 138 | Ga0157376_10532095 | 3300014969 | Bacteria | 1160 |
| 139 | Ga0207647_10046065 | 3300025904 | Bacteria | 2718 |
| 140 | Ga0207705_10000011 | 3300025909 | Bacteria | 517768 |
| 141 | Ga0207705_10000051 | 3300025909 | Bacteria | 169369 |
| 142 | Ga0207705_10000805 | 3300025909 | Bacteria | 25778 |
| 143 | Ga0207654_10000002 | 3300025911 | Bacteria | 1460142 |
| 144 | Ga0207654_10026225 | 3300025911 | Unclassified | 3153 |
| 145 | Ga0207654_10119539 | 3300025911 | Bacteria | 1652 |
| 146 | Ga0207707_10573820 | 3300025912 | Bacteria | 957 |
| 147 | Ga0207695_10000980 | 3300025913 | Bacteria | 50757 |
| 148 | Ga0207695_10106201 | 3300025913 | Bacteria | 2794 |
| 149 | Ga0207695_10242238 | 3300025913 | Bacteria | 1704 |
| 150 | Ga0207671_10000008 | 3300025914 | Bacteria | 798229 |
| 151 | Ga0207660_10009430 | 3300025917 | Bacteria | 6318 |
| 152 | Ga0207660_10411625 | 3300025917 | Bacteria | 1090 |
| 153 | Ga0207657_10000931 | 3300025919 | Bacteria | 30961 |
| 154 | Ga0207657_10061216 | 3300025919 | Bacteria | 3228 |
| 155 | Ga0207649_10009471 | 3300025920 | Bacteria | 5330 |
| 156 | Ga0207649_10067692 | 3300025920 | Bacteria | 2268 |
| 157 | Ga0207652_10001646 | 3300025921 | Bacteria | 19604 |
| 158 | Ga0207694_10007470 | 3300025924 | Bacteria | 8286 |
| 159 | Ga0207687_10000001 | 3300025927 | Bacteria | 1130810 |
| 160 | Ga0207687_10000030 | 3300025927 | Bacteria | 155548 |
| 161 | Ga0207644_10000001 | 3300025931 | Bacteria | 1243214 |
| 162 | Ga0207644_10009496 | 3300025931 | Bacteria | 6389 |
| 163 | Ga0207690_10124027 | 3300025932 | Bacteria | 1880 |
| 164 | Ga0207706_10000634 | 3300025933 | Bacteria | 37289 |
| 165 | Ga0207709_10003739 | 3300025935 | Bacteria | 8955 |
| 166 | Ga0207704_10001903 | 3300025938 | Bacteria | 9351 |
| 167 | Ga0207711_10388432 | 3300025941 | Bacteria | 1296 |
| 168 | Ga0207661_10001940 | 3300025944 | Bacteria | 14232 |
| 169 | Ga0207661_10327831 | 3300025944 | Bacteria | 1377 |
| 170 | Ga0207679_10000175 | 3300025945 | Bacteria | 52871 |
| 171 | Ga0207667_10000008 | 3300025949 | Bacteria | 625138 |
| 172 | Ga0207667_10003050 | 3300025949 | Bacteria | 20784 |
| 173 | Ga0207702_10000015 | 3300026078 | Bacteria | 250830 |
| 174 | Ga0207702_10000123 | 3300026078 | Bacteria | 91295 |
| 175 | Ga0207702_10006432 | 3300026078 | Bacteria | 10135 |
| 176 | Ga0207674_10000423 | 3300026116 | Bacteria | 55089 |
| 177 | Ga0207674_10009669 | 3300026116 | Bacteria | 10993 |
| 178 | Ga0207674_10157000 | 3300026116 | Bacteria | 2230 |
| 179 | Ga0207683_10010516 | 3300026121 | Bacteria | 7895 |
| 180 | Ga0207698_10000001 | 3300026142 | Bacteria | 625389 |
| 181 | Ga0207698_10004517 | 3300026142 | Bacteria | 8488 |
| 182 | Ga0209813_10000004 | 3300027866 | Bacteria | 139340 |
| 183 | Ga0268264_10815494 | 3300028381 | Unclassified | 933 |
| 184 | Ga0265338_10037993 | 3300028800 | Bacteria | 4571 |
| 185 | Ga0265327_10002516 | 3300031251 | Bacteria | 19138 |
| 186 | Ga0265327_10032501 | 3300031251 | Bacteria | 2919 |
| 187 | Ga0307516_10000221 | 3300031730 | Bacteria | 73726 |
| 188 | Ga0307516_10182023 | 3300031730 | Bacteria | 1834 |
| 189 | Ga0307406_10000001 | 3300031901 | Bacteria | 638191 |
| 190 | Ga0307406_10001822 | 3300031901 | Bacteria | 11622 |
| 191 | Ga0395899_0009600 | 3300037312 | Bacteria | 7427 |
| 192 | Ga0395900_0000001 | 3300037418 | Bacteria | 931146 |
| 193 | Ga0395900_0000232 | 3300037418 | Bacteria | 87268 |
| 194 | Ga0395900_0001560 | 3300037418 | Bacteria | 27209 |
| 195 | Ga0395900_0036282 | 3300037418 | Bacteria | 5082 |
| 196 | Ga0395900_0096040 | 3300037418 | Bacteria | 3045 |
| 197 | Ga0395898_0000002 | 3300037466 | Bacteria | 931013 |
| 198 | Ga0395898_0017849 | 3300037466 | Bacteria | 7240 |
| 199 | Ga0395905_0067944 | 3300037471 | Bacteria | 3339 |
| 200 | Ga0395901_0000060 | 3300038443 | Bacteria | 152235 |
| 201 | Ga0395901_0035170 | 3300038443 | Bacteria | 5177 |
| 202 | Ga0395901_0641398 | 3300038443 | Bacteria | 1066 |
| 203 | Ga0439431_0024535 | 3300041997 | Bacteria | 1468 |
| 204 | Ga0439464_0000188 | 3300042439 | Bacteria | 10785 |
| 205 | Ga0466970_0289402 | 3300044765 | Unclassified | 922 |
| 206 | Ga0495582_0115695 | 3300046473 | Bacteria | 1508 |
| 207 | Ga0495585_0186324 | 3300046492 | Bacteria | 1064 |
| 208 | Ga0495583_0013343 | 3300046506 | Bacteria | 4587 |
| 209 | Ga0495622_0000035 | 3300046557 | Bacteria | 122963 |
| 210 | Ga0495588_0000116 | 3300046674 | Bacteria | 135919 |
| 211 | Ga0495658_0009320 | 3300046683 | Bacteria | 4889 |
| 212 | Ga0495649_0000073 | 3300046694 | Bacteria | 86337 |
| 213 | Ga0495660_0011390 | 3300046810 | Bacteria | 5164 |
| 214 | Ga0495672_0000129 | 3300047320 | Bacteria | 112879 |
| 215 | Ga0495672_0069515 | 3300047320 | Bacteria | 1999 |
| 216 | Ga0496105_0581023 | 3300048908 | Unclassified | 872 |
| 217 | Ga0496115_0000007 | 3300048918 | Bacteria | 244991 |
| 218 | Ga0496118_0023457 | 3300048921 | Bacteria | 5358 |
| 219 | Ga0496126_0054120 | 3300048929 | Bacteria | 3637 |
| 220 | Ga0501031_0000854 | 3300049568 | Bacteria | 18296 |
| 221 | Ga0501032_0002152 | 3300049569 | Bacteria | 15515 |
| 222 | Ga0501033_0131727 | 3300049570 | Bacteria | 1811 |
| 223 | Ga0501034_0001866 | 3300049571 | Bacteria | 26740 |
| 224 | Ga0501034_0002756 | 3300049571 | Bacteria | 20637 |
| 225 | Ga0501036_0008729 | 3300049572 | Bacteria | 8315 |
| 226 | Ga0501037_0000133 | 3300049573 | Bacteria | 69741 |
| 227 | Ga0501038_0002588 | 3300049574 | Bacteria | 16889 |
| 228 | Ga0501043_0000404 | 3300049579 | Bacteria | 38801 |
| 229 | Ga0501046_0000038 | 3300049580 | Bacteria | 159193 |
| 230 | Ga0501047_0001085 | 3300049581 | Bacteria | 27157 |
| 231 | Ga0501048_0000033 | 3300049582 | Bacteria | 64896 |
| 232 | Ga0501070_0026674 | 3300049586 | Bacteria | 4847 |
| 233 | Ga0501073_0035975 | 3300049589 | Bacteria | 3519 |
| 234 | Ga0501223_020426 | 3300049663 | Bacteria | 1298 |
| 235 | Ga0501083_0021447 | 3300049744 | Bacteria | 4490 |
| 236 | Ga0501035_0000562 | 3300049822 | Bacteria | 41104 |
| 237 | Ga0501044_0020781 | 3300049823 | Bacteria | 7007 |
| 238 | nmdc:mga03683_2294_c2 | 3300050489 | Bacteria | 4283 |
| 239 | nmdc:mga03683_360_c1 | 3300050489 | Bacteria | 13117 |
| 240 | nmdc:mga03n38_44_c1 | 3300050490 | Bacteria | 26398 |
| 241 | nmdc:mga00v17_13786_c1 | 3300050491 | Bacteria | 4494 |
| 242 | nmdc:mga00v17_244837_c1 | 3300050491 | Unclassified | 1163 |
| 243 | nmdc:mga00v17_3477_c1 | 3300050491 | Bacteria | 8155 |
| 244 | nmdc:mga00v17_624_c1 | 3300050491 | Bacteria | 14512 |
| 245 | nmdc:mga00v17_7088_c2 | 3300050491 | Bacteria | 2391 |
| 246 | nmdc:mga0yw44_208_c1 | 3300050492 | Bacteria | 20813 |
| 247 | nmdc:mga0yw44_2_c1 | 3300050492 | Bacteria | 586884 |
| 248 | nmdc:mga0yw44_405224_c1 | 3300050492 | Bacteria | 922 |
| 249 | nmdc:mga0yw44_50628_c1 | 3300050492 | Bacteria | 2512 |
| 250 | nmdc:mga0k408_13375_c1 | 3300050493 | Bacteria | 4499 |
| 251 | nmdc:mga0k408_17_c2 | 3300050493 | Bacteria | 97852 |
| 252 | nmdc:mga0k408_1_c1 | 3300050493 | Bacteria | 1089059 |
| 253 | nmdc:mga0k408_2058_c1 | 3300050493 | Bacteria | 10755 |
| 254 | nmdc:mga0k408_24_c2 | 3300050493 | Bacteria | 61722 |
| 255 | nmdc:mga0k408_6766_c1 | 3300050493 | Bacteria | 6114 |
| 256 | nmdc:mga06z11_100479_c1 | 3300050494 | Bacteria | 1586 |
| 257 | nmdc:mga06z11_14_c1 | 3300050494 | Bacteria | 96662 |
| 258 | nmdc:mga06z11_23173_c2 | 3300050494 | Bacteria | 2417 |
| 259 | nmdc:mga06z11_44_c1 | 3300050494 | Bacteria | 47967 |
| 260 | nmdc:mga04h51_154063_c1 | 3300050495 | Unclassified | 880 |
| 261 | nmdc:mga04h51_4_c1 | 3300050495 | Bacteria | 139342 |
| 262 | nmdc:mga07m45_10433_c1 | 3300050496 | Bacteria | 4853 |
| 263 | nmdc:mga0sz30_1_c1 | 3300050516 | Bacteria | 796501 |
| 264 | nmdc:mga0sz30_52851_c1 | 3300050516 | Bacteria | 1725 |
| 265 | nmdc:mga0sz30_68874_c1 | 3300050516 | Unclassified | 1521 |
| 266 | nmdc:mga0sz30_8_c2 | 3300050516 | Bacteria | 48225 |
| 267 | Ga0500610_0000001 | 3300053079 | Bacteria | 185468 |
| 268 | Ga0500610_0007632 | 3300053079 | Bacteria | 4647 |
| 269 | Ga0500643_000038 | 3300053087 | Bacteria | 178974 |
| 270 | Ga0500644_0000626 | 3300053088 | Bacteria | 13206 |
| 271 | Ga0500644_0000744 | 3300053088 | Bacteria | 11288 |
| 272 | Ga0500644_0019191 | 3300053088 | Bacteria | 2015 |
| 273 | Ga0500646_0057804 | 3300053090 | Bacteria | 1134 |
| 274 | Ga0500583_0000052 | 3300053092 | Bacteria | 75622 |
| 275 | Ga0500583_0017080 | 3300053092 | Bacteria | 2913 |
| 276 | Ga0500651_0000027 | 3300053093 | Bacteria | 116666 |
| 277 | Ga0500651_0052645 | 3300053093 | Bacteria | 2553 |
| 278 | Ga0500566_0000001 | 3300053094 | Bacteria | 1101031 |
| 279 | Ga0500555_000001 | 3300053103 | Bacteria | 1353713 |
| 280 | Ga0500555_000002 | 3300053103 | Bacteria | 1314346 |
| 281 | Ga0500555_040636 | 3300053103 | Bacteria | 1296 |
| 282 | Ga0500556_0000295 | 3300053104 | Bacteria | 38375 |
| 283 | Ga0500556_0025400 | 3300053104 | Bacteria | 1957 |
| 284 | Ga0500556_0164005 | 3300053104 | Unclassified | 877 |
| 285 | Ga0500562_000001 | 3300053108 | Bacteria | 1178987 |
| 286 | Ga0500562_000002 | 3300053108 | Bacteria | 977234 |
| 287 | Ga0500593_000001 | 3300053117 | Bacteria | 784404 |
| 288 | Ga0500594_0001392 | 3300053118 | Bacteria | 5248 |
| 289 | Ga0500614_000001 | 3300053123 | Bacteria | 1274484 |
| 290 | Ga0500621_116302 | 3300053126 | Bacteria | 1040 |
| 291 | Ga0500628_000012 | 3300053129 | Bacteria | 106556 |
| 292 | Ga0500652_000950 | 3300053131 | Bacteria | 9599 |
| 293 | Ga0500655_000440 | 3300053133 | Bacteria | 8511 |
| 294 | Ga0500655_005223 | 3300053133 | Unclassified | 2342 |
| 295 | Ga0500559_0060049 | 3300053136 | Unclassified | 1693 |
| 296 | Ga0500561_0000001 | 3300053137 | Bacteria | 957685 |
| 297 | Ga0500577_0000181 | 3300053142 | Bacteria | 16316 |
| 298 | Ga0500577_0002704 | 3300053142 | Bacteria | 4548 |
| 299 | Ga0500589_000016 | 3300053147 | Bacteria | 107090 |
| 300 | Ga0500589_030725 | 3300053147 | Bacteria | 2502 |
| 301 | Ga0500604_0027605 | 3300053151 | Bacteria | 1644 |
| 302 | Ga0500616_0000005 | 3300053153 | Bacteria | 961725 |
| 303 | Ga0500620_103805 | 3300053155 | Bacteria | 994 |
| 304 | Ga0500649_000013 | 3300053722 | Bacteria | 73694 |
| 305 | Ga0500570_000005 | 3300053724 | Bacteria | 132994 |
| 306 | Ga0500611_000497 | 3300053727 | Bacteria | 3985 |
| 307 | Ga0501082_0009636 | 3300060353 | Bacteria | 8315 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009098 | Ga0105245_10247573 | Ga0105245_102475731 | 230 |
| 2 | 3300003322 | rootL2_10153266 | rootL2_101532664 | 235 |
| 3 | 3300005339 | Ga0070660_100000341 | Ga0070660_1000003418 | 235 |
| 4 | 3300025919 | Ga0207657_10000931 | Ga0207657_100009318 | 235 |
| 5 | 3300053104 | Ga0500556_0164005 | Ga0500556_0164005_15_728 | 235 |
| 6 | 3300050495 | nmdc:mga04h51_154063_c1 | nmdc:mga04h51_154063_c1_64_834 | 248 |
| 7 | 3300053155 | Ga0500620_103805 | Ga0500620_103805_35_847 | 248 |
| 8 | 3300053151 | Ga0500604_0027605 | Ga0500604_0027605_648_1418 | 252 |
| 9 | 3300005843 | Ga0068860_100314769 | Ga0068860_1003147692 | 254 |
| 10 | 3300026121 | Ga0207683_10010516 | Ga0207683_100105162 | 254 |
| 11 | 3300047320 | Ga0495672_0069515 | Ga0495672_0069515_978_1784 | 254 |
| 12 | 3300053118 | Ga0500594_0001392 | Ga0500594_0001392_356_1159 | 254 |
| 13 | 3300053129 | Ga0500628_000012 | Ga0500628_000012_78941_79744 | 254 |
| 14 | 3300005563 | Ga0068855_100002961 | Ga0068855_10000296119 | 255 |
| 15 | 3300025949 | Ga0207667_10003050 | Ga0207667_100030506 | 255 |
| 16 | 3300046557 | Ga0495622_0000035 | Ga0495622_0000035_23_817 | 255 |
| 17 | 3300050516 | nmdc:mga0sz30_1_c1 | nmdc:mga0sz30_1_c1_255652_256467 | 255 |
| 18 | 3300053079 | Ga0500610_0007632 | Ga0500610_0007632_3701_4513 | 255 |
| 19 | 3300053092 | Ga0500583_0000052 | Ga0500583_0000052_27219_28031 | 255 |
| 20 | 3300053093 | Ga0500651_0052645 | Ga0500651_0052645_453_1265 | 255 |
| 21 | 3300053126 | Ga0500621_116302 | Ga0500621_116302_15_827 | 255 |
| 22 | 3300053147 | Ga0500589_000016 | Ga0500589_000016_84765_85577 | 255 |
| 23 | 3300028800 | Ga0265338_10037993 | Ga0265338_100379932 | 257 |
| 24 | 3300005336 | Ga0070680_100488008 | Ga0070680_1004880081 | 258 |
| 25 | 3300009098 | Ga0105245_10000001 | Ga0105245_10000001368 | 258 |
| 26 | 3300025917 | Ga0207660_10411625 | Ga0207660_104116252 | 258 |
| 27 | 3300025927 | Ga0207687_10000030 | Ga0207687_1000003071 | 258 |
| 28 | 3300037418 | Ga0395900_0036282 | Ga0395900_0036282_2841_3635 | 258 |
| 29 | 3300005563 | Ga0068855_100000003 | Ga0068855_100000003105 | 259 |
| 30 | 3300006051 | Ga0075364_10006212 | Ga0075364_100062127 | 259 |
| 31 | 3300006051 | Ga0075364_10116779 | Ga0075364_101167793 | 259 |
| 32 | 3300006178 | Ga0075367_10122021 | Ga0075367_101220212 | 259 |
| 33 | 3300009174 | Ga0105241_10000003 | Ga0105241_10000003197 | 259 |
| 34 | 3300013105 | Ga0157369_10000945 | Ga0157369_1000094523 | 259 |
| 35 | 3300014325 | Ga0163163_10001150 | Ga0163163_1000115018 | 259 |
| 36 | 3300025911 | Ga0207654_10000002 | Ga0207654_100000021012 | 259 |
| 37 | 3300025949 | Ga0207667_10000008 | Ga0207667_10000008104 | 259 |
| 38 | 3300031730 | Ga0307516_10182023 | Ga0307516_101820232 | 259 |
| 39 | 3300053088 | Ga0500644_0000626 | Ga0500644_0000626_9529_10326 | 259 |
| 40 | 3300049571 | Ga0501034_0001866 | Ga0501034_0001866_23462_24265 | 264 |
| 41 | 3300003320 | rootH2_10000244 | rootH2_10000244394 | 265 |
| 42 | 3300005564 | Ga0070664_100089447 | Ga0070664_1000894472 | 265 |
| 43 | 3300006237 | Ga0097621_100000003 | Ga0097621_10000000355 | 265 |
| 44 | 3300006358 | Ga0068871_100000013 | Ga0068871_10000001353 | 265 |
| 45 | 3300053153 | Ga0500616_0000005 | Ga0500616_0000005_367317_368123 | 265 |
| 46 | 3300001979 | JGI24740J21852_10054616 | JGI24740J21852_100546161 | 266 |
| 47 | 3300001979 | JGI24740J21852_10063904 | JGI24740J21852_100639042 | 266 |
| 48 | 3300001989 | JGI24739J22299_10007383 | JGI24739J22299_100073833 | 266 |
| 49 | 3300001990 | JGI24737J22298_10011178 | JGI24737J22298_100111783 | 266 |
| 50 | 3300002067 | JGI24735J21928_10000543 | JGI24735J21928_100005437 | 266 |
| 51 | 3300002075 | JGI24738J21930_10001470 | JGI24738J21930_100014705 | 266 |
| 52 | 3300005327 | Ga0070658_10000038 | Ga0070658_1000003888 | 266 |
| 53 | 3300005329 | Ga0070683_100357242 | Ga0070683_1003572421 | 266 |
| 54 | 3300005344 | Ga0070661_100020049 | Ga0070661_1000200494 | 266 |
| 55 | 3300005344 | Ga0070661_100249435 | Ga0070661_1002494351 | 266 |
| 56 | 3300005354 | Ga0070675_100249461 | Ga0070675_1002494611 | 266 |
| 57 | 3300005366 | Ga0070659_100028334 | Ga0070659_1000283341 | 266 |
| 58 | 3300005535 | Ga0070684_100079257 | Ga0070684_1000792571 | 266 |
| 59 | 3300005564 | Ga0070664_100000073 | Ga0070664_10000007329 | 266 |
| 60 | 3300005577 | Ga0068857_100000345 | Ga0068857_10000034510 | 266 |
| 61 | 3300005614 | Ga0068856_100000016 | Ga0068856_100000016116 | 266 |
| 62 | 3300005614 | Ga0068856_100000059 | Ga0068856_10000005966 | 266 |
| 63 | 3300005616 | Ga0068852_100302174 | Ga0068852_1003021742 | 266 |
| 64 | 3300006051 | Ga0075364_10003937 | Ga0075364_100039379 | 266 |
| 65 | 3300006186 | Ga0075369_10053100 | Ga0075369_100531001 | 266 |
| 66 | 3300006358 | Ga0068871_100058981 | Ga0068871_1000589811 | 266 |
| 67 | 3300006881 | Ga0068865_100003567 | Ga0068865_1000035677 | 266 |
| 68 | 3300009174 | Ga0105241_10012032 | Ga0105241_100120324 | 266 |
| 69 | 3300009174 | Ga0105241_10182412 | Ga0105241_101824122 | 266 |
| 70 | 3300009174 | Ga0105241_10321247 | Ga0105241_103212472 | 266 |
| 71 | 3300009551 | Ga0105238_10249871 | Ga0105238_102498712 | 266 |
| 72 | 3300010375 | Ga0105239_10000261 | Ga0105239_1000026129 | 266 |
| 73 | 3300011119 | Ga0105246_10001397 | Ga0105246_100013972 | 266 |
| 74 | 3300011119 | Ga0105246_10080867 | Ga0105246_100808672 | 266 |
| 75 | 3300013100 | Ga0157373_10057630 | Ga0157373_100576302 | 266 |
| 76 | 3300013100 | Ga0157373_10204493 | Ga0157373_102044931 | 266 |
| 77 | 3300013100 | Ga0157373_10204496 | Ga0157373_102044961 | 266 |
| 78 | 3300013102 | Ga0157371_10007770 | Ga0157371_100077704 | 266 |
| 79 | 3300013104 | Ga0157370_10338059 | Ga0157370_103380592 | 266 |
| 80 | 3300013104 | Ga0157370_10348972 | Ga0157370_103489721 | 266 |
| 81 | 3300013105 | Ga0157369_10419353 | Ga0157369_104193532 | 266 |
| 82 | 3300013105 | Ga0157369_10419376 | Ga0157369_104193762 | 266 |
| 83 | 3300013296 | Ga0157374_10576265 | Ga0157374_105762651 | 266 |
| 84 | 3300013307 | Ga0157372_10327542 | Ga0157372_103275423 | 266 |
| 85 | 3300014325 | Ga0163163_10109812 | Ga0163163_101098123 | 266 |
| 86 | 3300014745 | Ga0157377_10000557 | Ga0157377_100005572 | 266 |
| 87 | 3300014969 | Ga0157376_10000190 | Ga0157376_1000019040 | 266 |
| 88 | 3300014969 | Ga0157376_10532095 | Ga0157376_105320952 | 266 |
| 89 | 3300025904 | Ga0207647_10046065 | Ga0207647_100460653 | 266 |
| 90 | 3300025909 | Ga0207705_10000051 | Ga0207705_10000051102 | 266 |
| 91 | 3300025911 | Ga0207654_10026225 | Ga0207654_100262253 | 266 |
| 92 | 3300025911 | Ga0207654_10119539 | Ga0207654_101195392 | 266 |
| 93 | 3300025919 | Ga0207657_10061216 | Ga0207657_100612162 | 266 |
| 94 | 3300025920 | Ga0207649_10009471 | Ga0207649_100094714 | 266 |
| 95 | 3300025920 | Ga0207649_10067692 | Ga0207649_100676922 | 266 |
| 96 | 3300025932 | Ga0207690_10124027 | Ga0207690_101240272 | 266 |
| 97 | 3300025933 | Ga0207706_10000634 | Ga0207706_1000063415 | 266 |
| 98 | 3300025938 | Ga0207704_10001903 | Ga0207704_100019032 | 266 |
| 99 | 3300025944 | Ga0207661_10327831 | Ga0207661_103278311 | 266 |
| 100 | 3300025945 | Ga0207679_10000175 | Ga0207679_1000017528 | 266 |
| 101 | 3300026078 | Ga0207702_10000015 | Ga0207702_10000015233 | 266 |
| 102 | 3300026078 | Ga0207702_10000123 | Ga0207702_1000012315 | 266 |
| 103 | 3300026116 | Ga0207674_10000423 | Ga0207674_1000042332 | 266 |
| 104 | 3300026142 | Ga0207698_10004517 | Ga0207698_100045175 | 266 |
| 105 | 3300028381 | Ga0268264_10815494 | Ga0268264_108154941 | 266 |
| 106 | 3300037312 | Ga0395899_0009600 | Ga0395899_0009600_13_819 | 266 |
| 107 | 3300037418 | Ga0395900_0000001 | Ga0395900_0000001_135350_136156 | 266 |
| 108 | 3300037466 | Ga0395898_0000002 | Ga0395898_0000002_38964_39770 | 266 |
| 109 | 3300038443 | Ga0395901_0000060 | Ga0395901_0000060_101541_102347 | 266 |
| 110 | 3300042439 | Ga0439464_0000188 | Ga0439464_0000188_7198_8004 | 266 |
| 111 | 3300049663 | Ga0501223_020426 | Ga0501223_020426_386_1207 | 266 |
| 112 | 3300050491 | nmdc:mga00v17_3477_c1 | nmdc:mga00v17_3477_c1_2035_2841 | 266 |
| 113 | 3300050516 | nmdc:mga0sz30_52851_c1 | nmdc:mga0sz30_52851_c1_792_1598 | 266 |
| 114 | 3300003320 | rootH2_10241977 | rootH2_102419772 | 267 |
| 115 | 3300003323 | rootH1_10199801 | rootH1_101998012 | 267 |
| 116 | 3300003323 | rootH1_10231137 | rootH1_102311374 | 267 |
| 117 | 3300003323 | rootH1_10268222 | rootH1_102682221 | 267 |
| 118 | 3300005327 | Ga0070658_10000015 | Ga0070658_1000001558 | 267 |
| 119 | 3300005327 | Ga0070658_10000749 | Ga0070658_1000074932 | 267 |
| 120 | 3300005336 | Ga0070680_100006945 | Ga0070680_1000069454 | 267 |
| 121 | 3300005337 | Ga0070682_100008335 | Ga0070682_1000083355 | 267 |
| 122 | 3300005347 | Ga0070668_100050680 | Ga0070668_1000506802 | 267 |
| 123 | 3300005530 | Ga0070679_100001253 | Ga0070679_10000125320 | 267 |
| 124 | 3300006038 | Ga0075365_10002136 | Ga0075365_100021369 | 267 |
| 125 | 3300006051 | Ga0075364_10001084 | Ga0075364_100010846 | 267 |
| 126 | 3300006051 | Ga0075364_10034576 | Ga0075364_100345762 | 267 |
| 127 | 3300006177 | Ga0075362_10000356 | Ga0075362_100003565 | 267 |
| 128 | 3300006178 | Ga0075367_10150297 | Ga0075367_101502972 | 267 |
| 129 | 3300009093 | Ga0105240_10000099 | Ga0105240_10000099205 | 267 |
| 130 | 3300009148 | Ga0105243_10003514 | Ga0105243_100035148 | 267 |
| 131 | 3300010375 | Ga0105239_10132379 | Ga0105239_101323792 | 267 |
| 132 | 3300013102 | Ga0157371_10001081 | Ga0157371_100010819 | 267 |
| 133 | 3300013102 | Ga0157371_10004252 | Ga0157371_1000425213 | 267 |
| 134 | 3300013104 | Ga0157370_10109326 | Ga0157370_101093262 | 267 |
| 135 | 3300013307 | Ga0157372_10148251 | Ga0157372_101482513 | 267 |
| 136 | 3300025909 | Ga0207705_10000011 | Ga0207705_10000011287 | 267 |
| 137 | 3300025909 | Ga0207705_10000805 | Ga0207705_100008052 | 267 |
| 138 | 3300025912 | Ga0207707_10573820 | Ga0207707_105738201 | 267 |
| 139 | 3300025913 | Ga0207695_10000980 | Ga0207695_100009802 | 267 |
| 140 | 3300025917 | Ga0207660_10009430 | Ga0207660_100094306 | 267 |
| 141 | 3300025921 | Ga0207652_10001646 | Ga0207652_1000164611 | 267 |
| 142 | 3300025935 | Ga0207709_10003739 | Ga0207709_100037394 | 267 |
| 143 | 3300031251 | Ga0265327_10032501 | Ga0265327_100325012 | 267 |
| 144 | 3300031730 | Ga0307516_10000221 | Ga0307516_1000022153 | 267 |
| 145 | 3300037418 | Ga0395900_0000232 | Ga0395900_0000232_6401_7219 | 267 |
| 146 | 3300037418 | Ga0395900_0001560 | Ga0395900_0001560_12400_13227 | 267 |
| 147 | 3300037466 | Ga0395898_0017849 | Ga0395898_0017849_351_1178 | 267 |
| 148 | 3300037471 | Ga0395905_0067944 | Ga0395905_0067944_736_1563 | 267 |
| 149 | 3300038443 | Ga0395901_0035170 | Ga0395901_0035170_2638_3465 | 267 |
| 150 | 3300038443 | Ga0395901_0641398 | Ga0395901_0641398_55_873 | 267 |
| 151 | 3300041997 | Ga0439431_0024535 | Ga0439431_0024535_265_1080 | 267 |
| 152 | 3300044765 | Ga0466970_0289402 | Ga0466970_0289402_17_829 | 267 |
| 153 | 3300046506 | Ga0495583_0013343 | Ga0495583_0013343_3479_4294 | 267 |
| 154 | 3300046810 | Ga0495660_0011390 | Ga0495660_0011390_13_828 | 267 |
| 155 | 3300048908 | Ga0496105_0581023 | Ga0496105_0581023_10_828 | 267 |
| 156 | 3300048918 | Ga0496115_0000007 | Ga0496115_0000007_20486_21289 | 267 |
| 157 | 3300048921 | Ga0496118_0023457 | Ga0496118_0023457_3530_4345 | 267 |
| 158 | 3300049568 | Ga0501031_0000854 | Ga0501031_0000854_8699_9517 | 267 |
| 159 | 3300049569 | Ga0501032_0002152 | Ga0501032_0002152_3315_4133 | 267 |
| 160 | 3300049570 | Ga0501033_0131727 | Ga0501033_0131727_571_1389 | 267 |
| 161 | 3300049571 | Ga0501034_0002756 | Ga0501034_0002756_16211_17029 | 267 |
| 162 | 3300049572 | Ga0501036_0008729 | Ga0501036_0008729_1791_2609 | 267 |
| 163 | 3300049573 | Ga0501037_0000133 | Ga0501037_0000133_4868_5686 | 267 |
| 164 | 3300049574 | Ga0501038_0002588 | Ga0501038_0002588_10975_11793 | 267 |
| 165 | 3300049579 | Ga0501043_0000404 | Ga0501043_0000404_4037_4855 | 267 |
| 166 | 3300049580 | Ga0501046_0000038 | Ga0501046_0000038_144503_145321 | 267 |
| 167 | 3300049581 | Ga0501047_0001085 | Ga0501047_0001085_25249_26067 | 267 |
| 168 | 3300049582 | Ga0501048_0000033 | Ga0501048_0000033_19242_20060 | 267 |
| 169 | 3300049586 | Ga0501070_0026674 | Ga0501070_0026674_2813_3631 | 267 |
| 170 | 3300049589 | Ga0501073_0035975 | Ga0501073_0035975_1310_2128 | 267 |
| 171 | 3300049744 | Ga0501083_0021447 | Ga0501083_0021447_2539_3357 | 267 |
| 172 | 3300049822 | Ga0501035_0000562 | Ga0501035_0000562_7967_8785 | 267 |
| 173 | 3300049823 | Ga0501044_0020781 | Ga0501044_0020781_677_1495 | 267 |
| 174 | 3300050489 | nmdc:mga03683_360_c1 | nmdc:mga03683_360_c1_7504_8334 | 267 |
| 175 | 3300050491 | nmdc:mga00v17_13786_c1 | nmdc:mga00v17_13786_c1_1966_2778 | 267 |
| 176 | 3300050491 | nmdc:mga00v17_624_c1 | nmdc:mga00v17_624_c1_7681_8499 | 267 |
| 177 | 3300050492 | nmdc:mga0yw44_208_c1 | nmdc:mga0yw44_208_c1_12613_13431 | 267 |
| 178 | 3300050494 | nmdc:mga06z11_23173_c2 | nmdc:mga06z11_23173_c2_806_1624 | 267 |
| 179 | 3300053088 | Ga0500644_0019191 | Ga0500644_0019191_1023_1841 | 267 |
| 180 | 3300053090 | Ga0500646_0057804 | Ga0500646_0057804_188_1006 | 267 |
| 181 | 3300053093 | Ga0500651_0000027 | Ga0500651_0000027_23979_24791 | 267 |
| 182 | 3300053103 | Ga0500555_040636 | Ga0500555_040636_245_1060 | 267 |
| 183 | 3300053104 | Ga0500556_0000295 | Ga0500556_0000295_1090_1908 | 267 |
| 184 | 3300053104 | Ga0500556_0025400 | Ga0500556_0025400_633_1451 | 267 |
| 185 | 3300053108 | Ga0500562_000001 | Ga0500562_000001_265113_265928 | 267 |
| 186 | 3300053133 | Ga0500655_005223 | Ga0500655_005223_1110_1925 | 267 |
| 187 | 3300053142 | Ga0500577_0000181 | Ga0500577_0000181_13684_14496 | 267 |
| 188 | 3300060353 | Ga0501082_0009636 | Ga0501082_0009636_2795_3613 | 267 |
| 189 | 2162886012 | MBSR1b_contig_9233593 | MBSR1b_0833.00006270 | 268 |
| 190 | 3300001915 | JGI24741J21665_1002514 | JGI24741J21665_10025146 | 268 |
| 191 | 3300001915 | JGI24741J21665_1005304 | JGI24741J21665_10053042 | 268 |
| 192 | 3300001979 | JGI24740J21852_10017710 | JGI24740J21852_100177101 | 268 |
| 193 | 3300001990 | JGI24737J22298_10000026 | JGI24737J22298_1000002613 | 268 |
| 194 | 3300002067 | JGI24735J21928_10000080 | JGI24735J21928_1000008013 | 268 |
| 195 | 3300003316 | rootH1_10015700 | rootH1_100157003 | 268 |
| 196 | 3300005293 | Ga0065715_10002706 | Ga0065715_100027062 | 268 |
| 197 | 3300005329 | Ga0070683_100000261 | Ga0070683_10000026116 | 268 |
| 198 | 3300005355 | Ga0070671_100000001 | Ga0070671_100000001502 | 268 |
| 199 | 3300005355 | Ga0070671_100003481 | Ga0070671_1000034814 | 268 |
| 200 | 3300005456 | Ga0070678_100099056 | Ga0070678_1000990562 | 268 |
| 201 | 3300005577 | Ga0068857_100032867 | Ga0068857_1000328673 | 268 |
| 202 | 3300005577 | Ga0068857_100049651 | Ga0068857_1000496513 | 268 |
| 203 | 3300005614 | Ga0068856_100004358 | Ga0068856_1000043587 | 268 |
| 204 | 3300005616 | Ga0068852_100000001 | Ga0068852_100000001529 | 268 |
| 205 | 3300005834 | Ga0068851_10255940 | Ga0068851_102559401 | 268 |
| 206 | 3300006038 | Ga0075365_10000043 | Ga0075365_1000004324 | 268 |
| 207 | 3300006042 | Ga0075368_10000232 | Ga0075368_100002329 | 268 |
| 208 | 3300006048 | Ga0075363_100000118 | Ga0075363_1000001189 | 268 |
| 209 | 3300006051 | Ga0075364_10189603 | Ga0075364_101896032 | 268 |
| 210 | 3300006178 | Ga0075367_10000088 | Ga0075367_1000008813 | 268 |
| 211 | 3300006178 | Ga0075367_10000840 | Ga0075367_1000084011 | 268 |
| 212 | 3300006186 | Ga0075369_10000005 | Ga0075369_10000005104 | 268 |
| 213 | 3300006186 | Ga0075369_10000108 | Ga0075369_1000010814 | 268 |
| 214 | 3300006195 | Ga0075366_10000001 | Ga0075366_10000001412 | 268 |
| 215 | 3300006195 | Ga0075366_10000171 | Ga0075366_1000017120 | 268 |
| 216 | 3300006195 | Ga0075366_10000294 | Ga0075366_100002946 | 268 |
| 217 | 3300006195 | Ga0075366_10000501 | Ga0075366_1000050112 | 268 |
| 218 | 3300006195 | Ga0075366_10016306 | Ga0075366_100163062 | 268 |
| 219 | 3300006237 | Ga0097621_100000264 | Ga0097621_1000002643 | 268 |
| 220 | 3300006353 | Ga0075370_10005203 | Ga0075370_100052039 | 268 |
| 221 | 3300006358 | Ga0068871_100001704 | Ga0068871_1000017042 | 268 |
| 222 | 3300007076 | Ga0075435_100434394 | Ga0075435_1004343942 | 268 |
| 223 | 3300009093 | Ga0105240_10013907 | Ga0105240_100139072 | 268 |
| 224 | 3300009093 | Ga0105240_10111985 | Ga0105240_101119855 | 268 |
| 225 | 3300009098 | Ga0105245_10000002 | Ga0105245_10000002220 | 268 |
| 226 | 3300009174 | Ga0105241_10031486 | Ga0105241_100314863 | 268 |
| 227 | 3300009174 | Ga0105241_10070022 | Ga0105241_100700223 | 268 |
| 228 | 3300009174 | Ga0105241_10076773 | Ga0105241_100767735 | 268 |
| 229 | 3300009177 | Ga0105248_10230747 | Ga0105248_102307472 | 268 |
| 230 | 3300009545 | Ga0105237_10000002 | Ga0105237_10000002422 | 268 |
| 231 | 3300009551 | Ga0105238_10009246 | Ga0105238_1000924611 | 268 |
| 232 | 3300009551 | Ga0105238_10450756 | Ga0105238_104507562 | 268 |
| 233 | 3300009986 | Ga0105033_100300 | Ga0105033_1003002 | 268 |
| 234 | 3300009987 | Ga0105030_101698 | Ga0105030_1016981 | 268 |
| 235 | 3300009993 | Ga0105028_100313 | Ga0105028_1003135 | 268 |
| 236 | 3300010375 | Ga0105239_10013216 | Ga0105239_1001321610 | 268 |
| 237 | 3300013100 | Ga0157373_10000042 | Ga0157373_1000004256 | 268 |
| 238 | 3300013296 | Ga0157374_10000031 | Ga0157374_10000031152 | 268 |
| 239 | 3300013296 | Ga0157374_10000945 | Ga0157374_100009458 | 268 |
| 240 | 3300013307 | Ga0157372_10000086 | Ga0157372_1000008689 | 268 |
| 241 | 3300014326 | Ga0157380_10068022 | Ga0157380_100680223 | 268 |
| 242 | 3300014745 | Ga0157377_10004608 | Ga0157377_100046086 | 268 |
| 243 | 3300014968 | Ga0157379_10279005 | Ga0157379_102790051 | 268 |
| 244 | 3300025913 | Ga0207695_10106201 | Ga0207695_101062014 | 268 |
| 245 | 3300025913 | Ga0207695_10242238 | Ga0207695_102422382 | 268 |
| 246 | 3300025914 | Ga0207671_10000008 | Ga0207671_10000008527 | 268 |
| 247 | 3300025924 | Ga0207694_10007470 | Ga0207694_100074704 | 268 |
| 248 | 3300025927 | Ga0207687_10000001 | Ga0207687_10000001991 | 268 |
| 249 | 3300025931 | Ga0207644_10000001 | Ga0207644_10000001934 | 268 |
| 250 | 3300025931 | Ga0207644_10009496 | Ga0207644_100094969 | 268 |
| 251 | 3300025941 | Ga0207711_10388432 | Ga0207711_103884322 | 268 |
| 252 | 3300025944 | Ga0207661_10001940 | Ga0207661_100019405 | 268 |
| 253 | 3300026078 | Ga0207702_10006432 | Ga0207702_100064326 | 268 |
| 254 | 3300026116 | Ga0207674_10009669 | Ga0207674_100096697 | 268 |
| 255 | 3300026116 | Ga0207674_10157000 | Ga0207674_101570002 | 268 |
| 256 | 3300026142 | Ga0207698_10000001 | Ga0207698_10000001480 | 268 |
| 257 | 3300027866 | Ga0209813_10000004 | Ga0209813_10000004139 | 268 |
| 258 | 3300031251 | Ga0265327_10002516 | Ga0265327_100025169 | 268 |
| 259 | 3300031901 | Ga0307406_10000001 | Ga0307406_10000001141 | 268 |
| 260 | 3300031901 | Ga0307406_10001822 | Ga0307406_100018225 | 268 |
| 261 | 3300037418 | Ga0395900_0096040 | Ga0395900_0096040_1106_1936 | 268 |
| 262 | 3300046473 | Ga0495582_0115695 | Ga0495582_0115695_68_901 | 268 |
| 263 | 3300046492 | Ga0495585_0186324 | Ga0495585_0186324_75_902 | 268 |
| 264 | 3300046674 | Ga0495588_0000116 | Ga0495588_0000116_63453_64277 | 268 |
| 265 | 3300046683 | Ga0495658_0009320 | Ga0495658_0009320_934_1767 | 268 |
| 266 | 3300046694 | Ga0495649_0000073 | Ga0495649_0000073_67814_68638 | 268 |
| 267 | 3300047320 | Ga0495672_0000129 | Ga0495672_0000129_4466_5320 | 268 |
| 268 | 3300048929 | Ga0496126_0054120 | Ga0496126_0054120_705_1538 | 268 |
| 269 | 3300050489 | nmdc:mga03683_2294_c2 | nmdc:mga03683_2294_c2_3112_3945 | 268 |
| 270 | 3300050490 | nmdc:mga03n38_44_c1 | nmdc:mga03n38_44_c1_5028_5855 | 268 |
| 271 | 3300050491 | nmdc:mga00v17_244837_c1 | nmdc:mga00v17_244837_c1_132_965 | 268 |
| 272 | 3300050491 | nmdc:mga00v17_7088_c2 | nmdc:mga00v17_7088_c2_541_1365 | 268 |
| 273 | 3300050492 | nmdc:mga0yw44_2_c1 | nmdc:mga0yw44_2_c1_259951_260790 | 268 |
| 274 | 3300050492 | nmdc:mga0yw44_405224_c1 | nmdc:mga0yw44_405224_c1_38_880 | 268 |
| 275 | 3300050492 | nmdc:mga0yw44_50628_c1 | nmdc:mga0yw44_50628_c1_780_1604 | 268 |
| 276 | 3300050493 | nmdc:mga0k408_13375_c1 | nmdc:mga0k408_13375_c1_192_1013 | 268 |
| 277 | 3300050493 | nmdc:mga0k408_17_c2 | nmdc:mga0k408_17_c2_64843_65679 | 268 |
| 278 | 3300050493 | nmdc:mga0k408_1_c1 | nmdc:mga0k408_1_c1_705317_706147 | 268 |
| 279 | 3300050493 | nmdc:mga0k408_2058_c1 | nmdc:mga0k408_2058_c1_3757_4581 | 268 |
| 280 | 3300050493 | nmdc:mga0k408_24_c2 | nmdc:mga0k408_24_c2_12435_13259 | 268 |
| 281 | 3300050493 | nmdc:mga0k408_6766_c1 | nmdc:mga0k408_6766_c1_2768_3610 | 268 |
| 282 | 3300050494 | nmdc:mga06z11_100479_c1 | nmdc:mga06z11_100479_c1_157_990 | 268 |
| 283 | 3300050494 | nmdc:mga06z11_14_c1 | nmdc:mga06z11_14_c1_72427_73254 | 268 |
| 284 | 3300050494 | nmdc:mga06z11_44_c1 | nmdc:mga06z11_44_c1_3082_3906 | 268 |
| 285 | 3300050495 | nmdc:mga04h51_4_c1 | nmdc:mga04h51_4_c1_5134_5961 | 268 |
| 286 | 3300050496 | nmdc:mga07m45_10433_c1 | nmdc:mga07m45_10433_c1_716_1543 | 268 |
| 287 | 3300050516 | nmdc:mga0sz30_68874_c1 | nmdc:mga0sz30_68874_c1_455_1285 | 268 |
| 288 | 3300050516 | nmdc:mga0sz30_8_c2 | nmdc:mga0sz30_8_c2_35556_36386 | 268 |
| 289 | 3300053079 | Ga0500610_0000001 | Ga0500610_0000001_87325_88158 | 268 |
| 290 | 3300053087 | Ga0500643_000038 | Ga0500643_000038_99725_100573 | 268 |
| 291 | 3300053088 | Ga0500644_0000744 | Ga0500644_0000744_8856_9689 | 268 |
| 292 | 3300053092 | Ga0500583_0017080 | Ga0500583_0017080_1631_2479 | 268 |
| 293 | 3300053094 | Ga0500566_0000001 | Ga0500566_0000001_646305_647138 | 268 |
| 294 | 3300053103 | Ga0500555_000001 | Ga0500555_000001_740178_741020 | 268 |
| 295 | 3300053103 | Ga0500555_000002 | Ga0500555_000002_503945_504778 | 268 |
| 296 | 3300053108 | Ga0500562_000002 | Ga0500562_000002_891506_892336 | 268 |
| 297 | 3300053117 | Ga0500593_000001 | Ga0500593_000001_589121_589942 | 268 |
| 298 | 3300053123 | Ga0500614_000001 | Ga0500614_000001_263080_263904 | 268 |
| 299 | 3300053131 | Ga0500652_000950 | Ga0500652_000950_7165_7998 | 268 |
| 300 | 3300053133 | Ga0500655_000440 | Ga0500655_000440_5421_6227 | 268 |
| 301 | 3300053136 | Ga0500559_0060049 | Ga0500559_0060049_20_853 | 268 |
| 302 | 3300053137 | Ga0500561_0000001 | Ga0500561_0000001_569453_570292 | 268 |
| 303 | 3300053142 | Ga0500577_0002704 | Ga0500577_0002704_2926_3738 | 268 |
| 304 | 3300053147 | Ga0500589_030725 | Ga0500589_030725_358_1206 | 268 |
| 305 | 3300053722 | Ga0500649_000013 | Ga0500649_000013_10063_10887 | 268 |
| 306 | 3300053724 | Ga0500570_000005 | Ga0500570_000005_36129_36998 | 268 |
| 307 | 3300053727 | Ga0500611_000497 | Ga0500611_000497_1508_2356 | 268 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kho-assembly2.cif.gz_B | crystal structure analysis of clostridium perfringens alpha-toxin isolated from avian strain swcp | 0.6851 | 7 | 267 |
| 1kho-assembly2.cif.gz_B | crystal structure analysis of clostridium perfringens alpha-toxin isolated from avian strain swcp | 0.6269 | 7 | 267 |
| 1olp-assembly3.cif.gz_C | alpha toxin from clostridium absonum | 0.597 | 7 | 268 |
| 2wxu-assembly1.cif.gz_A | clostridium perfringens alpha-toxin strain nctc8237 mutant t74i | 0.5807 | 7 | 267 |
| 2wy6-assembly3.cif.gz_C | clostridium perfringens alpha-toxin strain nctc8237 mutant t74i | 0.5588 | 10 | 267 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q1L860_1_301_1.10.575.10 | Mainly Alpha;Orthogonal Bundle;P1 Nuclease;P1 Nuclease | 0.594 | 11 | 120 | 1.10.575.10 |
| af_A0A0G2KZ87_1_238_1.10.575.10 | Mainly Alpha;Orthogonal Bundle;P1 Nuclease;P1 Nuclease | 0.5224 | 21 | 120 | 1.10.575.10 |
| 1khoA01 | Mainly Alpha;Orthogonal Bundle;P1 Nuclease;P1 Nuclease | 0.5115 | 17 | 267 | 1.10.575.10 |
| 1khoA01 | Mainly Alpha;Orthogonal Bundle;P1 Nuclease;P1 Nuclease | 0.4726 | 17 | 267 | 1.10.575.10 |
| af_A4I5I0_31_303_1.10.575.10 | Mainly Alpha;Orthogonal Bundle;P1 Nuclease;P1 Nuclease | 0.4405 | 17 | 267 | 1.10.575.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0G4AWK8-F1-model_v4 | Phospholipase C/D domain-containing protein | 0.9746 | 18 | 267 |
GO:0016788
|
| AF-A0A7T9IPQ7-F1-model_v4 | deleted | 0.9598 | 18 | 267 |
|
| AF-A0A5C7J440-F1-model_v4 | Phospholipase C/D domain-containing protein | 0.9598 | 1 | 266 |
GO:0016788
|
| AF-A0A563C4W1-F1-model_v4 | Phospholipase C/D domain-containing protein | 0.9573 | 15 | 266 |
GO:0016788
|
| AF-A0A7T9K7J3-F1-model_v4 | deleted | 0.9559 | 34 | 266 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar