F398918
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 306 | 177 | 294 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300055283|Ga0500661_005435|Ga0500661_005435_283_1023 |
| Length | 246 |
| Sequence | MLLTVRKTAFFQNINKFDLQNPISADQNGVKNTFLKTKALLLPYSVILICALCIKITYTKEDIYFFINNLHFAAGDIVFPYLTELGNITTVAVLCLLLTFVSYKSSLLLLTSQIVTSLVNFPLKDLFLAPRPKLYFDGSIRPIYYVPNVEVLSNHFSFPSGHTVCAFTSALVLTYISPRRRYGYLYLIGALLVAYSRMYMSQHFFEDVTAGSFVAVTVTFLWLSWFNKRKFLQQDWWNRSLSKKTP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 3 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 4 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 5 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 6 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 7 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 8 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 9 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 10 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 11 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 12 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 13 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 16 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 19 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 21 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 73 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 75 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 76 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 115 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 116 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 117 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 118 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 119 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 120 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 121 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 122 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 123 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 124 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 125 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 126 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 127 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 128 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 129 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 130 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 131 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 132 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 133 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 161 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 162 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 163 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 164 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 165 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 166 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 167 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 168 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 169 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 170 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 171 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 172 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 173 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 174 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 175 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 176 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 177 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.77 |
| Metatranscriptomes | 1.31 |
| Isolates | 3.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.07 |
| Nodule | 0 |
| Rhizoplane | 0.33 |
| Rhizosphere | 77.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10031384 | 3300001979 | Bacteria | 1714 |
| 2 | JGI24737J22298_10000071 | 3300001990 | Bacteria | 29829 |
| 3 | JGI24737J22298_10056092 | 3300001990 | Bacteria | 1190 |
| 4 | JGI24743J22301_10043479 | 3300001991 | Unclassified | 905 |
| 5 | JGI24735J21928_10000013 | 3300002067 | Bacteria | 208663 |
| 6 | JGI24744J21845_10016587 | 3300002077 | Bacteria | 1466 |
| 7 | JGI25162J39368_1000107 | 3300002737 | Bacteria | 90782 |
| 8 | JGI25162J39368_1000615 | 3300002737 | Bacteria | 25611 |
| 9 | JGI25164J39214_1001761 | 3300002772 | Bacteria | 4263 |
| 10 | JGI25165J46597_1000157 | 3300003214 | Bacteria | 108987 |
| 11 | rootH1_10003553 | 3300003316 | Bacteria | 11129 |
| 12 | rootH1_10077670 | 3300003316 | Bacteria | 3161 |
| 13 | rootH2_10005336 | 3300003320 | Bacteria | 90063 |
| 14 | rootH2_10089997 | 3300003320 | Bacteria | 5681 |
| 15 | rootH2_10100104 | 3300003320 | Bacteria | 1959 |
| 16 | rootH2_10268268 | 3300003320 | Bacteria | 2077 |
| 17 | rootL2_10021199 | 3300003322 | Bacteria | 1518 |
| 18 | rootL2_10123764 | 3300003322 | Bacteria | 5674 |
| 19 | rootH1_10005851 | 3300003323 | Bacteria | 85811 |
| 20 | rootH1_10017654 | 3300003323 | Bacteria | 4324 |
| 21 | rootH1_10043200 | 3300003323 | Bacteria | 2234 |
| 22 | rootH1_10193575 | 3300003323 | Unclassified | 1456 |
| 23 | rootH1_10323207 | 3300003323 | Bacteria | 1898 |
| 24 | Ga0055535_1003443 | 3300003761 | Bacteria | 4490 |
| 25 | Ga0065165_1012934 | 3300005262 | Bacteria | 3355 |
| 26 | Ga0065714_10023151 | 3300005288 | Bacteria | 1021 |
| 27 | Ga0065714_10110354 | 3300005288 | Bacteria | 1487 |
| 28 | Ga0065714_10110659 | 3300005288 | Bacteria | 1482 |
| 29 | Ga0070658_10000014 | 3300005327 | Bacteria | 244978 |
| 30 | Ga0070658_10053216 | 3300005327 | Bacteria | 3285 |
| 31 | Ga0070676_10000729 | 3300005328 | Bacteria | 16102 |
| 32 | Ga0070660_100004154 | 3300005339 | Bacteria | 9997 |
| 33 | Ga0070660_100052135 | 3300005339 | Unclassified | 3153 |
| 34 | Ga0070675_100307288 | 3300005354 | Bacteria | 1398 |
| 35 | Ga0070671_100011944 | 3300005355 | Bacteria | 6987 |
| 36 | Ga0070674_100733756 | 3300005356 | Bacteria | 847 |
| 37 | Ga0070659_100000242 | 3300005366 | Bacteria | 42847 |
| 38 | Ga0070659_100138501 | 3300005366 | Bacteria | 1980 |
| 39 | Ga0070678_100015591 | 3300005456 | Bacteria | 4834 |
| 40 | Ga0070662_100000014 | 3300005457 | Bacteria | 110124 |
| 41 | Ga0070662_100062444 | 3300005457 | Unclassified | 2722 |
| 42 | Ga0068867_100001403 | 3300005459 | Bacteria | 16639 |
| 43 | Ga0070679_100015039 | 3300005530 | Bacteria | 7436 |
| 44 | Ga0068853_100003643 | 3300005539 | Bacteria | 11812 |
| 45 | Ga0068853_100074604 | 3300005539 | Bacteria | 2959 |
| 46 | Ga0068853_100122825 | 3300005539 | Bacteria | 2318 |
| 47 | Ga0070665_100000032 | 3300005548 | Bacteria | 333352 |
| 48 | Ga0068855_100000662 | 3300005563 | Bacteria | 42009 |
| 49 | Ga0068855_100044045 | 3300005563 | Bacteria | 5283 |
| 50 | Ga0068855_100115178 | 3300005563 | Bacteria | 3082 |
| 51 | Ga0068855_100999824 | 3300005563 | Bacteria | 879 |
| 52 | Ga0068854_100005184 | 3300005578 | Bacteria | 8217 |
| 53 | Ga0068856_100025316 | 3300005614 | Bacteria | 5785 |
| 54 | Ga0068856_100191627 | 3300005614 | Bacteria | 2058 |
| 55 | Ga0068852_100011199 | 3300005616 | Bacteria | 6738 |
| 56 | Ga0068863_100364415 | 3300005841 | Bacteria | 1409 |
| 57 | Ga0068858_100223676 | 3300005842 | Bacteria | 1783 |
| 58 | Ga0075366_10004640 | 3300006195 | Bacteria | 7382 |
| 59 | Ga0075366_10006004 | 3300006195 | Bacteria | 6617 |
| 60 | Ga0075366_10100269 | 3300006195 | Bacteria | 1738 |
| 61 | Ga0097621_100010173 | 3300006237 | Bacteria | 6867 |
| 62 | Ga0068871_100000306 | 3300006358 | Bacteria | 34178 |
| 63 | Ga0068865_100007153 | 3300006881 | Bacteria | 6853 |
| 64 | Ga0105240_10000010 | 3300009093 | Bacteria | 537830 |
| 65 | Ga0105240_10018922 | 3300009093 | Bacteria | 9223 |
| 66 | Ga0105240_10034933 | 3300009093 | Bacteria | 6482 |
| 67 | Ga0105240_10042668 | 3300009093 | Bacteria | 5779 |
| 68 | Ga0105240_10058849 | 3300009093 | Bacteria | 4797 |
| 69 | Ga0105240_10059864 | 3300009093 | Bacteria | 4751 |
| 70 | Ga0105240_10159809 | 3300009093 | Bacteria | 2677 |
| 71 | Ga0105240_10221296 | 3300009093 | Bacteria | 2205 |
| 72 | Ga0105240_10276746 | 3300009093 | Unclassified | 1930 |
| 73 | Ga0105240_11097073 | 3300009093 | Bacteria | 847 |
| 74 | Ga0105245_10800799 | 3300009098 | Bacteria | 980 |
| 75 | Ga0105243_10048091 | 3300009148 | Bacteria | 3361 |
| 76 | Ga0105241_10002362 | 3300009174 | Bacteria | 14177 |
| 77 | Ga0105241_10012557 | 3300009174 | Bacteria | 6213 |
| 78 | Ga0105241_10047228 | 3300009174 | Bacteria | 3273 |
| 79 | Ga0105241_10222825 | 3300009174 | Bacteria | 1586 |
| 80 | Ga0105237_10002429 | 3300009545 | Bacteria | 23143 |
| 81 | Ga0105237_10003264 | 3300009545 | Bacteria | 19375 |
| 82 | Ga0105237_10009567 | 3300009545 | Bacteria | 10376 |
| 83 | Ga0105237_10017775 | 3300009545 | Bacteria | 7372 |
| 84 | Ga0105237_10018280 | 3300009545 | Bacteria | 7254 |
| 85 | Ga0105237_10019775 | 3300009545 | Bacteria | 6952 |
| 86 | Ga0105237_10035203 | 3300009545 | Bacteria | 5068 |
| 87 | Ga0105237_10391806 | 3300009545 | Bacteria | 1394 |
| 88 | Ga0105237_10447778 | 3300009545 | Bacteria | 1297 |
| 89 | Ga0105238_10009925 | 3300009551 | Bacteria | 9546 |
| 90 | Ga0105238_10048865 | 3300009551 | Bacteria | 4262 |
| 91 | Ga0105238_10428218 | 3300009551 | Bacteria | 1319 |
| 92 | Ga0105239_10000001 | 3300010375 | Bacteria | 617353 |
| 93 | Ga0105239_10000007 | 3300010375 | Bacteria | 385297 |
| 94 | Ga0105239_10000212 | 3300010375 | Bacteria | 85747 |
| 95 | Ga0105239_10000352 | 3300010375 | Bacteria | 67522 |
| 96 | Ga0105239_10019157 | 3300010375 | Bacteria | 7561 |
| 97 | Ga0105239_10041432 | 3300010375 | Bacteria | 5047 |
| 98 | Ga0105239_10042526 | 3300010375 | Bacteria | 4979 |
| 99 | Ga0105239_10056316 | 3300010375 | Bacteria | 4313 |
| 100 | Ga0105239_10217225 | 3300010375 | Bacteria | 2144 |
| 101 | Ga0157373_10000881 | 3300013100 | Bacteria | 23243 |
| 102 | Ga0157373_10196817 | 3300013100 | Bacteria | 1421 |
| 103 | Ga0157371_10002946 | 3300013102 | Bacteria | 15852 |
| 104 | Ga0157371_10005024 | 3300013102 | Bacteria | 11332 |
| 105 | Ga0157371_10012339 | 3300013102 | Bacteria | 6538 |
| 106 | Ga0157370_10036373 | 3300013104 | Bacteria | 4778 |
| 107 | Ga0157370_10057969 | 3300013104 | Bacteria | 3681 |
| 108 | Ga0157370_10110972 | 3300013104 | Bacteria | 2564 |
| 109 | Ga0157370_10357504 | 3300013104 | Unclassified | 1346 |
| 110 | Ga0157369_10014221 | 3300013105 | Bacteria | 8990 |
| 111 | Ga0157369_10153439 | 3300013105 | Bacteria | 2434 |
| 112 | Ga0157369_10187024 | 3300013105 | Bacteria | 2178 |
| 113 | Ga0157374_10001060 | 3300013296 | Bacteria | 23873 |
| 114 | Ga0157374_10002738 | 3300013296 | Bacteria | 14800 |
| 115 | Ga0157374_10009161 | 3300013296 | Bacteria | 8485 |
| 116 | Ga0157374_10257279 | 3300013296 | Bacteria | 1719 |
| 117 | Ga0157374_10428607 | 3300013296 | Unclassified | 1322 |
| 118 | Ga0157378_10009516 | 3300013297 | Bacteria | 8462 |
| 119 | Ga0157378_10134718 | 3300013297 | Bacteria | 2289 |
| 120 | Ga0163162_10000010 | 3300013306 | Bacteria | 302032 |
| 121 | Ga0163162_10010391 | 3300013306 | Bacteria | 9047 |
| 122 | Ga0163162_10010995 | 3300013306 | Bacteria | 8815 |
| 123 | Ga0163162_10304285 | 3300013306 | Bacteria | 1726 |
| 124 | Ga0163162_11670198 | 3300013306 | Bacteria | 727 |
| 125 | Ga0157372_10000073 | 3300013307 | Bacteria | 107356 |
| 126 | Ga0157372_10000173 | 3300013307 | Bacteria | 71416 |
| 127 | Ga0157372_10002719 | 3300013307 | Bacteria | 19140 |
| 128 | Ga0157375_10011593 | 3300013308 | Bacteria | 7788 |
| 129 | Ga0157375_10031510 | 3300013308 | Bacteria | 5014 |
| 130 | Ga0157377_10011791 | 3300014745 | Bacteria | 4373 |
| 131 | Ga0157376_10331741 | 3300014969 | Bacteria | 1450 |
| 132 | Ga0182007_10098898 | 3300015262 | Unclassified | 965 |
| 133 | Ga0182005_1000371 | 3300015265 | Bacteria | 24821 |
| 134 | Ga0163161_10024612 | 3300017792 | Bacteria | 4254 |
| 135 | Ga0206355_1025687 | 3300020076 | Bacteria | 1538 |
| 136 | Ga0206351_10763673 | 3300020077 | Bacteria | 1818 |
| 137 | Ga0154015_1180645 | 3300020610 | Bacteria | 1921 |
| 138 | Ga0213872_10008537 | 3300021361 | Bacteria | 4954 |
| 139 | Ga0224712_10063924 | 3300022467 | Bacteria | 1475 |
| 140 | Ga0209436_101755 | 3300025208 | Bacteria | 7118 |
| 141 | Ga0209563_112929 | 3300025230 | Bacteria | 1121 |
| 142 | Ga0207427_100025 | 3300025231 | Bacteria | 433726 |
| 143 | Ga0209437_100010 | 3300025233 | Bacteria | 838447 |
| 144 | Ga0209437_100148 | 3300025233 | Bacteria | 158795 |
| 145 | Ga0209258_100098 | 3300025242 | Bacteria | 215216 |
| 146 | Ga0209148_1000120 | 3300025254 | Bacteria | 186836 |
| 147 | Ga0209129_1008736 | 3300025258 | Bacteria | 2772 |
| 148 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 149 | Ga0209233_1009172 | 3300025261 | Bacteria | 3024 |
| 150 | Ga0209455_1006632 | 3300025272 | Bacteria | 3393 |
| 151 | Ga0209758_1031512 | 3300025297 | Bacteria | 2173 |
| 152 | Ga0207426_1005661 | 3300025302 | Bacteria | 5645 |
| 153 | Ga0207647_10000680 | 3300025904 | Bacteria | 26722 |
| 154 | Ga0207647_10005778 | 3300025904 | Bacteria | 9026 |
| 155 | Ga0207645_10000591 | 3300025907 | Bacteria | 30054 |
| 156 | Ga0207705_10000107 | 3300025909 | Bacteria | 94984 |
| 157 | Ga0207705_10077312 | 3300025909 | Unclassified | 2421 |
| 158 | Ga0207705_10128354 | 3300025909 | Bacteria | 1886 |
| 159 | Ga0207654_10032090 | 3300025911 | Bacteria | 2898 |
| 160 | Ga0207707_10119043 | 3300025912 | Unclassified | 2308 |
| 161 | Ga0207695_10000019 | 3300025913 | Bacteria | 732137 |
| 162 | Ga0207695_10039525 | 3300025913 | Bacteria | 5070 |
| 163 | Ga0207695_10101889 | 3300025913 | Bacteria | 2865 |
| 164 | Ga0207695_10138742 | 3300025913 | Bacteria | 2382 |
| 165 | Ga0207695_10177055 | 3300025913 | Unclassified | 2055 |
| 166 | Ga0207695_10649054 | 3300025913 | Bacteria | 936 |
| 167 | Ga0207671_10002702 | 3300025914 | Bacteria | 18606 |
| 168 | Ga0207671_10003542 | 3300025914 | Bacteria | 15486 |
| 169 | Ga0207671_10007187 | 3300025914 | Bacteria | 9704 |
| 170 | Ga0207671_10010478 | 3300025914 | Bacteria | 7643 |
| 171 | Ga0207671_10021139 | 3300025914 | Bacteria | 4942 |
| 172 | Ga0207657_10029807 | 3300025919 | Bacteria | 4961 |
| 173 | Ga0207657_10233450 | 3300025919 | Bacteria | 1471 |
| 174 | Ga0207652_10006186 | 3300025921 | Bacteria | 9672 |
| 175 | Ga0207652_10072004 | 3300025921 | Bacteria | 3004 |
| 176 | Ga0207694_10018923 | 3300025924 | Bacteria | 5206 |
| 177 | Ga0207694_10301820 | 3300025924 | Bacteria | 1319 |
| 178 | Ga0207644_10018029 | 3300025931 | Bacteria | 4772 |
| 179 | Ga0207690_10000272 | 3300025932 | Bacteria | 36902 |
| 180 | Ga0207690_10108403 | 3300025932 | Bacteria | 1996 |
| 181 | Ga0207706_10000057 | 3300025933 | Bacteria | 112805 |
| 182 | Ga0207686_10366518 | 3300025934 | Bacteria | 1089 |
| 183 | Ga0207669_10732026 | 3300025937 | Bacteria | 815 |
| 184 | Ga0207704_10000266 | 3300025938 | Bacteria | 25142 |
| 185 | Ga0207667_10002856 | 3300025949 | Bacteria | 21432 |
| 186 | Ga0207667_10054548 | 3300025949 | Bacteria | 4204 |
| 187 | Ga0207667_10104675 | 3300025949 | Bacteria | 2919 |
| 188 | Ga0207667_10582703 | 3300025949 | Bacteria | 1129 |
| 189 | Ga0207651_10096595 | 3300025960 | Bacteria | 2179 |
| 190 | Ga0207640_10005183 | 3300025981 | Bacteria | 7090 |
| 191 | Ga0207639_10032979 | 3300026041 | Bacteria | 3817 |
| 192 | Ga0207639_10053759 | 3300026041 | Bacteria | 3074 |
| 193 | Ga0207702_10109031 | 3300026078 | Bacteria | 2458 |
| 194 | Ga0207648_10005635 | 3300026089 | Bacteria | 12581 |
| 195 | Ga0207674_10269625 | 3300026116 | Bacteria | 1650 |
| 196 | Ga0207683_10008342 | 3300026121 | Bacteria | 8861 |
| 197 | Ga0207698_10079738 | 3300026142 | Bacteria | 2634 |
| 198 | Ga0268266_10000030 | 3300028379 | Bacteria | 417120 |
| 199 | Ga0307517_10001373 | 3300028786 | Bacteria | 40930 |
| 200 | Ga0307515_10000376 | 3300028794 | Bacteria | 109190 |
| 201 | Ga0307515_10005206 | 3300028794 | Bacteria | 26435 |
| 202 | Ga0307515_10104050 | 3300028794 | Bacteria | 3397 |
| 203 | Ga0307515_10176904 | 3300028794 | Bacteria | 2101 |
| 204 | Ga0307512_10185342 | 3300030522 | Bacteria | 1160 |
| 205 | Ga0307507_10000032 | 3300033179 | Bacteria | 194155 |
| 206 | Ga0307510_10010205 | 3300033180 | Bacteria | 11166 |
| 207 | Ga0373941_0087668 | 3300035115 | Bacteria | 1062 |
| 208 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 209 | Ga0395899_0000887 | 3300037312 | Bacteria | 28407 |
| 210 | Ga0395899_0007044 | 3300037312 | Bacteria | 8701 |
| 211 | Ga0395899_0022353 | 3300037312 | Bacteria | 4796 |
| 212 | Ga0395900_0000143 | 3300037418 | Bacteria | 120234 |
| 213 | Ga0395900_0010532 | 3300037418 | Bacteria | 9458 |
| 214 | Ga0395900_0109690 | 3300037418 | Bacteria | 2835 |
| 215 | Ga0395898_0070858 | 3300037466 | Bacteria | 3369 |
| 216 | Ga0395905_0000175 | 3300037471 | Bacteria | 104024 |
| 217 | Ga0395905_0002359 | 3300037471 | Bacteria | 21041 |
| 218 | Ga0395901_0000313 | 3300038443 | Bacteria | 59766 |
| 219 | Ga0395901_0024555 | 3300038443 | Bacteria | 6189 |
| 220 | Ga0395901_0150469 | 3300038443 | Bacteria | 2446 |
| 221 | Ga0436361_0924736 | 3300039447 | Bacteria | 22942 |
| 222 | Ga0439448_0001918 | 3300042005 | Bacteria | 5538 |
| 223 | Ga0466969_0056993 | 3300044656 | Bacteria | 1906 |
| 224 | Ga0466966_0013641 | 3300044684 | Bacteria | 5376 |
| 225 | Ga0466961_0397903 | 3300044693 | Unclassified | 836 |
| 226 | Ga0466970_0233450 | 3300044765 | Unclassified | 1028 |
| 227 | Ga0466959_0036512 | 3300045049 | Bacteria | 3632 |
| 228 | Ga0466959_0045498 | 3300045049 | Bacteria | 3232 |
| 229 | Ga0466959_0435701 | 3300045049 | Bacteria | 889 |
| 230 | Ga0466958_0017493 | 3300045836 | Bacteria | 4146 |
| 231 | Ga0495627_008925 | 3300046453 | Bacteria | 3711 |
| 232 | Ga0495651_0097231 | 3300046462 | Bacteria | 2199 |
| 233 | Ga0495650_0000162 | 3300046471 | Bacteria | 148927 |
| 234 | Ga0495585_0000262 | 3300046492 | Bacteria | 53542 |
| 235 | Ga0495585_0000853 | 3300046492 | Bacteria | 26111 |
| 236 | Ga0495596_0053928 | 3300046500 | Unclassified | 1573 |
| 237 | Ga0495583_0023670 | 3300046506 | Bacteria | 3102 |
| 238 | Ga0495606_0000033 | 3300046507 | Bacteria | 247739 |
| 239 | Ga0495606_0041225 | 3300046507 | Bacteria | 3097 |
| 240 | Ga0495606_0093103 | 3300046507 | Bacteria | 1849 |
| 241 | Ga0495606_0139359 | 3300046507 | Bacteria | 1434 |
| 242 | Ga0495610_0018447 | 3300046512 | Bacteria | 3940 |
| 243 | Ga0495616_0004223 | 3300046513 | Bacteria | 9091 |
| 244 | Ga0495628_0078820 | 3300046516 | Bacteria | 2562 |
| 245 | Ga0495632_0068243 | 3300046519 | Unclassified | 1714 |
| 246 | Ga0495632_0110443 | 3300046519 | Bacteria | 1291 |
| 247 | Ga0495648_0012159 | 3300046524 | Bacteria | 6439 |
| 248 | Ga0495648_0141526 | 3300046524 | Bacteria | 1265 |
| 249 | Ga0495642_0051515 | 3300046528 | Bacteria | 1694 |
| 250 | Ga0495652_0151417 | 3300046529 | Bacteria | 1812 |
| 251 | Ga0495654_0058710 | 3300046530 | Bacteria | 1855 |
| 252 | Ga0495609_0071647 | 3300046538 | Bacteria | 1522 |
| 253 | Ga0495633_0000516 | 3300046558 | Bacteria | 38775 |
| 254 | Ga0495633_0014364 | 3300046558 | Bacteria | 4144 |
| 255 | Ga0495668_0000009 | 3300046616 | Bacteria | 492623 |
| 256 | Ga0495625_0000131 | 3300046660 | Bacteria | 117738 |
| 257 | Ga0495625_0000951 | 3300046660 | Bacteria | 38714 |
| 258 | Ga0495625_0042570 | 3300046660 | Bacteria | 3299 |
| 259 | Ga0495625_0047979 | 3300046660 | Bacteria | 3077 |
| 260 | Ga0495625_0148198 | 3300046660 | Bacteria | 1579 |
| 261 | Ga0495661_0000134 | 3300046665 | Bacteria | 87487 |
| 262 | Ga0495661_0003857 | 3300046665 | Bacteria | 10954 |
| 263 | Ga0495661_0119110 | 3300046665 | Bacteria | 1460 |
| 264 | Ga0495649_0000009 | 3300046694 | Bacteria | 451725 |
| 265 | Ga0495660_0022374 | 3300046810 | Bacteria | 3610 |
| 266 | Ga0495683_0181131 | 3300047323 | Bacteria | 962 |
| 267 | Ga0495687_003112 | 3300047443 | Bacteria | 12401 |
| 268 | Ga0495687_022980 | 3300047443 | Bacteria | 2985 |
| 269 | Ga0495687_085242 | 3300047443 | Bacteria | 1225 |
| 270 | Ga0495673_0021761 | 3300047469 | Bacteria | 3158 |
| 271 | Ga0495686_0000843 | 3300047472 | Bacteria | 39372 |
| 272 | Ga0495686_0000973 | 3300047472 | Bacteria | 35208 |
| 273 | Ga0495686_0035201 | 3300047472 | Bacteria | 3221 |
| 274 | Ga0495614_0017847 | 3300048089 | Bacteria | 3078 |
| 275 | Ga0496121_0000026 | 3300048924 | Bacteria | 450157 |
| 276 | Ga0501238_005727 | 3300049671 | Bacteria | 1584 |
| 277 | nmdc:mga0k408_574_c3 | 3300050493 | Bacteria | 6199 |
| 278 | Ga0500646_0002414 | 3300053090 | Bacteria | 4855 |
| 279 | Ga0500583_0003889 | 3300053092 | Bacteria | 4784 |
| 280 | Ga0500569_000136 | 3300053109 | Bacteria | 11674 |
| 281 | Ga0500607_038083 | 3300053121 | Bacteria | 2618 |
| 282 | Ga0500608_001479 | 3300053122 | Bacteria | 8394 |
| 283 | Ga0500618_009521 | 3300053125 | Bacteria | 2648 |
| 284 | Ga0500618_060403 | 3300053125 | Bacteria | 852 |
| 285 | Ga0500658_0002204 | 3300053134 | Bacteria | 7564 |
| 286 | Ga0500559_0044271 | 3300053136 | Bacteria | 1946 |
| 287 | Ga0500577_0006891 | 3300053142 | Bacteria | 3157 |
| 288 | Ga0500616_0021179 | 3300053153 | Bacteria | 3649 |
| 289 | Ga0500622_0000295 | 3300053156 | Bacteria | 51064 |
| 290 | Ga0500622_0001079 | 3300053156 | Bacteria | 22688 |
| 291 | Ga0500624_000118 | 3300053157 | Bacteria | 35980 |
| 292 | Ga0500633_0000392 | 3300053160 | Bacteria | 6768 |
| 293 | Ga0500636_0075202 | 3300053177 | Bacteria | 1954 |
| 294 | Ga0500661_005435 | 3300055283 | Bacteria | 2381 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300010375 | Ga0105239_10000212 | Ga0105239_1000021237 | 179 |
| 2 | 3300037418 | Ga0395900_0109690 | Ga0395900_0109690_151_765 | 186 |
| 3 | 3300047443 | Ga0495687_085242 | Ga0495687_085242_45_647 | 193 |
| 4 | 3300046524 | Ga0495648_0141526 | Ga0495648_0141526_669_1253 | 194 |
| 5 | 3300047472 | Ga0495686_0000973 | Ga0495686_0000973_4022_4621 | 199 |
| 6 | 3300053136 | Ga0500559_0044271 | Ga0500559_0044271_1130_1801 | 201 |
| 7 | 3300053177 | Ga0500636_0075202 | Ga0500636_0075202_146_817 | 201 |
| 8 | 3300025921 | Ga0207652_10072004 | Ga0207652_100720042 | 203 |
| 9 | 3300003323 | rootH1_10193575 | rootH1_101935752 | 204 |
| 10 | 3300013297 | Ga0157378_10134718 | Ga0157378_101347182 | 204 |
| 11 | 3300013308 | Ga0157375_10031510 | Ga0157375_100315103 | 204 |
| 12 | 3300003320 | rootH2_10089997 | rootH2_100899972 | 205 |
| 13 | 3300005327 | Ga0070658_10000014 | Ga0070658_10000014167 | 205 |
| 14 | 3300005563 | Ga0068855_100115178 | Ga0068855_1001151782 | 205 |
| 15 | 3300009093 | Ga0105240_10221296 | Ga0105240_102212964 | 205 |
| 16 | 3300009174 | Ga0105241_10047228 | Ga0105241_100472283 | 205 |
| 17 | 3300013296 | Ga0157374_10009161 | Ga0157374_100091615 | 205 |
| 18 | 3300025909 | Ga0207705_10000107 | Ga0207705_1000010724 | 205 |
| 19 | 3300025949 | Ga0207667_10104675 | Ga0207667_101046754 | 205 |
| 20 | 3300045049 | Ga0466959_0435701 | Ga0466959_0435701_111_731 | 205 |
| 21 | 3300046660 | Ga0495625_0148198 | Ga0495625_0148198_285_968 | 205 |
| 22 | 3300053092 | Ga0500583_0003889 | Ga0500583_0003889_1221_1904 | 205 |
| 23 | 3300003316 | rootH1_10077670 | rootH1_100776703 | 206 |
| 24 | 3300009093 | Ga0105240_10000010 | Ga0105240_1000001067 | 206 |
| 25 | 3300009174 | Ga0105241_10222825 | Ga0105241_102228252 | 206 |
| 26 | 3300009545 | Ga0105237_10002429 | Ga0105237_1000242917 | 206 |
| 27 | 3300009545 | Ga0105237_10391806 | Ga0105237_103918061 | 206 |
| 28 | 3300009551 | Ga0105238_10428218 | Ga0105238_104282182 | 206 |
| 29 | 3300010375 | Ga0105239_10041432 | Ga0105239_100414324 | 206 |
| 30 | 3300025913 | Ga0207695_10000019 | Ga0207695_10000019384 | 206 |
| 31 | 3300025914 | Ga0207671_10007187 | Ga0207671_100071874 | 206 |
| 32 | 3300025924 | Ga0207694_10301820 | Ga0207694_103018202 | 206 |
| 33 | 3300035115 | Ga0373941_0087668 | Ga0373941_0087668_247_870 | 206 |
| 34 | 3300037312 | Ga0395899_0022353 | Ga0395899_0022353_993_1613 | 206 |
| 35 | 3300037418 | Ga0395900_0010532 | Ga0395900_0010532_3953_4573 | 206 |
| 36 | 3300037471 | Ga0395905_0002359 | Ga0395905_0002359_4858_5478 | 206 |
| 37 | 3300038443 | Ga0395901_0024555 | Ga0395901_0024555_4848_5468 | 206 |
| 38 | 3300005262 | Ga0065165_1012934 | Ga0065165_10129343 | 207 |
| 39 | 3300025208 | Ga0209436_101755 | Ga0209436_1017554 | 207 |
| 40 | 3300025302 | Ga0207426_1005661 | Ga0207426_10056614 | 207 |
| 41 | 3300044765 | Ga0466970_0233450 | Ga0466970_0233450_292_936 | 210 |
| 42 | 3300045049 | Ga0466959_0036512 | Ga0466959_0036512_2568_3212 | 210 |
| 43 | 3300028794 | Ga0307515_10104050 | Ga0307515_101040502 | 212 |
| 44 | iso_pu_bacteria | 2818991442 | 2819575742 | 212 |
| 45 | iso_pu_bacteria | 2821136567 | 2821138294 | 212 |
| 46 | iso_pu_bacteria | 2904467357 | 2904469090 | 212 |
| 47 | 3300005355 | Ga0070671_100011944 | Ga0070671_1000119441 | 213 |
| 48 | 3300005457 | Ga0070662_100062444 | Ga0070662_1000624442 | 213 |
| 49 | 3300009093 | Ga0105240_10018922 | Ga0105240_100189229 | 213 |
| 50 | 3300009093 | Ga0105240_10034933 | Ga0105240_100349332 | 213 |
| 51 | 3300009148 | Ga0105243_10048091 | Ga0105243_100480912 | 213 |
| 52 | 3300009174 | Ga0105241_10012557 | Ga0105241_100125572 | 213 |
| 53 | 3300009545 | Ga0105237_10009567 | Ga0105237_100095677 | 213 |
| 54 | 3300009551 | Ga0105238_10009925 | Ga0105238_100099254 | 213 |
| 55 | 3300010375 | Ga0105239_10042526 | Ga0105239_100425264 | 213 |
| 56 | 3300013296 | Ga0157374_10001060 | Ga0157374_1000106020 | 213 |
| 57 | 3300013297 | Ga0157378_10009516 | Ga0157378_100095162 | 213 |
| 58 | 3300013306 | Ga0163162_10000010 | Ga0163162_10000010268 | 213 |
| 59 | 3300014969 | Ga0157376_10331741 | Ga0157376_103317412 | 213 |
| 60 | 3300025913 | Ga0207695_10101889 | Ga0207695_101018892 | 213 |
| 61 | 3300025931 | Ga0207644_10018029 | Ga0207644_100180292 | 213 |
| 62 | 3300037312 | Ga0395899_0000887 | Ga0395899_0000887_13795_14436 | 213 |
| 63 | 3300037418 | Ga0395900_0000143 | Ga0395900_0000143_14963_15604 | 213 |
| 64 | 3300037466 | Ga0395898_0070858 | Ga0395898_0070858_882_1523 | 213 |
| 65 | 3300037471 | Ga0395905_0000175 | Ga0395905_0000175_17077_17718 | 213 |
| 66 | 3300038443 | Ga0395901_0000313 | Ga0395901_0000313_13961_14602 | 213 |
| 67 | 3300003761 | Ga0055535_1003443 | Ga0055535_10034432 | 214 |
| 68 | 3300025242 | Ga0209258_100098 | Ga0209258_100098120 | 214 |
| 69 | 3300025254 | Ga0209148_1000120 | Ga0209148_100012094 | 214 |
| 70 | 3300046519 | Ga0495632_0068243 | Ga0495632_0068243_390_1037 | 214 |
| 71 | 3300053090 | Ga0500646_0002414 | Ga0500646_0002414_3735_4382 | 214 |
| 72 | 3300053109 | Ga0500569_000136 | Ga0500569_000136_10342_10989 | 214 |
| 73 | 3300053121 | Ga0500607_038083 | Ga0500607_038083_306_953 | 214 |
| 74 | 3300053134 | Ga0500658_0002204 | Ga0500658_0002204_236_883 | 214 |
| 75 | 3300053153 | Ga0500616_0021179 | Ga0500616_0021179_1749_2396 | 214 |
| 76 | 3300005539 | Ga0068853_100074604 | Ga0068853_1000746042 | 215 |
| 77 | 3300005548 | Ga0070665_100000032 | Ga0070665_100000032194 | 215 |
| 78 | 3300013104 | Ga0157370_10110972 | Ga0157370_101109723 | 215 |
| 79 | 3300026041 | Ga0207639_10032979 | Ga0207639_100329792 | 215 |
| 80 | 3300028379 | Ga0268266_10000030 | Ga0268266_10000030136 | 215 |
| 81 | 3300028786 | Ga0307517_10001373 | Ga0307517_1000137332 | 215 |
| 82 | 3300033180 | Ga0307510_10010205 | Ga0307510_100102055 | 215 |
| 83 | 3300047323 | Ga0495683_0181131 | Ga0495683_0181131_292_939 | 215 |
| 84 | 3300053160 | Ga0500633_0000392 | Ga0500633_0000392_3435_4106 | 215 |
| 85 | iso_pu_bacteria | 2977232053 | 2977236456 | 215 |
| 86 | 3300003322 | rootL2_10021199 | rootL2_100211991 | 216 |
| 87 | 3300021361 | Ga0213872_10008537 | Ga0213872_100085372 | 216 |
| 88 | 3300025297 | Ga0209758_1031512 | Ga0209758_10315122 | 216 |
| 89 | 3300039447 | Ga0436361_0924736 | Ga0436361_0924736_20709_21380 | 216 |
| 90 | 3300046453 | Ga0495627_008925 | Ga0495627_008925_197_859 | 216 |
| 91 | 3300046558 | Ga0495633_0000516 | Ga0495633_0000516_11897_12559 | 216 |
| 92 | 3300048924 | Ga0496121_0000026 | Ga0496121_0000026_419595_420248 | 216 |
| 93 | 3300053156 | Ga0500622_0000295 | Ga0500622_0000295_30857_31525 | 216 |
| 94 | iso_pu_bacteria | 2599185184 | 2599480426 | 216 |
| 95 | iso_pu_bacteria | 2852623160 | 2852625046 | 216 |
| 96 | iso_pu_bacteria | 2884933994 | 2884934063 | 216 |
| 97 | iso_pu_bacteria | 2919437846 | 2919438283 | 216 |
| 98 | iso_pu_bacteria | 2928078545 | 2928083333 | 216 |
| 99 | iso_pu_bacteria | 2928147474 | 2928151405 | 216 |
| 100 | iso_pu_bacteria | 2932082852 | 2932087324 | 216 |
| 101 | 3300001990 | JGI24737J22298_10056092 | JGI24737J22298_100560922 | 217 |
| 102 | 3300001991 | JGI24743J22301_10043479 | JGI24743J22301_100434792 | 217 |
| 103 | 3300002077 | JGI24744J21845_10016587 | JGI24744J21845_100165872 | 217 |
| 104 | 3300003320 | rootH2_10005336 | rootH2_1000533669 | 217 |
| 105 | 3300005328 | Ga0070676_10000729 | Ga0070676_100007299 | 217 |
| 106 | 3300005354 | Ga0070675_100307288 | Ga0070675_1003072882 | 217 |
| 107 | 3300005456 | Ga0070678_100015591 | Ga0070678_1000155913 | 217 |
| 108 | 3300005457 | Ga0070662_100000014 | Ga0070662_10000001457 | 217 |
| 109 | 3300005459 | Ga0068867_100001403 | Ga0068867_10000140312 | 217 |
| 110 | 3300005539 | Ga0068853_100003643 | Ga0068853_1000036434 | 217 |
| 111 | 3300005563 | Ga0068855_100044045 | Ga0068855_1000440452 | 217 |
| 112 | 3300005563 | Ga0068855_100999824 | Ga0068855_1009998242 | 217 |
| 113 | 3300005616 | Ga0068852_100011199 | Ga0068852_1000111994 | 217 |
| 114 | 3300005841 | Ga0068863_100364415 | Ga0068863_1003644152 | 217 |
| 115 | 3300006237 | Ga0097621_100010173 | Ga0097621_1000101734 | 217 |
| 116 | 3300006358 | Ga0068871_100000306 | Ga0068871_10000030623 | 217 |
| 117 | 3300006881 | Ga0068865_100007153 | Ga0068865_1000071534 | 217 |
| 118 | 3300009093 | Ga0105240_10058849 | Ga0105240_100588493 | 217 |
| 119 | 3300009093 | Ga0105240_11097073 | Ga0105240_110970731 | 217 |
| 120 | 3300009098 | Ga0105245_10800799 | Ga0105245_108007991 | 217 |
| 121 | 3300009174 | Ga0105241_10002362 | Ga0105241_1000236212 | 217 |
| 122 | 3300009545 | Ga0105237_10003264 | Ga0105237_100032642 | 217 |
| 123 | 3300010375 | Ga0105239_10056316 | Ga0105239_100563164 | 217 |
| 124 | 3300013100 | Ga0157373_10196817 | Ga0157373_101968172 | 217 |
| 125 | 3300013105 | Ga0157369_10187024 | Ga0157369_101870242 | 217 |
| 126 | 3300013296 | Ga0157374_10002738 | Ga0157374_1000273811 | 217 |
| 127 | 3300013296 | Ga0157374_10428607 | Ga0157374_104286073 | 217 |
| 128 | 3300013306 | Ga0163162_10304285 | Ga0163162_103042852 | 217 |
| 129 | 3300013308 | Ga0157375_10011593 | Ga0157375_100115934 | 217 |
| 130 | 3300014745 | Ga0157377_10011791 | Ga0157377_100117913 | 217 |
| 131 | 3300015262 | Ga0182007_10098898 | Ga0182007_100988981 | 217 |
| 132 | 3300025904 | Ga0207647_10000680 | Ga0207647_1000068018 | 217 |
| 133 | 3300025907 | Ga0207645_10000591 | Ga0207645_100005918 | 217 |
| 134 | 3300025911 | Ga0207654_10032090 | Ga0207654_100320902 | 217 |
| 135 | 3300025913 | Ga0207695_10039525 | Ga0207695_100395252 | 217 |
| 136 | 3300025913 | Ga0207695_10177055 | Ga0207695_101770551 | 217 |
| 137 | 3300025913 | Ga0207695_10649054 | Ga0207695_106490542 | 217 |
| 138 | 3300025914 | Ga0207671_10010478 | Ga0207671_100104785 | 217 |
| 139 | 3300025924 | Ga0207694_10018923 | Ga0207694_100189235 | 217 |
| 140 | 3300025933 | Ga0207706_10000057 | Ga0207706_1000005779 | 217 |
| 141 | 3300025934 | Ga0207686_10366518 | Ga0207686_103665181 | 217 |
| 142 | 3300025938 | Ga0207704_10000266 | Ga0207704_100002664 | 217 |
| 143 | 3300025949 | Ga0207667_10582703 | Ga0207667_105827032 | 217 |
| 144 | 3300025960 | Ga0207651_10096595 | Ga0207651_100965952 | 217 |
| 145 | 3300026041 | Ga0207639_10053759 | Ga0207639_100537592 | 217 |
| 146 | 3300026089 | Ga0207648_10005635 | Ga0207648_1000563512 | 217 |
| 147 | 3300026121 | Ga0207683_10008342 | Ga0207683_100083424 | 217 |
| 148 | 3300026142 | Ga0207698_10079738 | Ga0207698_100797382 | 217 |
| 149 | 3300042005 | Ga0439448_0001918 | Ga0439448_0001918_4810_5463 | 217 |
| 150 | 3300046500 | Ga0495596_0053928 | Ga0495596_0053928_101_754 | 217 |
| 151 | 3300046519 | Ga0495632_0110443 | Ga0495632_0110443_428_1081 | 217 |
| 152 | 3300046665 | Ga0495661_0000134 | Ga0495661_0000134_62666_63319 | 217 |
| 153 | 3300047443 | Ga0495687_003112 | Ga0495687_003112_10774_11427 | 217 |
| 154 | 3300053122 | Ga0500608_001479 | Ga0500608_001479_1663_2316 | 217 |
| 155 | 3300009093 | Ga0105240_10159809 | Ga0105240_101598092 | 218 |
| 156 | 3300010375 | Ga0105239_10000001 | Ga0105239_10000001296 | 218 |
| 157 | 3300013100 | Ga0157373_10000881 | Ga0157373_1000088123 | 218 |
| 158 | 3300013102 | Ga0157371_10002946 | Ga0157371_1000294620 | 218 |
| 159 | 3300013104 | Ga0157370_10036373 | Ga0157370_100363734 | 218 |
| 160 | 3300013105 | Ga0157369_10153439 | Ga0157369_101534392 | 218 |
| 161 | 3300013307 | Ga0157372_10000173 | Ga0157372_1000017336 | 218 |
| 162 | 3300025261 | Ga0209233_1009172 | Ga0209233_10091722 | 218 |
| 163 | 3300038443 | Ga0395901_0150469 | Ga0395901_0150469_1706_2365 | 218 |
| 164 | 3300002737 | JGI25162J39368_1000615 | JGI25162J39368_100061513 | 219 |
| 165 | 3300002772 | JGI25164J39214_1001761 | JGI25164J39214_10017613 | 219 |
| 166 | 3300003214 | JGI25165J46597_1000157 | JGI25165J46597_100015730 | 219 |
| 167 | 3300003320 | rootH2_10268268 | rootH2_102682682 | 219 |
| 168 | 3300003323 | rootH1_10005851 | rootH1_1000585189 | 219 |
| 169 | 3300003323 | rootH1_10017654 | rootH1_100176542 | 219 |
| 170 | 3300003323 | rootH1_10323207 | rootH1_103232072 | 219 |
| 171 | 3300005288 | Ga0065714_10023151 | Ga0065714_100231512 | 219 |
| 172 | 3300005339 | Ga0070660_100004154 | Ga0070660_10000415411 | 219 |
| 173 | 3300005530 | Ga0070679_100015039 | Ga0070679_1000150394 | 219 |
| 174 | 3300005563 | Ga0068855_100000662 | Ga0068855_1000006627 | 219 |
| 175 | 3300005614 | Ga0068856_100025316 | Ga0068856_1000253162 | 219 |
| 176 | 3300009093 | Ga0105240_10042668 | Ga0105240_100426683 | 219 |
| 177 | 3300013104 | Ga0157370_10357504 | Ga0157370_103575042 | 219 |
| 178 | 3300013306 | Ga0163162_10010391 | Ga0163162_100103916 | 219 |
| 179 | 3300020076 | Ga0206355_1025687 | Ga0206355_10256872 | 219 |
| 180 | 3300020077 | Ga0206351_10763673 | Ga0206351_107636732 | 219 |
| 181 | 3300020610 | Ga0154015_1180645 | Ga0154015_11806452 | 219 |
| 182 | 3300022467 | Ga0224712_10063924 | Ga0224712_100639241 | 219 |
| 183 | 3300025230 | Ga0209563_112929 | Ga0209563_1129292 | 219 |
| 184 | 3300025231 | Ga0207427_100025 | Ga0207427_100025112 | 219 |
| 185 | 3300025233 | Ga0209437_100010 | Ga0209437_100010374 | 219 |
| 186 | 3300025261 | Ga0209233_1000017 | Ga0209233_1000017387 | 219 |
| 187 | 3300025272 | Ga0209455_1006632 | Ga0209455_10066322 | 219 |
| 188 | 3300025909 | Ga0207705_10128354 | Ga0207705_101283542 | 219 |
| 189 | 3300025912 | Ga0207707_10119043 | Ga0207707_101190432 | 219 |
| 190 | 3300025919 | Ga0207657_10029807 | Ga0207657_100298075 | 219 |
| 191 | 3300025921 | Ga0207652_10006186 | Ga0207652_100061866 | 219 |
| 192 | 3300025949 | Ga0207667_10002856 | Ga0207667_1000285610 | 219 |
| 193 | 3300026078 | Ga0207702_10109031 | Ga0207702_101090311 | 219 |
| 194 | 3300030522 | Ga0307512_10185342 | Ga0307512_101853422 | 219 |
| 195 | 3300044656 | Ga0466969_0056993 | Ga0466969_0056993_614_1273 | 219 |
| 196 | 3300044693 | Ga0466961_0397903 | Ga0466961_0397903_159_818 | 219 |
| 197 | 3300045049 | Ga0466959_0045498 | Ga0466959_0045498_2112_2771 | 219 |
| 198 | 3300046471 | Ga0495650_0000162 | Ga0495650_0000162_86995_87675 | 219 |
| 199 | 3300046492 | Ga0495585_0000262 | Ga0495585_0000262_31062_31742 | 219 |
| 200 | 3300046506 | Ga0495583_0023670 | Ga0495583_0023670_1393_2073 | 219 |
| 201 | 3300046507 | Ga0495606_0000033 | Ga0495606_0000033_215160_215840 | 219 |
| 202 | 3300046507 | Ga0495606_0139359 | Ga0495606_0139359_688_1368 | 219 |
| 203 | 3300046512 | Ga0495610_0018447 | Ga0495610_0018447_3103_3783 | 219 |
| 204 | 3300046513 | Ga0495616_0004223 | Ga0495616_0004223_5499_6179 | 219 |
| 205 | 3300046558 | Ga0495633_0014364 | Ga0495633_0014364_875_1555 | 219 |
| 206 | 3300046660 | Ga0495625_0000131 | Ga0495625_0000131_92948_93628 | 219 |
| 207 | 3300046660 | Ga0495625_0042570 | Ga0495625_0042570_883_1557 | 219 |
| 208 | 3300046665 | Ga0495661_0003857 | Ga0495661_0003857_8960_9640 | 219 |
| 209 | 3300046665 | Ga0495661_0119110 | Ga0495661_0119110_94_753 | 219 |
| 210 | 3300046694 | Ga0495649_0000009 | Ga0495649_0000009_92938_93618 | 219 |
| 211 | 3300047469 | Ga0495673_0021761 | Ga0495673_0021761_607_1287 | 219 |
| 212 | 3300049671 | Ga0501238_005727 | Ga0501238_005727_531_1190 | 219 |
| 213 | 3300053125 | Ga0500618_009521 | Ga0500618_009521_1045_1725 | 219 |
| 214 | 3300053125 | Ga0500618_060403 | Ga0500618_060403_33_713 | 219 |
| 215 | 3300053142 | Ga0500577_0006891 | Ga0500577_0006891_2051_2734 | 219 |
| 216 | 3300053156 | Ga0500622_0001079 | Ga0500622_0001079_17925_18599 | 219 |
| 217 | 3300001990 | JGI24737J22298_10000071 | JGI24737J22298_1000007119 | 220 |
| 218 | 3300002067 | JGI24735J21928_10000013 | JGI24735J21928_10000013167 | 220 |
| 219 | 3300002737 | JGI25162J39368_1000107 | JGI25162J39368_100010749 | 220 |
| 220 | 3300003316 | rootH1_10003553 | rootH1_1000355313 | 220 |
| 221 | 3300003320 | rootH2_10100104 | rootH2_101001041 | 220 |
| 222 | 3300003322 | rootL2_10123764 | rootL2_101237644 | 220 |
| 223 | 3300005288 | Ga0065714_10110354 | Ga0065714_101103541 | 220 |
| 224 | 3300005288 | Ga0065714_10110659 | Ga0065714_101106592 | 220 |
| 225 | 3300005356 | Ga0070674_100733756 | Ga0070674_1007337561 | 220 |
| 226 | 3300005366 | Ga0070659_100138501 | Ga0070659_1001385011 | 220 |
| 227 | 3300005539 | Ga0068853_100122825 | Ga0068853_1001228252 | 220 |
| 228 | 3300005578 | Ga0068854_100005184 | Ga0068854_1000051844 | 220 |
| 229 | 3300005614 | Ga0068856_100191627 | Ga0068856_1001916273 | 220 |
| 230 | 3300005842 | Ga0068858_100223676 | Ga0068858_1002236762 | 220 |
| 231 | 3300006195 | Ga0075366_10004640 | Ga0075366_100046403 | 220 |
| 232 | 3300006195 | Ga0075366_10006004 | Ga0075366_100060044 | 220 |
| 233 | 3300006195 | Ga0075366_10100269 | Ga0075366_101002692 | 220 |
| 234 | 3300009093 | Ga0105240_10059864 | Ga0105240_100598642 | 220 |
| 235 | 3300009093 | Ga0105240_10276746 | Ga0105240_102767462 | 220 |
| 236 | 3300009545 | Ga0105237_10017775 | Ga0105237_100177758 | 220 |
| 237 | 3300009545 | Ga0105237_10018280 | Ga0105237_100182803 | 220 |
| 238 | 3300009545 | Ga0105237_10019775 | Ga0105237_100197757 | 220 |
| 239 | 3300009545 | Ga0105237_10035203 | Ga0105237_100352033 | 220 |
| 240 | 3300009545 | Ga0105237_10447778 | Ga0105237_104477781 | 220 |
| 241 | 3300009551 | Ga0105238_10048865 | Ga0105238_100488652 | 220 |
| 242 | 3300010375 | Ga0105239_10000007 | Ga0105239_10000007163 | 220 |
| 243 | 3300010375 | Ga0105239_10000352 | Ga0105239_1000035233 | 220 |
| 244 | 3300010375 | Ga0105239_10019157 | Ga0105239_100191576 | 220 |
| 245 | 3300010375 | Ga0105239_10217225 | Ga0105239_102172252 | 220 |
| 246 | 3300013102 | Ga0157371_10012339 | Ga0157371_100123392 | 220 |
| 247 | 3300013306 | Ga0163162_10010995 | Ga0163162_100109953 | 220 |
| 248 | 3300013306 | Ga0163162_11670198 | Ga0163162_116701981 | 220 |
| 249 | 3300013307 | Ga0157372_10002719 | Ga0157372_1000271911 | 220 |
| 250 | 3300015265 | Ga0182005_1000371 | Ga0182005_100037112 | 220 |
| 251 | 3300017792 | Ga0163161_10024612 | Ga0163161_100246122 | 220 |
| 252 | 3300025233 | Ga0209437_100148 | Ga0209437_10014893 | 220 |
| 253 | 3300025258 | Ga0209129_1008736 | Ga0209129_10087364 | 220 |
| 254 | 3300025904 | Ga0207647_10005778 | Ga0207647_100057787 | 220 |
| 255 | 3300025913 | Ga0207695_10138742 | Ga0207695_101387421 | 220 |
| 256 | 3300025914 | Ga0207671_10002702 | Ga0207671_100027028 | 220 |
| 257 | 3300025914 | Ga0207671_10003542 | Ga0207671_100035428 | 220 |
| 258 | 3300025914 | Ga0207671_10021139 | Ga0207671_100211392 | 220 |
| 259 | 3300025932 | Ga0207690_10108403 | Ga0207690_101084032 | 220 |
| 260 | 3300025937 | Ga0207669_10732026 | Ga0207669_107320261 | 220 |
| 261 | 3300025949 | Ga0207667_10054548 | Ga0207667_100545483 | 220 |
| 262 | 3300025981 | Ga0207640_10005183 | Ga0207640_100051833 | 220 |
| 263 | 3300026116 | Ga0207674_10269625 | Ga0207674_102696252 | 220 |
| 264 | 3300028794 | Ga0307515_10000376 | Ga0307515_1000037697 | 220 |
| 265 | 3300028794 | Ga0307515_10005206 | Ga0307515_100052066 | 220 |
| 266 | 3300028794 | Ga0307515_10176904 | Ga0307515_101769042 | 220 |
| 267 | 3300033179 | Ga0307507_10000032 | Ga0307507_10000032139 | 220 |
| 268 | 3300046462 | Ga0495651_0097231 | Ga0495651_0097231_724_1389 | 220 |
| 269 | 3300046492 | Ga0495585_0000853 | Ga0495585_0000853_18184_18849 | 220 |
| 270 | 3300046507 | Ga0495606_0041225 | Ga0495606_0041225_2095_2778 | 220 |
| 271 | 3300046507 | Ga0495606_0093103 | Ga0495606_0093103_747_1415 | 220 |
| 272 | 3300046516 | Ga0495628_0078820 | Ga0495628_0078820_399_1064 | 220 |
| 273 | 3300046524 | Ga0495648_0012159 | Ga0495648_0012159_2587_3252 | 220 |
| 274 | 3300046528 | Ga0495642_0051515 | Ga0495642_0051515_662_1330 | 220 |
| 275 | 3300046529 | Ga0495652_0151417 | Ga0495652_0151417_725_1390 | 220 |
| 276 | 3300046530 | Ga0495654_0058710 | Ga0495654_0058710_234_899 | 220 |
| 277 | 3300046538 | Ga0495609_0071647 | Ga0495609_0071647_347_1012 | 220 |
| 278 | 3300046616 | Ga0495668_0000009 | Ga0495668_0000009_221420_222082 | 220 |
| 279 | 3300046660 | Ga0495625_0000951 | Ga0495625_0000951_21004_21669 | 220 |
| 280 | 3300046660 | Ga0495625_0047979 | Ga0495625_0047979_795_1460 | 220 |
| 281 | 3300046810 | Ga0495660_0022374 | Ga0495660_0022374_1306_1989 | 220 |
| 282 | 3300047443 | Ga0495687_022980 | Ga0495687_022980_1970_2644 | 220 |
| 283 | 3300047472 | Ga0495686_0000843 | Ga0495686_0000843_15120_15782 | 220 |
| 284 | 3300047472 | Ga0495686_0035201 | Ga0495686_0035201_1805_2467 | 220 |
| 285 | 3300048089 | Ga0495614_0017847 | Ga0495614_0017847_347_1012 | 220 |
| 286 | 3300050493 | nmdc:mga0k408_574_c3 | nmdc:mga0k408_574_c3_835_1512 | 220 |
| 287 | 3300053157 | Ga0500624_000118 | Ga0500624_000118_24222_24887 | 220 |
| 288 | 3300055283 | Ga0500661_005435 | Ga0500661_005435_283_1023 | 220 |
| 289 | iso_pu_bacteria | 2929239360 | 2929242964 | 220 |
| 290 | 3300001979 | JGI24740J21852_10031384 | JGI24740J21852_100313842 | 221 |
| 291 | 3300003323 | rootH1_10043200 | rootH1_100432002 | 221 |
| 292 | 3300005327 | Ga0070658_10053216 | Ga0070658_100532165 | 221 |
| 293 | 3300005339 | Ga0070660_100052135 | Ga0070660_1000521355 | 221 |
| 294 | 3300005366 | Ga0070659_100000242 | Ga0070659_10000024226 | 221 |
| 295 | 3300013102 | Ga0157371_10005024 | Ga0157371_100050245 | 221 |
| 296 | 3300013104 | Ga0157370_10057969 | Ga0157370_100579691 | 221 |
| 297 | 3300013105 | Ga0157369_10014221 | Ga0157369_100142216 | 221 |
| 298 | 3300013296 | Ga0157374_10257279 | Ga0157374_102572792 | 221 |
| 299 | 3300013307 | Ga0157372_10000073 | Ga0157372_1000007318 | 221 |
| 300 | 3300025909 | Ga0207705_10077312 | Ga0207705_100773122 | 221 |
| 301 | 3300025919 | Ga0207657_10233450 | Ga0207657_102334502 | 221 |
| 302 | 3300025932 | Ga0207690_10000272 | Ga0207690_100002723 | 221 |
| 303 | 3300037312 | Ga0395899_0000002 | Ga0395899_0000002_539567_540241 | 221 |
| 304 | 3300037312 | Ga0395899_0007044 | Ga0395899_0007044_7019_7684 | 221 |
| 305 | 3300044684 | Ga0466966_0013641 | Ga0466966_0013641_364_1029 | 221 |
| 306 | 3300045836 | Ga0466958_0017493 | Ga0466958_0017493_1595_2260 | 221 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ebu-assembly1.cif.gz_A | crystal structure of aquifex aeolicus lpxe | 0.9228 | 37 | 199 |
| 6ebu-assembly1.cif.gz_A | crystal structure of aquifex aeolicus lpxe | 0.8643 | 37 | 199 |
| 1qhb-assembly1.cif.gz_A | vanadium bromoperoxidase from red alga corallina officinalis | 0.7952 | 129 | 194 |
| 4usz-assembly1.cif.gz_A | crystal structure of the first bacterial vanadium dependant iodoperoxidase | 0.7744 | 106 | 195 |
| 4cit-assembly1.cif.gz_A | crystal structure of the first bacterial vanadium dependant iodoperoxidase | 0.7688 | 106 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0N7KFG1_1_446_1.20.144.10 | Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase | 0.8423 | 132 | 198 | 1.20.144.10 |
| af_Q9Z186_13_195_1.20.144.10 | Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase | 0.8009 | 51 | 196 | 1.20.144.10 |
| af_Q75HI8_51_243_1.20.144.10 | Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase | 0.7895 | 37 | 197 | 1.20.144.10 |
| af_F1R7P4_74_293_1.20.144.10 | Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase | 0.7866 | 79 | 199 | 1.20.144.10 |
| 4citA00 | Mainly Alpha;Orthogonal Bundle;Vanadium-containing Chloroperoxidase; domain 2; | 0.7688 | 106 | 195 | 1.10.606.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q6EG09-F1-model_v4 | Phosphatase PAP2 family protein | 0.9951 | 1 | 216 |
GO:0008610
GO:0016020 GO:0016787 GO:1901137 |
| AF-A0A367GSZ2-F1-model_v4 | Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein | 0.9897 | 1 | 218 |
GO:0008610
GO:0016020 GO:0016787 GO:1901137 |
| AF-A0A4V1ZZM1-F1-model_v4 | Phosphatase PAP2 family protein | 0.9882 | 43 | 218 |
GO:0008610
GO:0016020 GO:0016787 GO:1901137 |
| AF-A0A2W5HCF9-F1-model_v4 | Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein | 0.9877 | 5 | 218 |
GO:0008610
GO:0016020 GO:0016787 GO:1901137 |
| AF-A0A1Q3UC48-F1-model_v4 | Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein | 0.9873 | 1 | 218 |
GO:0008610
GO:0016020 GO:0016787 GO:1901137 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar