F399057

General Info

Members Datasets Scaffolds Average Seq Length
307 174 307 271

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100099056|Ga0070678_1000990562
Length 291
Sequence MYSGTTLTPLSGRVMGAHQKLDRLSRGALRVLLSEKDSKFPKMRQILHFEGVNGPDAIKRKSPAHDEPWHYYAPFDENDTQLVDLIGDHYDQLVKALKNEDDVRAAFEAAWLAHAIVDGLTPAHHYPYEEKLAELRGGAGLETRTSVKSKIVMPGASPAEKMSNNWKMWGPRGLLMSHGFFEFGIAFLIKPISARQVAVRPQHIAELQKYGMVELFRRKAKEVSAQGMYDYYQERGWTPRLAWRVRTKLVPAIVHTVALSWYAASIDAGIVPRPDNIASEPKPKHGAERQK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
54 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
55 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
106 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
115 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
139 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
143 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
144 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
145 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
146 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
147 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
148 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
149 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
150 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
151 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
152 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
153 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
154 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
155 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
156 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
157 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
158 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
159 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
160 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
161 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
162 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
163 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
164 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
165 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
166 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
167 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
168 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
171 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
172 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
173 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.62
Nodule 0
Rhizoplane 0.65
Rhizosphere 65.15
Stem 0
Stem Tuber 0
Unclassified 3.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_9233593 2162886012 Bacteria 1567
2 JGI24741J21665_1002514 3300001915 Bacteria 4738
3 JGI24741J21665_1005304 3300001915 Bacteria 2722
4 JGI24740J21852_10017710 3300001979 Unclassified 2541
5 JGI24740J21852_10054616 3300001979 Bacteria 1127
6 JGI24740J21852_10063904 3300001979 Eukaryota 1006
7 JGI24739J22299_10007383 3300001989 Bacteria 4127
8 JGI24737J22298_10000026 3300001990 Bacteria 43680
9 JGI24737J22298_10011178 3300001990 Bacteria 2945
10 JGI24735J21928_10000080 3300002067 Bacteria 37384
11 JGI24735J21928_10000543 3300002067 Bacteria 13331
12 JGI24738J21930_10001470 3300002075 Bacteria 6539
13 rootH1_10015700 3300003316 Bacteria 38785
14 rootH2_10000244 3300003320 Bacteria 697651
15 rootH2_10241977 3300003320 Bacteria 3402
16 rootL2_10153266 3300003322 Bacteria 3087
17 rootH1_10199801 3300003323 Bacteria 2177
18 rootH1_10231137 3300003323 Bacteria 4238
19 rootH1_10268222 3300003323 Unclassified 1316
20 Ga0065715_10002706 3300005293 Bacteria 4519
21 Ga0070658_10000015 3300005327 Bacteria 230579
22 Ga0070658_10000038 3300005327 Bacteria 137159
23 Ga0070658_10000749 3300005327 Bacteria 27863
24 Ga0070683_100000261 3300005329 Bacteria 36323
25 Ga0070683_100357242 3300005329 Bacteria 1391
26 Ga0070680_100006945 3300005336 Bacteria 8627
27 Ga0070680_100488008 3300005336 Bacteria 1053
28 Ga0070682_100008335 3300005337 Bacteria 5843
29 Ga0070660_100000341 3300005339 Bacteria 31056
30 Ga0070661_100020049 3300005344 Bacteria 4766
31 Ga0070661_100249435 3300005344 Bacteria 1369
32 Ga0070668_100050680 3300005347 Bacteria 3197
33 Ga0070675_100249461 3300005354 Bacteria 1553
34 Ga0070671_100000001 3300005355 Bacteria 1228151
35 Ga0070671_100003481 3300005355 Bacteria 12283
36 Ga0070659_100028334 3300005366 Bacteria 4324
37 Ga0070678_100099056 3300005456 Bacteria 2255
38 Ga0070679_100001253 3300005530 Bacteria 22393
39 Ga0070684_100079257 3300005535 Unclassified 2903
40 Ga0068855_100000003 3300005563 Bacteria 589862
41 Ga0068855_100002961 3300005563 Bacteria 20765
42 Ga0070664_100000073 3300005564 Bacteria 63531
43 Ga0070664_100089447 3300005564 Unclassified 2664
44 Ga0068857_100000345 3300005577 Bacteria 32052
45 Ga0068857_100032867 3300005577 Bacteria 4586
46 Ga0068857_100049651 3300005577 Bacteria 3722
47 Ga0068856_100000016 3300005614 Bacteria 155667
48 Ga0068856_100000059 3300005614 Bacteria 101763
49 Ga0068856_100004358 3300005614 Bacteria 14102
50 Ga0068852_100000001 3300005616 Bacteria 716526
51 Ga0068852_100302174 3300005616 Bacteria 1549
52 Ga0068851_10255940 3300005834 Bacteria 994
53 Ga0068860_100314769 3300005843 Bacteria 1535
54 Ga0075365_10000043 3300006038 Bacteria 41148
55 Ga0075365_10002136 3300006038 Bacteria 9487
56 Ga0075368_10000232 3300006042 Bacteria 15751
57 Ga0075363_100000118 3300006048 Bacteria 18520
58 Ga0075364_10001084 3300006051 Bacteria 14512
59 Ga0075364_10003937 3300006051 Bacteria 8518
60 Ga0075364_10006212 3300006051 Bacteria 7007
61 Ga0075364_10034576 3300006051 Bacteria 3262
62 Ga0075364_10116779 3300006051 Unclassified 1784
63 Ga0075364_10189603 3300006051 Unclassified 1392
64 Ga0075362_10000356 3300006177 Bacteria 13118
65 Ga0075367_10000088 3300006178 Bacteria 24938
66 Ga0075367_10000840 3300006178 Bacteria 12203
67 Ga0075367_10122021 3300006178 Bacteria 1606
68 Ga0075367_10150297 3300006178 Bacteria 1445
69 Ga0075369_10000005 3300006186 Bacteria 147699
70 Ga0075369_10000108 3300006186 Bacteria 22404
71 Ga0075369_10053100 3300006186 Bacteria 1758
72 Ga0075366_10000001 3300006195 Bacteria 569172
73 Ga0075366_10000171 3300006195 Bacteria 27869
74 Ga0075366_10000294 3300006195 Bacteria 22461
75 Ga0075366_10000501 3300006195 Bacteria 18164
76 Ga0075366_10016306 3300006195 Bacteria 4269
77 Ga0097621_100000003 3300006237 Bacteria 164830
78 Ga0097621_100000264 3300006237 Bacteria 35498
79 Ga0075370_10005203 3300006353 Bacteria 6436
80 Ga0068871_100000013 3300006358 Bacteria 102533
81 Ga0068871_100001704 3300006358 Bacteria 14772
82 Ga0068871_100058981 3300006358 Unclassified 3126
83 Ga0068865_100003567 3300006881 Bacteria 9344
84 Ga0075435_100434394 3300007076 Unclassified 1131
85 Ga0105240_10000099 3300009093 Bacteria 177984
86 Ga0105240_10013907 3300009093 Bacteria 11017
87 Ga0105240_10111985 3300009093 Bacteria 3300
88 Ga0105245_10000001 3300009098 Bacteria 939270
89 Ga0105245_10000002 3300009098 Bacteria 634374
90 Ga0105245_10247573 3300009098 Bacteria 1730
91 Ga0105243_10003514 3300009148 Bacteria 12662
92 Ga0105241_10000003 3300009174 Bacteria 839043
93 Ga0105241_10012032 3300009174 Bacteria 6356
94 Ga0105241_10031486 3300009174 Bacteria 3972
95 Ga0105241_10070022 3300009174 Bacteria 2721
96 Ga0105241_10076773 3300009174 Bacteria 2606
97 Ga0105241_10182412 3300009174 Bacteria 1742
98 Ga0105241_10321247 3300009174 Bacteria 1335
99 Ga0105248_10230747 3300009177 Bacteria 2084
100 Ga0105237_10000002 3300009545 Bacteria 702357
101 Ga0105238_10009246 3300009551 Bacteria 9864
102 Ga0105238_10249871 3300009551 Bacteria 1751
103 Ga0105238_10450756 3300009551 Bacteria 1283
104 Ga0105033_100300 3300009986 Bacteria 3890
105 Ga0105030_101698 3300009987 Unclassified 1943
106 Ga0105028_100313 3300009993 Bacteria 5247
107 Ga0105239_10000261 3300010375 Bacteria 78396
108 Ga0105239_10013216 3300010375 Bacteria 9174
109 Ga0105239_10132379 3300010375 Bacteria 2775
110 Ga0105246_10001397 3300011119 Bacteria 14274
111 Ga0105246_10080867 3300011119 Bacteria 2314
112 Ga0157373_10000042 3300013100 Bacteria 113564
113 Ga0157373_10057630 3300013100 Bacteria 2755
114 Ga0157373_10204493 3300013100 Bacteria 1392
115 Ga0157373_10204496 3300013100 Bacteria 1392
116 Ga0157371_10001081 3300013102 Bacteria 29510
117 Ga0157371_10004252 3300013102 Bacteria 12592
118 Ga0157371_10007770 3300013102 Bacteria 8620
119 Ga0157370_10109326 3300013104 Bacteria 2585
120 Ga0157370_10338059 3300013104 Bacteria 1388
121 Ga0157370_10348972 3300013104 Bacteria 1364
122 Ga0157369_10000945 3300013105 Bacteria 36893
123 Ga0157369_10419353 3300013105 Bacteria 1388
124 Ga0157369_10419376 3300013105 Bacteria 1388
125 Ga0157374_10000031 3300013296 Bacteria 204840
126 Ga0157374_10000945 3300013296 Bacteria 25227
127 Ga0157374_10576265 3300013296 Unclassified 1134
128 Ga0157372_10000086 3300013307 Bacteria 96247
129 Ga0157372_10148251 3300013307 Bacteria 2706
130 Ga0157372_10327542 3300013307 Bacteria 1783
131 Ga0163163_10001150 3300014325 Bacteria 22476
132 Ga0163163_10109812 3300014325 Bacteria 2786
133 Ga0157380_10068022 3300014326 Bacteria 2870
134 Ga0157377_10000557 3300014745 Bacteria 15651
135 Ga0157377_10004608 3300014745 Bacteria 6372
136 Ga0157379_10279005 3300014968 Bacteria 1520
137 Ga0157376_10000190 3300014969 Bacteria 42751
138 Ga0157376_10532095 3300014969 Bacteria 1160
139 Ga0207647_10046065 3300025904 Bacteria 2718
140 Ga0207705_10000011 3300025909 Bacteria 517768
141 Ga0207705_10000051 3300025909 Bacteria 169369
142 Ga0207705_10000805 3300025909 Bacteria 25778
143 Ga0207654_10000002 3300025911 Bacteria 1460142
144 Ga0207654_10026225 3300025911 Unclassified 3153
145 Ga0207654_10119539 3300025911 Bacteria 1652
146 Ga0207707_10573820 3300025912 Bacteria 957
147 Ga0207695_10000980 3300025913 Bacteria 50757
148 Ga0207695_10106201 3300025913 Bacteria 2794
149 Ga0207695_10242238 3300025913 Bacteria 1704
150 Ga0207671_10000008 3300025914 Bacteria 798229
151 Ga0207660_10009430 3300025917 Bacteria 6318
152 Ga0207660_10411625 3300025917 Bacteria 1090
153 Ga0207657_10000931 3300025919 Bacteria 30961
154 Ga0207657_10061216 3300025919 Bacteria 3228
155 Ga0207649_10009471 3300025920 Bacteria 5330
156 Ga0207649_10067692 3300025920 Bacteria 2268
157 Ga0207652_10001646 3300025921 Bacteria 19604
158 Ga0207694_10007470 3300025924 Bacteria 8286
159 Ga0207687_10000001 3300025927 Bacteria 1130810
160 Ga0207687_10000030 3300025927 Bacteria 155548
161 Ga0207644_10000001 3300025931 Bacteria 1243214
162 Ga0207644_10009496 3300025931 Bacteria 6389
163 Ga0207690_10124027 3300025932 Bacteria 1880
164 Ga0207706_10000634 3300025933 Bacteria 37289
165 Ga0207709_10003739 3300025935 Bacteria 8955
166 Ga0207704_10001903 3300025938 Bacteria 9351
167 Ga0207711_10388432 3300025941 Bacteria 1296
168 Ga0207661_10001940 3300025944 Bacteria 14232
169 Ga0207661_10327831 3300025944 Bacteria 1377
170 Ga0207679_10000175 3300025945 Bacteria 52871
171 Ga0207667_10000008 3300025949 Bacteria 625138
172 Ga0207667_10003050 3300025949 Bacteria 20784
173 Ga0207702_10000015 3300026078 Bacteria 250830
174 Ga0207702_10000123 3300026078 Bacteria 91295
175 Ga0207702_10006432 3300026078 Bacteria 10135
176 Ga0207674_10000423 3300026116 Bacteria 55089
177 Ga0207674_10009669 3300026116 Bacteria 10993
178 Ga0207674_10157000 3300026116 Bacteria 2230
179 Ga0207683_10010516 3300026121 Bacteria 7895
180 Ga0207698_10000001 3300026142 Bacteria 625389
181 Ga0207698_10004517 3300026142 Bacteria 8488
182 Ga0209813_10000004 3300027866 Bacteria 139340
183 Ga0268264_10815494 3300028381 Unclassified 933
184 Ga0265338_10037993 3300028800 Bacteria 4571
185 Ga0265327_10002516 3300031251 Bacteria 19138
186 Ga0265327_10032501 3300031251 Bacteria 2919
187 Ga0307516_10000221 3300031730 Bacteria 73726
188 Ga0307516_10182023 3300031730 Bacteria 1834
189 Ga0307406_10000001 3300031901 Bacteria 638191
190 Ga0307406_10001822 3300031901 Bacteria 11622
191 Ga0395899_0009600 3300037312 Bacteria 7427
192 Ga0395900_0000001 3300037418 Bacteria 931146
193 Ga0395900_0000232 3300037418 Bacteria 87268
194 Ga0395900_0001560 3300037418 Bacteria 27209
195 Ga0395900_0036282 3300037418 Bacteria 5082
196 Ga0395900_0096040 3300037418 Bacteria 3045
197 Ga0395898_0000002 3300037466 Bacteria 931013
198 Ga0395898_0017849 3300037466 Bacteria 7240
199 Ga0395905_0067944 3300037471 Bacteria 3339
200 Ga0395901_0000060 3300038443 Bacteria 152235
201 Ga0395901_0035170 3300038443 Bacteria 5177
202 Ga0395901_0641398 3300038443 Bacteria 1066
203 Ga0439431_0024535 3300041997 Bacteria 1468
204 Ga0439464_0000188 3300042439 Bacteria 10785
205 Ga0466970_0289402 3300044765 Unclassified 922
206 Ga0495582_0115695 3300046473 Bacteria 1508
207 Ga0495585_0186324 3300046492 Bacteria 1064
208 Ga0495583_0013343 3300046506 Bacteria 4587
209 Ga0495622_0000035 3300046557 Bacteria 122963
210 Ga0495588_0000116 3300046674 Bacteria 135919
211 Ga0495658_0009320 3300046683 Bacteria 4889
212 Ga0495649_0000073 3300046694 Bacteria 86337
213 Ga0495660_0011390 3300046810 Bacteria 5164
214 Ga0495672_0000129 3300047320 Bacteria 112879
215 Ga0495672_0069515 3300047320 Bacteria 1999
216 Ga0496105_0581023 3300048908 Unclassified 872
217 Ga0496115_0000007 3300048918 Bacteria 244991
218 Ga0496118_0023457 3300048921 Bacteria 5358
219 Ga0496126_0054120 3300048929 Bacteria 3637
220 Ga0501031_0000854 3300049568 Bacteria 18296
221 Ga0501032_0002152 3300049569 Bacteria 15515
222 Ga0501033_0131727 3300049570 Bacteria 1811
223 Ga0501034_0001866 3300049571 Bacteria 26740
224 Ga0501034_0002756 3300049571 Bacteria 20637
225 Ga0501036_0008729 3300049572 Bacteria 8315
226 Ga0501037_0000133 3300049573 Bacteria 69741
227 Ga0501038_0002588 3300049574 Bacteria 16889
228 Ga0501043_0000404 3300049579 Bacteria 38801
229 Ga0501046_0000038 3300049580 Bacteria 159193
230 Ga0501047_0001085 3300049581 Bacteria 27157
231 Ga0501048_0000033 3300049582 Bacteria 64896
232 Ga0501070_0026674 3300049586 Bacteria 4847
233 Ga0501073_0035975 3300049589 Bacteria 3519
234 Ga0501223_020426 3300049663 Bacteria 1298
235 Ga0501083_0021447 3300049744 Bacteria 4490
236 Ga0501035_0000562 3300049822 Bacteria 41104
237 Ga0501044_0020781 3300049823 Bacteria 7007
238 nmdc:mga03683_2294_c2 3300050489 Bacteria 4283
239 nmdc:mga03683_360_c1 3300050489 Bacteria 13117
240 nmdc:mga03n38_44_c1 3300050490 Bacteria 26398
241 nmdc:mga00v17_13786_c1 3300050491 Bacteria 4494
242 nmdc:mga00v17_244837_c1 3300050491 Unclassified 1163
243 nmdc:mga00v17_3477_c1 3300050491 Bacteria 8155
244 nmdc:mga00v17_624_c1 3300050491 Bacteria 14512
245 nmdc:mga00v17_7088_c2 3300050491 Bacteria 2391
246 nmdc:mga0yw44_208_c1 3300050492 Bacteria 20813
247 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
248 nmdc:mga0yw44_405224_c1 3300050492 Bacteria 922
249 nmdc:mga0yw44_50628_c1 3300050492 Bacteria 2512
250 nmdc:mga0k408_13375_c1 3300050493 Bacteria 4499
251 nmdc:mga0k408_17_c2 3300050493 Bacteria 97852
252 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
253 nmdc:mga0k408_2058_c1 3300050493 Bacteria 10755
254 nmdc:mga0k408_24_c2 3300050493 Bacteria 61722
255 nmdc:mga0k408_6766_c1 3300050493 Bacteria 6114
256 nmdc:mga06z11_100479_c1 3300050494 Bacteria 1586
257 nmdc:mga06z11_14_c1 3300050494 Bacteria 96662
258 nmdc:mga06z11_23173_c2 3300050494 Bacteria 2417
259 nmdc:mga06z11_44_c1 3300050494 Bacteria 47967
260 nmdc:mga04h51_154063_c1 3300050495 Unclassified 880
261 nmdc:mga04h51_4_c1 3300050495 Bacteria 139342
262 nmdc:mga07m45_10433_c1 3300050496 Bacteria 4853
263 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
264 nmdc:mga0sz30_52851_c1 3300050516 Bacteria 1725
265 nmdc:mga0sz30_68874_c1 3300050516 Unclassified 1521
266 nmdc:mga0sz30_8_c2 3300050516 Bacteria 48225
267 Ga0500610_0000001 3300053079 Bacteria 185468
268 Ga0500610_0007632 3300053079 Bacteria 4647
269 Ga0500643_000038 3300053087 Bacteria 178974
270 Ga0500644_0000626 3300053088 Bacteria 13206
271 Ga0500644_0000744 3300053088 Bacteria 11288
272 Ga0500644_0019191 3300053088 Bacteria 2015
273 Ga0500646_0057804 3300053090 Bacteria 1134
274 Ga0500583_0000052 3300053092 Bacteria 75622
275 Ga0500583_0017080 3300053092 Bacteria 2913
276 Ga0500651_0000027 3300053093 Bacteria 116666
277 Ga0500651_0052645 3300053093 Bacteria 2553
278 Ga0500566_0000001 3300053094 Bacteria 1101031
279 Ga0500555_000001 3300053103 Bacteria 1353713
280 Ga0500555_000002 3300053103 Bacteria 1314346
281 Ga0500555_040636 3300053103 Bacteria 1296
282 Ga0500556_0000295 3300053104 Bacteria 38375
283 Ga0500556_0025400 3300053104 Bacteria 1957
284 Ga0500556_0164005 3300053104 Unclassified 877
285 Ga0500562_000001 3300053108 Bacteria 1178987
286 Ga0500562_000002 3300053108 Bacteria 977234
287 Ga0500593_000001 3300053117 Bacteria 784404
288 Ga0500594_0001392 3300053118 Bacteria 5248
289 Ga0500614_000001 3300053123 Bacteria 1274484
290 Ga0500621_116302 3300053126 Bacteria 1040
291 Ga0500628_000012 3300053129 Bacteria 106556
292 Ga0500652_000950 3300053131 Bacteria 9599
293 Ga0500655_000440 3300053133 Bacteria 8511
294 Ga0500655_005223 3300053133 Unclassified 2342
295 Ga0500559_0060049 3300053136 Unclassified 1693
296 Ga0500561_0000001 3300053137 Bacteria 957685
297 Ga0500577_0000181 3300053142 Bacteria 16316
298 Ga0500577_0002704 3300053142 Bacteria 4548
299 Ga0500589_000016 3300053147 Bacteria 107090
300 Ga0500589_030725 3300053147 Bacteria 2502
301 Ga0500604_0027605 3300053151 Bacteria 1644
302 Ga0500616_0000005 3300053153 Bacteria 961725
303 Ga0500620_103805 3300053155 Bacteria 994
304 Ga0500649_000013 3300053722 Bacteria 73694
305 Ga0500570_000005 3300053724 Bacteria 132994
306 Ga0500611_000497 3300053727 Bacteria 3985
307 Ga0501082_0009636 3300060353 Bacteria 8315

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10247573 Ga0105245_102475731 230
2 3300003322 rootL2_10153266 rootL2_101532664 235
3 3300005339 Ga0070660_100000341 Ga0070660_1000003418 235
4 3300025919 Ga0207657_10000931 Ga0207657_100009318 235
5 3300053104 Ga0500556_0164005 Ga0500556_0164005_15_728 235
6 3300050495 nmdc:mga04h51_154063_c1 nmdc:mga04h51_154063_c1_64_834 248
7 3300053155 Ga0500620_103805 Ga0500620_103805_35_847 248
8 3300053151 Ga0500604_0027605 Ga0500604_0027605_648_1418 252
9 3300005843 Ga0068860_100314769 Ga0068860_1003147692 254
10 3300026121 Ga0207683_10010516 Ga0207683_100105162 254
11 3300047320 Ga0495672_0069515 Ga0495672_0069515_978_1784 254
12 3300053118 Ga0500594_0001392 Ga0500594_0001392_356_1159 254
13 3300053129 Ga0500628_000012 Ga0500628_000012_78941_79744 254
14 3300005563 Ga0068855_100002961 Ga0068855_10000296119 255
15 3300025949 Ga0207667_10003050 Ga0207667_100030506 255
16 3300046557 Ga0495622_0000035 Ga0495622_0000035_23_817 255
17 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_255652_256467 255
18 3300053079 Ga0500610_0007632 Ga0500610_0007632_3701_4513 255
19 3300053092 Ga0500583_0000052 Ga0500583_0000052_27219_28031 255
20 3300053093 Ga0500651_0052645 Ga0500651_0052645_453_1265 255
21 3300053126 Ga0500621_116302 Ga0500621_116302_15_827 255
22 3300053147 Ga0500589_000016 Ga0500589_000016_84765_85577 255
23 3300028800 Ga0265338_10037993 Ga0265338_100379932 257
24 3300005336 Ga0070680_100488008 Ga0070680_1004880081 258
25 3300009098 Ga0105245_10000001 Ga0105245_10000001368 258
26 3300025917 Ga0207660_10411625 Ga0207660_104116252 258
27 3300025927 Ga0207687_10000030 Ga0207687_1000003071 258
28 3300037418 Ga0395900_0036282 Ga0395900_0036282_2841_3635 258
29 3300005563 Ga0068855_100000003 Ga0068855_100000003105 259
30 3300006051 Ga0075364_10006212 Ga0075364_100062127 259
31 3300006051 Ga0075364_10116779 Ga0075364_101167793 259
32 3300006178 Ga0075367_10122021 Ga0075367_101220212 259
33 3300009174 Ga0105241_10000003 Ga0105241_10000003197 259
34 3300013105 Ga0157369_10000945 Ga0157369_1000094523 259
35 3300014325 Ga0163163_10001150 Ga0163163_1000115018 259
36 3300025911 Ga0207654_10000002 Ga0207654_100000021012 259
37 3300025949 Ga0207667_10000008 Ga0207667_10000008104 259
38 3300031730 Ga0307516_10182023 Ga0307516_101820232 259
39 3300053088 Ga0500644_0000626 Ga0500644_0000626_9529_10326 259
40 3300049571 Ga0501034_0001866 Ga0501034_0001866_23462_24265 264
41 3300003320 rootH2_10000244 rootH2_10000244394 265
42 3300005564 Ga0070664_100089447 Ga0070664_1000894472 265
43 3300006237 Ga0097621_100000003 Ga0097621_10000000355 265
44 3300006358 Ga0068871_100000013 Ga0068871_10000001353 265
45 3300053153 Ga0500616_0000005 Ga0500616_0000005_367317_368123 265
46 3300001979 JGI24740J21852_10054616 JGI24740J21852_100546161 266
47 3300001979 JGI24740J21852_10063904 JGI24740J21852_100639042 266
48 3300001989 JGI24739J22299_10007383 JGI24739J22299_100073833 266
49 3300001990 JGI24737J22298_10011178 JGI24737J22298_100111783 266
50 3300002067 JGI24735J21928_10000543 JGI24735J21928_100005437 266
51 3300002075 JGI24738J21930_10001470 JGI24738J21930_100014705 266
52 3300005327 Ga0070658_10000038 Ga0070658_1000003888 266
53 3300005329 Ga0070683_100357242 Ga0070683_1003572421 266
54 3300005344 Ga0070661_100020049 Ga0070661_1000200494 266
55 3300005344 Ga0070661_100249435 Ga0070661_1002494351 266
56 3300005354 Ga0070675_100249461 Ga0070675_1002494611 266
57 3300005366 Ga0070659_100028334 Ga0070659_1000283341 266
58 3300005535 Ga0070684_100079257 Ga0070684_1000792571 266
59 3300005564 Ga0070664_100000073 Ga0070664_10000007329 266
60 3300005577 Ga0068857_100000345 Ga0068857_10000034510 266
61 3300005614 Ga0068856_100000016 Ga0068856_100000016116 266
62 3300005614 Ga0068856_100000059 Ga0068856_10000005966 266
63 3300005616 Ga0068852_100302174 Ga0068852_1003021742 266
64 3300006051 Ga0075364_10003937 Ga0075364_100039379 266
65 3300006186 Ga0075369_10053100 Ga0075369_100531001 266
66 3300006358 Ga0068871_100058981 Ga0068871_1000589811 266
67 3300006881 Ga0068865_100003567 Ga0068865_1000035677 266
68 3300009174 Ga0105241_10012032 Ga0105241_100120324 266
69 3300009174 Ga0105241_10182412 Ga0105241_101824122 266
70 3300009174 Ga0105241_10321247 Ga0105241_103212472 266
71 3300009551 Ga0105238_10249871 Ga0105238_102498712 266
72 3300010375 Ga0105239_10000261 Ga0105239_1000026129 266
73 3300011119 Ga0105246_10001397 Ga0105246_100013972 266
74 3300011119 Ga0105246_10080867 Ga0105246_100808672 266
75 3300013100 Ga0157373_10057630 Ga0157373_100576302 266
76 3300013100 Ga0157373_10204493 Ga0157373_102044931 266
77 3300013100 Ga0157373_10204496 Ga0157373_102044961 266
78 3300013102 Ga0157371_10007770 Ga0157371_100077704 266
79 3300013104 Ga0157370_10338059 Ga0157370_103380592 266
80 3300013104 Ga0157370_10348972 Ga0157370_103489721 266
81 3300013105 Ga0157369_10419353 Ga0157369_104193532 266
82 3300013105 Ga0157369_10419376 Ga0157369_104193762 266
83 3300013296 Ga0157374_10576265 Ga0157374_105762651 266
84 3300013307 Ga0157372_10327542 Ga0157372_103275423 266
85 3300014325 Ga0163163_10109812 Ga0163163_101098123 266
86 3300014745 Ga0157377_10000557 Ga0157377_100005572 266
87 3300014969 Ga0157376_10000190 Ga0157376_1000019040 266
88 3300014969 Ga0157376_10532095 Ga0157376_105320952 266
89 3300025904 Ga0207647_10046065 Ga0207647_100460653 266
90 3300025909 Ga0207705_10000051 Ga0207705_10000051102 266
91 3300025911 Ga0207654_10026225 Ga0207654_100262253 266
92 3300025911 Ga0207654_10119539 Ga0207654_101195392 266
93 3300025919 Ga0207657_10061216 Ga0207657_100612162 266
94 3300025920 Ga0207649_10009471 Ga0207649_100094714 266
95 3300025920 Ga0207649_10067692 Ga0207649_100676922 266
96 3300025932 Ga0207690_10124027 Ga0207690_101240272 266
97 3300025933 Ga0207706_10000634 Ga0207706_1000063415 266
98 3300025938 Ga0207704_10001903 Ga0207704_100019032 266
99 3300025944 Ga0207661_10327831 Ga0207661_103278311 266
100 3300025945 Ga0207679_10000175 Ga0207679_1000017528 266
101 3300026078 Ga0207702_10000015 Ga0207702_10000015233 266
102 3300026078 Ga0207702_10000123 Ga0207702_1000012315 266
103 3300026116 Ga0207674_10000423 Ga0207674_1000042332 266
104 3300026142 Ga0207698_10004517 Ga0207698_100045175 266
105 3300028381 Ga0268264_10815494 Ga0268264_108154941 266
106 3300037312 Ga0395899_0009600 Ga0395899_0009600_13_819 266
107 3300037418 Ga0395900_0000001 Ga0395900_0000001_135350_136156 266
108 3300037466 Ga0395898_0000002 Ga0395898_0000002_38964_39770 266
109 3300038443 Ga0395901_0000060 Ga0395901_0000060_101541_102347 266
110 3300042439 Ga0439464_0000188 Ga0439464_0000188_7198_8004 266
111 3300049663 Ga0501223_020426 Ga0501223_020426_386_1207 266
112 3300050491 nmdc:mga00v17_3477_c1 nmdc:mga00v17_3477_c1_2035_2841 266
113 3300050516 nmdc:mga0sz30_52851_c1 nmdc:mga0sz30_52851_c1_792_1598 266
114 3300003320 rootH2_10241977 rootH2_102419772 267
115 3300003323 rootH1_10199801 rootH1_101998012 267
116 3300003323 rootH1_10231137 rootH1_102311374 267
117 3300003323 rootH1_10268222 rootH1_102682221 267
118 3300005327 Ga0070658_10000015 Ga0070658_1000001558 267
119 3300005327 Ga0070658_10000749 Ga0070658_1000074932 267
120 3300005336 Ga0070680_100006945 Ga0070680_1000069454 267
121 3300005337 Ga0070682_100008335 Ga0070682_1000083355 267
122 3300005347 Ga0070668_100050680 Ga0070668_1000506802 267
123 3300005530 Ga0070679_100001253 Ga0070679_10000125320 267
124 3300006038 Ga0075365_10002136 Ga0075365_100021369 267
125 3300006051 Ga0075364_10001084 Ga0075364_100010846 267
126 3300006051 Ga0075364_10034576 Ga0075364_100345762 267
127 3300006177 Ga0075362_10000356 Ga0075362_100003565 267
128 3300006178 Ga0075367_10150297 Ga0075367_101502972 267
129 3300009093 Ga0105240_10000099 Ga0105240_10000099205 267
130 3300009148 Ga0105243_10003514 Ga0105243_100035148 267
131 3300010375 Ga0105239_10132379 Ga0105239_101323792 267
132 3300013102 Ga0157371_10001081 Ga0157371_100010819 267
133 3300013102 Ga0157371_10004252 Ga0157371_1000425213 267
134 3300013104 Ga0157370_10109326 Ga0157370_101093262 267
135 3300013307 Ga0157372_10148251 Ga0157372_101482513 267
136 3300025909 Ga0207705_10000011 Ga0207705_10000011287 267
137 3300025909 Ga0207705_10000805 Ga0207705_100008052 267
138 3300025912 Ga0207707_10573820 Ga0207707_105738201 267
139 3300025913 Ga0207695_10000980 Ga0207695_100009802 267
140 3300025917 Ga0207660_10009430 Ga0207660_100094306 267
141 3300025921 Ga0207652_10001646 Ga0207652_1000164611 267
142 3300025935 Ga0207709_10003739 Ga0207709_100037394 267
143 3300031251 Ga0265327_10032501 Ga0265327_100325012 267
144 3300031730 Ga0307516_10000221 Ga0307516_1000022153 267
145 3300037418 Ga0395900_0000232 Ga0395900_0000232_6401_7219 267
146 3300037418 Ga0395900_0001560 Ga0395900_0001560_12400_13227 267
147 3300037466 Ga0395898_0017849 Ga0395898_0017849_351_1178 267
148 3300037471 Ga0395905_0067944 Ga0395905_0067944_736_1563 267
149 3300038443 Ga0395901_0035170 Ga0395901_0035170_2638_3465 267
150 3300038443 Ga0395901_0641398 Ga0395901_0641398_55_873 267
151 3300041997 Ga0439431_0024535 Ga0439431_0024535_265_1080 267
152 3300044765 Ga0466970_0289402 Ga0466970_0289402_17_829 267
153 3300046506 Ga0495583_0013343 Ga0495583_0013343_3479_4294 267
154 3300046810 Ga0495660_0011390 Ga0495660_0011390_13_828 267
155 3300048908 Ga0496105_0581023 Ga0496105_0581023_10_828 267
156 3300048918 Ga0496115_0000007 Ga0496115_0000007_20486_21289 267
157 3300048921 Ga0496118_0023457 Ga0496118_0023457_3530_4345 267
158 3300049568 Ga0501031_0000854 Ga0501031_0000854_8699_9517 267
159 3300049569 Ga0501032_0002152 Ga0501032_0002152_3315_4133 267
160 3300049570 Ga0501033_0131727 Ga0501033_0131727_571_1389 267
161 3300049571 Ga0501034_0002756 Ga0501034_0002756_16211_17029 267
162 3300049572 Ga0501036_0008729 Ga0501036_0008729_1791_2609 267
163 3300049573 Ga0501037_0000133 Ga0501037_0000133_4868_5686 267
164 3300049574 Ga0501038_0002588 Ga0501038_0002588_10975_11793 267
165 3300049579 Ga0501043_0000404 Ga0501043_0000404_4037_4855 267
166 3300049580 Ga0501046_0000038 Ga0501046_0000038_144503_145321 267
167 3300049581 Ga0501047_0001085 Ga0501047_0001085_25249_26067 267
168 3300049582 Ga0501048_0000033 Ga0501048_0000033_19242_20060 267
169 3300049586 Ga0501070_0026674 Ga0501070_0026674_2813_3631 267
170 3300049589 Ga0501073_0035975 Ga0501073_0035975_1310_2128 267
171 3300049744 Ga0501083_0021447 Ga0501083_0021447_2539_3357 267
172 3300049822 Ga0501035_0000562 Ga0501035_0000562_7967_8785 267
173 3300049823 Ga0501044_0020781 Ga0501044_0020781_677_1495 267
174 3300050489 nmdc:mga03683_360_c1 nmdc:mga03683_360_c1_7504_8334 267
175 3300050491 nmdc:mga00v17_13786_c1 nmdc:mga00v17_13786_c1_1966_2778 267
176 3300050491 nmdc:mga00v17_624_c1 nmdc:mga00v17_624_c1_7681_8499 267
177 3300050492 nmdc:mga0yw44_208_c1 nmdc:mga0yw44_208_c1_12613_13431 267
178 3300050494 nmdc:mga06z11_23173_c2 nmdc:mga06z11_23173_c2_806_1624 267
179 3300053088 Ga0500644_0019191 Ga0500644_0019191_1023_1841 267
180 3300053090 Ga0500646_0057804 Ga0500646_0057804_188_1006 267
181 3300053093 Ga0500651_0000027 Ga0500651_0000027_23979_24791 267
182 3300053103 Ga0500555_040636 Ga0500555_040636_245_1060 267
183 3300053104 Ga0500556_0000295 Ga0500556_0000295_1090_1908 267
184 3300053104 Ga0500556_0025400 Ga0500556_0025400_633_1451 267
185 3300053108 Ga0500562_000001 Ga0500562_000001_265113_265928 267
186 3300053133 Ga0500655_005223 Ga0500655_005223_1110_1925 267
187 3300053142 Ga0500577_0000181 Ga0500577_0000181_13684_14496 267
188 3300060353 Ga0501082_0009636 Ga0501082_0009636_2795_3613 267
189 2162886012 MBSR1b_contig_9233593 MBSR1b_0833.00006270 268
190 3300001915 JGI24741J21665_1002514 JGI24741J21665_10025146 268
191 3300001915 JGI24741J21665_1005304 JGI24741J21665_10053042 268
192 3300001979 JGI24740J21852_10017710 JGI24740J21852_100177101 268
193 3300001990 JGI24737J22298_10000026 JGI24737J22298_1000002613 268
194 3300002067 JGI24735J21928_10000080 JGI24735J21928_1000008013 268
195 3300003316 rootH1_10015700 rootH1_100157003 268
196 3300005293 Ga0065715_10002706 Ga0065715_100027062 268
197 3300005329 Ga0070683_100000261 Ga0070683_10000026116 268
198 3300005355 Ga0070671_100000001 Ga0070671_100000001502 268
199 3300005355 Ga0070671_100003481 Ga0070671_1000034814 268
200 3300005456 Ga0070678_100099056 Ga0070678_1000990562 268
201 3300005577 Ga0068857_100032867 Ga0068857_1000328673 268
202 3300005577 Ga0068857_100049651 Ga0068857_1000496513 268
203 3300005614 Ga0068856_100004358 Ga0068856_1000043587 268
204 3300005616 Ga0068852_100000001 Ga0068852_100000001529 268
205 3300005834 Ga0068851_10255940 Ga0068851_102559401 268
206 3300006038 Ga0075365_10000043 Ga0075365_1000004324 268
207 3300006042 Ga0075368_10000232 Ga0075368_100002329 268
208 3300006048 Ga0075363_100000118 Ga0075363_1000001189 268
209 3300006051 Ga0075364_10189603 Ga0075364_101896032 268
210 3300006178 Ga0075367_10000088 Ga0075367_1000008813 268
211 3300006178 Ga0075367_10000840 Ga0075367_1000084011 268
212 3300006186 Ga0075369_10000005 Ga0075369_10000005104 268
213 3300006186 Ga0075369_10000108 Ga0075369_1000010814 268
214 3300006195 Ga0075366_10000001 Ga0075366_10000001412 268
215 3300006195 Ga0075366_10000171 Ga0075366_1000017120 268
216 3300006195 Ga0075366_10000294 Ga0075366_100002946 268
217 3300006195 Ga0075366_10000501 Ga0075366_1000050112 268
218 3300006195 Ga0075366_10016306 Ga0075366_100163062 268
219 3300006237 Ga0097621_100000264 Ga0097621_1000002643 268
220 3300006353 Ga0075370_10005203 Ga0075370_100052039 268
221 3300006358 Ga0068871_100001704 Ga0068871_1000017042 268
222 3300007076 Ga0075435_100434394 Ga0075435_1004343942 268
223 3300009093 Ga0105240_10013907 Ga0105240_100139072 268
224 3300009093 Ga0105240_10111985 Ga0105240_101119855 268
225 3300009098 Ga0105245_10000002 Ga0105245_10000002220 268
226 3300009174 Ga0105241_10031486 Ga0105241_100314863 268
227 3300009174 Ga0105241_10070022 Ga0105241_100700223 268
228 3300009174 Ga0105241_10076773 Ga0105241_100767735 268
229 3300009177 Ga0105248_10230747 Ga0105248_102307472 268
230 3300009545 Ga0105237_10000002 Ga0105237_10000002422 268
231 3300009551 Ga0105238_10009246 Ga0105238_1000924611 268
232 3300009551 Ga0105238_10450756 Ga0105238_104507562 268
233 3300009986 Ga0105033_100300 Ga0105033_1003002 268
234 3300009987 Ga0105030_101698 Ga0105030_1016981 268
235 3300009993 Ga0105028_100313 Ga0105028_1003135 268
236 3300010375 Ga0105239_10013216 Ga0105239_1001321610 268
237 3300013100 Ga0157373_10000042 Ga0157373_1000004256 268
238 3300013296 Ga0157374_10000031 Ga0157374_10000031152 268
239 3300013296 Ga0157374_10000945 Ga0157374_100009458 268
240 3300013307 Ga0157372_10000086 Ga0157372_1000008689 268
241 3300014326 Ga0157380_10068022 Ga0157380_100680223 268
242 3300014745 Ga0157377_10004608 Ga0157377_100046086 268
243 3300014968 Ga0157379_10279005 Ga0157379_102790051 268
244 3300025913 Ga0207695_10106201 Ga0207695_101062014 268
245 3300025913 Ga0207695_10242238 Ga0207695_102422382 268
246 3300025914 Ga0207671_10000008 Ga0207671_10000008527 268
247 3300025924 Ga0207694_10007470 Ga0207694_100074704 268
248 3300025927 Ga0207687_10000001 Ga0207687_10000001991 268
249 3300025931 Ga0207644_10000001 Ga0207644_10000001934 268
250 3300025931 Ga0207644_10009496 Ga0207644_100094969 268
251 3300025941 Ga0207711_10388432 Ga0207711_103884322 268
252 3300025944 Ga0207661_10001940 Ga0207661_100019405 268
253 3300026078 Ga0207702_10006432 Ga0207702_100064326 268
254 3300026116 Ga0207674_10009669 Ga0207674_100096697 268
255 3300026116 Ga0207674_10157000 Ga0207674_101570002 268
256 3300026142 Ga0207698_10000001 Ga0207698_10000001480 268
257 3300027866 Ga0209813_10000004 Ga0209813_10000004139 268
258 3300031251 Ga0265327_10002516 Ga0265327_100025169 268
259 3300031901 Ga0307406_10000001 Ga0307406_10000001141 268
260 3300031901 Ga0307406_10001822 Ga0307406_100018225 268
261 3300037418 Ga0395900_0096040 Ga0395900_0096040_1106_1936 268
262 3300046473 Ga0495582_0115695 Ga0495582_0115695_68_901 268
263 3300046492 Ga0495585_0186324 Ga0495585_0186324_75_902 268
264 3300046674 Ga0495588_0000116 Ga0495588_0000116_63453_64277 268
265 3300046683 Ga0495658_0009320 Ga0495658_0009320_934_1767 268
266 3300046694 Ga0495649_0000073 Ga0495649_0000073_67814_68638 268
267 3300047320 Ga0495672_0000129 Ga0495672_0000129_4466_5320 268
268 3300048929 Ga0496126_0054120 Ga0496126_0054120_705_1538 268
269 3300050489 nmdc:mga03683_2294_c2 nmdc:mga03683_2294_c2_3112_3945 268
270 3300050490 nmdc:mga03n38_44_c1 nmdc:mga03n38_44_c1_5028_5855 268
271 3300050491 nmdc:mga00v17_244837_c1 nmdc:mga00v17_244837_c1_132_965 268
272 3300050491 nmdc:mga00v17_7088_c2 nmdc:mga00v17_7088_c2_541_1365 268
273 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_259951_260790 268
274 3300050492 nmdc:mga0yw44_405224_c1 nmdc:mga0yw44_405224_c1_38_880 268
275 3300050492 nmdc:mga0yw44_50628_c1 nmdc:mga0yw44_50628_c1_780_1604 268
276 3300050493 nmdc:mga0k408_13375_c1 nmdc:mga0k408_13375_c1_192_1013 268
277 3300050493 nmdc:mga0k408_17_c2 nmdc:mga0k408_17_c2_64843_65679 268
278 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_705317_706147 268
279 3300050493 nmdc:mga0k408_2058_c1 nmdc:mga0k408_2058_c1_3757_4581 268
280 3300050493 nmdc:mga0k408_24_c2 nmdc:mga0k408_24_c2_12435_13259 268
281 3300050493 nmdc:mga0k408_6766_c1 nmdc:mga0k408_6766_c1_2768_3610 268
282 3300050494 nmdc:mga06z11_100479_c1 nmdc:mga06z11_100479_c1_157_990 268
283 3300050494 nmdc:mga06z11_14_c1 nmdc:mga06z11_14_c1_72427_73254 268
284 3300050494 nmdc:mga06z11_44_c1 nmdc:mga06z11_44_c1_3082_3906 268
285 3300050495 nmdc:mga04h51_4_c1 nmdc:mga04h51_4_c1_5134_5961 268
286 3300050496 nmdc:mga07m45_10433_c1 nmdc:mga07m45_10433_c1_716_1543 268
287 3300050516 nmdc:mga0sz30_68874_c1 nmdc:mga0sz30_68874_c1_455_1285 268
288 3300050516 nmdc:mga0sz30_8_c2 nmdc:mga0sz30_8_c2_35556_36386 268
289 3300053079 Ga0500610_0000001 Ga0500610_0000001_87325_88158 268
290 3300053087 Ga0500643_000038 Ga0500643_000038_99725_100573 268
291 3300053088 Ga0500644_0000744 Ga0500644_0000744_8856_9689 268
292 3300053092 Ga0500583_0017080 Ga0500583_0017080_1631_2479 268
293 3300053094 Ga0500566_0000001 Ga0500566_0000001_646305_647138 268
294 3300053103 Ga0500555_000001 Ga0500555_000001_740178_741020 268
295 3300053103 Ga0500555_000002 Ga0500555_000002_503945_504778 268
296 3300053108 Ga0500562_000002 Ga0500562_000002_891506_892336 268
297 3300053117 Ga0500593_000001 Ga0500593_000001_589121_589942 268
298 3300053123 Ga0500614_000001 Ga0500614_000001_263080_263904 268
299 3300053131 Ga0500652_000950 Ga0500652_000950_7165_7998 268
300 3300053133 Ga0500655_000440 Ga0500655_000440_5421_6227 268
301 3300053136 Ga0500559_0060049 Ga0500559_0060049_20_853 268
302 3300053137 Ga0500561_0000001 Ga0500561_0000001_569453_570292 268
303 3300053142 Ga0500577_0002704 Ga0500577_0002704_2926_3738 268
304 3300053147 Ga0500589_030725 Ga0500589_030725_358_1206 268
305 3300053722 Ga0500649_000013 Ga0500649_000013_10063_10887 268
306 3300053724 Ga0500570_000005 Ga0500570_000005_36129_36998 268
307 3300053727 Ga0500611_000497 Ga0500611_000497_1508_2356 268

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kho-assembly2.cif.gz_B crystal structure analysis of clostridium perfringens alpha-toxin isolated from avian strain swcp 0.6851 7 267
1kho-assembly2.cif.gz_B crystal structure analysis of clostridium perfringens alpha-toxin isolated from avian strain swcp 0.6269 7 267
1olp-assembly3.cif.gz_C alpha toxin from clostridium absonum 0.597 7 268
2wxu-assembly1.cif.gz_A clostridium perfringens alpha-toxin strain nctc8237 mutant t74i 0.5807 7 267
2wy6-assembly3.cif.gz_C clostridium perfringens alpha-toxin strain nctc8237 mutant t74i 0.5588 10 267
ID Description Score Start End Superfamily
af_Q1L860_1_301_1.10.575.10 Mainly Alpha;Orthogonal Bundle;P1 Nuclease;P1 Nuclease 0.594 11 120 1.10.575.10
af_A0A0G2KZ87_1_238_1.10.575.10 Mainly Alpha;Orthogonal Bundle;P1 Nuclease;P1 Nuclease 0.5224 21 120 1.10.575.10
1khoA01 Mainly Alpha;Orthogonal Bundle;P1 Nuclease;P1 Nuclease 0.5115 17 267 1.10.575.10
1khoA01 Mainly Alpha;Orthogonal Bundle;P1 Nuclease;P1 Nuclease 0.4726 17 267 1.10.575.10
af_A4I5I0_31_303_1.10.575.10 Mainly Alpha;Orthogonal Bundle;P1 Nuclease;P1 Nuclease 0.4405 17 267 1.10.575.10
ID Description Score Start End GO Terms
AF-A0A0G4AWK8-F1-model_v4 Phospholipase C/D domain-containing protein 0.9746 18 267 GO:0016788
AF-A0A7T9IPQ7-F1-model_v4 deleted 0.9598 18 267
AF-A0A5C7J440-F1-model_v4 Phospholipase C/D domain-containing protein 0.9598 1 266 GO:0016788
AF-A0A563C4W1-F1-model_v4 Phospholipase C/D domain-containing protein 0.9573 15 266 GO:0016788
AF-A0A7T9K7J3-F1-model_v4 deleted 0.9559 34 266

Feature Viewer

pLDDT pTM Quality
86.72 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map