F398918

General Info

Members Datasets Scaffolds Average Seq Length
306 177 294 219

Family's Representative Sequence

Representative Sequence 3300055283|Ga0500661_005435|Ga0500661_005435_283_1023
Length 246
Sequence MLLTVRKTAFFQNINKFDLQNPISADQNGVKNTFLKTKALLLPYSVILICALCIKITYTKEDIYFFINNLHFAAGDIVFPYLTELGNITTVAVLCLLLTFVSYKSSLLLLTSQIVTSLVNFPLKDLFLAPRPKLYFDGSIRPIYYVPNVEVLSNHFSFPSGHTVCAFTSALVLTYISPRRRYGYLYLIGALLVAYSRMYMSQHFFEDVTAGSFVAVTVTFLWLSWFNKRKFLQQDWWNRSLSKKTP

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
5 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
6 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
7 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
8 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
9 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
10 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
11 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
12 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
19 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
73 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
117 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
155 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
164 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
165 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
166 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
167 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
168 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
169 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
170 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
171 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
173 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
174 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
175 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
176 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
177 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.77
Metatranscriptomes 1.31
Isolates 3.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.07
Nodule 0
Rhizoplane 0.33
Rhizosphere 77.12
Stem 0
Stem Tuber 0
Unclassified 9.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10031384 3300001979 Bacteria 1714
2 JGI24737J22298_10000071 3300001990 Bacteria 29829
3 JGI24737J22298_10056092 3300001990 Bacteria 1190
4 JGI24743J22301_10043479 3300001991 Unclassified 905
5 JGI24735J21928_10000013 3300002067 Bacteria 208663
6 JGI24744J21845_10016587 3300002077 Bacteria 1466
7 JGI25162J39368_1000107 3300002737 Bacteria 90782
8 JGI25162J39368_1000615 3300002737 Bacteria 25611
9 JGI25164J39214_1001761 3300002772 Bacteria 4263
10 JGI25165J46597_1000157 3300003214 Bacteria 108987
11 rootH1_10003553 3300003316 Bacteria 11129
12 rootH1_10077670 3300003316 Bacteria 3161
13 rootH2_10005336 3300003320 Bacteria 90063
14 rootH2_10089997 3300003320 Bacteria 5681
15 rootH2_10100104 3300003320 Bacteria 1959
16 rootH2_10268268 3300003320 Bacteria 2077
17 rootL2_10021199 3300003322 Bacteria 1518
18 rootL2_10123764 3300003322 Bacteria 5674
19 rootH1_10005851 3300003323 Bacteria 85811
20 rootH1_10017654 3300003323 Bacteria 4324
21 rootH1_10043200 3300003323 Bacteria 2234
22 rootH1_10193575 3300003323 Unclassified 1456
23 rootH1_10323207 3300003323 Bacteria 1898
24 Ga0055535_1003443 3300003761 Bacteria 4490
25 Ga0065165_1012934 3300005262 Bacteria 3355
26 Ga0065714_10023151 3300005288 Bacteria 1021
27 Ga0065714_10110354 3300005288 Bacteria 1487
28 Ga0065714_10110659 3300005288 Bacteria 1482
29 Ga0070658_10000014 3300005327 Bacteria 244978
30 Ga0070658_10053216 3300005327 Bacteria 3285
31 Ga0070676_10000729 3300005328 Bacteria 16102
32 Ga0070660_100004154 3300005339 Bacteria 9997
33 Ga0070660_100052135 3300005339 Unclassified 3153
34 Ga0070675_100307288 3300005354 Bacteria 1398
35 Ga0070671_100011944 3300005355 Bacteria 6987
36 Ga0070674_100733756 3300005356 Bacteria 847
37 Ga0070659_100000242 3300005366 Bacteria 42847
38 Ga0070659_100138501 3300005366 Bacteria 1980
39 Ga0070678_100015591 3300005456 Bacteria 4834
40 Ga0070662_100000014 3300005457 Bacteria 110124
41 Ga0070662_100062444 3300005457 Unclassified 2722
42 Ga0068867_100001403 3300005459 Bacteria 16639
43 Ga0070679_100015039 3300005530 Bacteria 7436
44 Ga0068853_100003643 3300005539 Bacteria 11812
45 Ga0068853_100074604 3300005539 Bacteria 2959
46 Ga0068853_100122825 3300005539 Bacteria 2318
47 Ga0070665_100000032 3300005548 Bacteria 333352
48 Ga0068855_100000662 3300005563 Bacteria 42009
49 Ga0068855_100044045 3300005563 Bacteria 5283
50 Ga0068855_100115178 3300005563 Bacteria 3082
51 Ga0068855_100999824 3300005563 Bacteria 879
52 Ga0068854_100005184 3300005578 Bacteria 8217
53 Ga0068856_100025316 3300005614 Bacteria 5785
54 Ga0068856_100191627 3300005614 Bacteria 2058
55 Ga0068852_100011199 3300005616 Bacteria 6738
56 Ga0068863_100364415 3300005841 Bacteria 1409
57 Ga0068858_100223676 3300005842 Bacteria 1783
58 Ga0075366_10004640 3300006195 Bacteria 7382
59 Ga0075366_10006004 3300006195 Bacteria 6617
60 Ga0075366_10100269 3300006195 Bacteria 1738
61 Ga0097621_100010173 3300006237 Bacteria 6867
62 Ga0068871_100000306 3300006358 Bacteria 34178
63 Ga0068865_100007153 3300006881 Bacteria 6853
64 Ga0105240_10000010 3300009093 Bacteria 537830
65 Ga0105240_10018922 3300009093 Bacteria 9223
66 Ga0105240_10034933 3300009093 Bacteria 6482
67 Ga0105240_10042668 3300009093 Bacteria 5779
68 Ga0105240_10058849 3300009093 Bacteria 4797
69 Ga0105240_10059864 3300009093 Bacteria 4751
70 Ga0105240_10159809 3300009093 Bacteria 2677
71 Ga0105240_10221296 3300009093 Bacteria 2205
72 Ga0105240_10276746 3300009093 Unclassified 1930
73 Ga0105240_11097073 3300009093 Bacteria 847
74 Ga0105245_10800799 3300009098 Bacteria 980
75 Ga0105243_10048091 3300009148 Bacteria 3361
76 Ga0105241_10002362 3300009174 Bacteria 14177
77 Ga0105241_10012557 3300009174 Bacteria 6213
78 Ga0105241_10047228 3300009174 Bacteria 3273
79 Ga0105241_10222825 3300009174 Bacteria 1586
80 Ga0105237_10002429 3300009545 Bacteria 23143
81 Ga0105237_10003264 3300009545 Bacteria 19375
82 Ga0105237_10009567 3300009545 Bacteria 10376
83 Ga0105237_10017775 3300009545 Bacteria 7372
84 Ga0105237_10018280 3300009545 Bacteria 7254
85 Ga0105237_10019775 3300009545 Bacteria 6952
86 Ga0105237_10035203 3300009545 Bacteria 5068
87 Ga0105237_10391806 3300009545 Bacteria 1394
88 Ga0105237_10447778 3300009545 Bacteria 1297
89 Ga0105238_10009925 3300009551 Bacteria 9546
90 Ga0105238_10048865 3300009551 Bacteria 4262
91 Ga0105238_10428218 3300009551 Bacteria 1319
92 Ga0105239_10000001 3300010375 Bacteria 617353
93 Ga0105239_10000007 3300010375 Bacteria 385297
94 Ga0105239_10000212 3300010375 Bacteria 85747
95 Ga0105239_10000352 3300010375 Bacteria 67522
96 Ga0105239_10019157 3300010375 Bacteria 7561
97 Ga0105239_10041432 3300010375 Bacteria 5047
98 Ga0105239_10042526 3300010375 Bacteria 4979
99 Ga0105239_10056316 3300010375 Bacteria 4313
100 Ga0105239_10217225 3300010375 Bacteria 2144
101 Ga0157373_10000881 3300013100 Bacteria 23243
102 Ga0157373_10196817 3300013100 Bacteria 1421
103 Ga0157371_10002946 3300013102 Bacteria 15852
104 Ga0157371_10005024 3300013102 Bacteria 11332
105 Ga0157371_10012339 3300013102 Bacteria 6538
106 Ga0157370_10036373 3300013104 Bacteria 4778
107 Ga0157370_10057969 3300013104 Bacteria 3681
108 Ga0157370_10110972 3300013104 Bacteria 2564
109 Ga0157370_10357504 3300013104 Unclassified 1346
110 Ga0157369_10014221 3300013105 Bacteria 8990
111 Ga0157369_10153439 3300013105 Bacteria 2434
112 Ga0157369_10187024 3300013105 Bacteria 2178
113 Ga0157374_10001060 3300013296 Bacteria 23873
114 Ga0157374_10002738 3300013296 Bacteria 14800
115 Ga0157374_10009161 3300013296 Bacteria 8485
116 Ga0157374_10257279 3300013296 Bacteria 1719
117 Ga0157374_10428607 3300013296 Unclassified 1322
118 Ga0157378_10009516 3300013297 Bacteria 8462
119 Ga0157378_10134718 3300013297 Bacteria 2289
120 Ga0163162_10000010 3300013306 Bacteria 302032
121 Ga0163162_10010391 3300013306 Bacteria 9047
122 Ga0163162_10010995 3300013306 Bacteria 8815
123 Ga0163162_10304285 3300013306 Bacteria 1726
124 Ga0163162_11670198 3300013306 Bacteria 727
125 Ga0157372_10000073 3300013307 Bacteria 107356
126 Ga0157372_10000173 3300013307 Bacteria 71416
127 Ga0157372_10002719 3300013307 Bacteria 19140
128 Ga0157375_10011593 3300013308 Bacteria 7788
129 Ga0157375_10031510 3300013308 Bacteria 5014
130 Ga0157377_10011791 3300014745 Bacteria 4373
131 Ga0157376_10331741 3300014969 Bacteria 1450
132 Ga0182007_10098898 3300015262 Unclassified 965
133 Ga0182005_1000371 3300015265 Bacteria 24821
134 Ga0163161_10024612 3300017792 Bacteria 4254
135 Ga0206355_1025687 3300020076 Bacteria 1538
136 Ga0206351_10763673 3300020077 Bacteria 1818
137 Ga0154015_1180645 3300020610 Bacteria 1921
138 Ga0213872_10008537 3300021361 Bacteria 4954
139 Ga0224712_10063924 3300022467 Bacteria 1475
140 Ga0209436_101755 3300025208 Bacteria 7118
141 Ga0209563_112929 3300025230 Bacteria 1121
142 Ga0207427_100025 3300025231 Bacteria 433726
143 Ga0209437_100010 3300025233 Bacteria 838447
144 Ga0209437_100148 3300025233 Bacteria 158795
145 Ga0209258_100098 3300025242 Bacteria 215216
146 Ga0209148_1000120 3300025254 Bacteria 186836
147 Ga0209129_1008736 3300025258 Bacteria 2772
148 Ga0209233_1000017 3300025261 Bacteria 898076
149 Ga0209233_1009172 3300025261 Bacteria 3024
150 Ga0209455_1006632 3300025272 Bacteria 3393
151 Ga0209758_1031512 3300025297 Bacteria 2173
152 Ga0207426_1005661 3300025302 Bacteria 5645
153 Ga0207647_10000680 3300025904 Bacteria 26722
154 Ga0207647_10005778 3300025904 Bacteria 9026
155 Ga0207645_10000591 3300025907 Bacteria 30054
156 Ga0207705_10000107 3300025909 Bacteria 94984
157 Ga0207705_10077312 3300025909 Unclassified 2421
158 Ga0207705_10128354 3300025909 Bacteria 1886
159 Ga0207654_10032090 3300025911 Bacteria 2898
160 Ga0207707_10119043 3300025912 Unclassified 2308
161 Ga0207695_10000019 3300025913 Bacteria 732137
162 Ga0207695_10039525 3300025913 Bacteria 5070
163 Ga0207695_10101889 3300025913 Bacteria 2865
164 Ga0207695_10138742 3300025913 Bacteria 2382
165 Ga0207695_10177055 3300025913 Unclassified 2055
166 Ga0207695_10649054 3300025913 Bacteria 936
167 Ga0207671_10002702 3300025914 Bacteria 18606
168 Ga0207671_10003542 3300025914 Bacteria 15486
169 Ga0207671_10007187 3300025914 Bacteria 9704
170 Ga0207671_10010478 3300025914 Bacteria 7643
171 Ga0207671_10021139 3300025914 Bacteria 4942
172 Ga0207657_10029807 3300025919 Bacteria 4961
173 Ga0207657_10233450 3300025919 Bacteria 1471
174 Ga0207652_10006186 3300025921 Bacteria 9672
175 Ga0207652_10072004 3300025921 Bacteria 3004
176 Ga0207694_10018923 3300025924 Bacteria 5206
177 Ga0207694_10301820 3300025924 Bacteria 1319
178 Ga0207644_10018029 3300025931 Bacteria 4772
179 Ga0207690_10000272 3300025932 Bacteria 36902
180 Ga0207690_10108403 3300025932 Bacteria 1996
181 Ga0207706_10000057 3300025933 Bacteria 112805
182 Ga0207686_10366518 3300025934 Bacteria 1089
183 Ga0207669_10732026 3300025937 Bacteria 815
184 Ga0207704_10000266 3300025938 Bacteria 25142
185 Ga0207667_10002856 3300025949 Bacteria 21432
186 Ga0207667_10054548 3300025949 Bacteria 4204
187 Ga0207667_10104675 3300025949 Bacteria 2919
188 Ga0207667_10582703 3300025949 Bacteria 1129
189 Ga0207651_10096595 3300025960 Bacteria 2179
190 Ga0207640_10005183 3300025981 Bacteria 7090
191 Ga0207639_10032979 3300026041 Bacteria 3817
192 Ga0207639_10053759 3300026041 Bacteria 3074
193 Ga0207702_10109031 3300026078 Bacteria 2458
194 Ga0207648_10005635 3300026089 Bacteria 12581
195 Ga0207674_10269625 3300026116 Bacteria 1650
196 Ga0207683_10008342 3300026121 Bacteria 8861
197 Ga0207698_10079738 3300026142 Bacteria 2634
198 Ga0268266_10000030 3300028379 Bacteria 417120
199 Ga0307517_10001373 3300028786 Bacteria 40930
200 Ga0307515_10000376 3300028794 Bacteria 109190
201 Ga0307515_10005206 3300028794 Bacteria 26435
202 Ga0307515_10104050 3300028794 Bacteria 3397
203 Ga0307515_10176904 3300028794 Bacteria 2101
204 Ga0307512_10185342 3300030522 Bacteria 1160
205 Ga0307507_10000032 3300033179 Bacteria 194155
206 Ga0307510_10010205 3300033180 Bacteria 11166
207 Ga0373941_0087668 3300035115 Bacteria 1062
208 Ga0395899_0000002 3300037312 Bacteria 1324310
209 Ga0395899_0000887 3300037312 Bacteria 28407
210 Ga0395899_0007044 3300037312 Bacteria 8701
211 Ga0395899_0022353 3300037312 Bacteria 4796
212 Ga0395900_0000143 3300037418 Bacteria 120234
213 Ga0395900_0010532 3300037418 Bacteria 9458
214 Ga0395900_0109690 3300037418 Bacteria 2835
215 Ga0395898_0070858 3300037466 Bacteria 3369
216 Ga0395905_0000175 3300037471 Bacteria 104024
217 Ga0395905_0002359 3300037471 Bacteria 21041
218 Ga0395901_0000313 3300038443 Bacteria 59766
219 Ga0395901_0024555 3300038443 Bacteria 6189
220 Ga0395901_0150469 3300038443 Bacteria 2446
221 Ga0436361_0924736 3300039447 Bacteria 22942
222 Ga0439448_0001918 3300042005 Bacteria 5538
223 Ga0466969_0056993 3300044656 Bacteria 1906
224 Ga0466966_0013641 3300044684 Bacteria 5376
225 Ga0466961_0397903 3300044693 Unclassified 836
226 Ga0466970_0233450 3300044765 Unclassified 1028
227 Ga0466959_0036512 3300045049 Bacteria 3632
228 Ga0466959_0045498 3300045049 Bacteria 3232
229 Ga0466959_0435701 3300045049 Bacteria 889
230 Ga0466958_0017493 3300045836 Bacteria 4146
231 Ga0495627_008925 3300046453 Bacteria 3711
232 Ga0495651_0097231 3300046462 Bacteria 2199
233 Ga0495650_0000162 3300046471 Bacteria 148927
234 Ga0495585_0000262 3300046492 Bacteria 53542
235 Ga0495585_0000853 3300046492 Bacteria 26111
236 Ga0495596_0053928 3300046500 Unclassified 1573
237 Ga0495583_0023670 3300046506 Bacteria 3102
238 Ga0495606_0000033 3300046507 Bacteria 247739
239 Ga0495606_0041225 3300046507 Bacteria 3097
240 Ga0495606_0093103 3300046507 Bacteria 1849
241 Ga0495606_0139359 3300046507 Bacteria 1434
242 Ga0495610_0018447 3300046512 Bacteria 3940
243 Ga0495616_0004223 3300046513 Bacteria 9091
244 Ga0495628_0078820 3300046516 Bacteria 2562
245 Ga0495632_0068243 3300046519 Unclassified 1714
246 Ga0495632_0110443 3300046519 Bacteria 1291
247 Ga0495648_0012159 3300046524 Bacteria 6439
248 Ga0495648_0141526 3300046524 Bacteria 1265
249 Ga0495642_0051515 3300046528 Bacteria 1694
250 Ga0495652_0151417 3300046529 Bacteria 1812
251 Ga0495654_0058710 3300046530 Bacteria 1855
252 Ga0495609_0071647 3300046538 Bacteria 1522
253 Ga0495633_0000516 3300046558 Bacteria 38775
254 Ga0495633_0014364 3300046558 Bacteria 4144
255 Ga0495668_0000009 3300046616 Bacteria 492623
256 Ga0495625_0000131 3300046660 Bacteria 117738
257 Ga0495625_0000951 3300046660 Bacteria 38714
258 Ga0495625_0042570 3300046660 Bacteria 3299
259 Ga0495625_0047979 3300046660 Bacteria 3077
260 Ga0495625_0148198 3300046660 Bacteria 1579
261 Ga0495661_0000134 3300046665 Bacteria 87487
262 Ga0495661_0003857 3300046665 Bacteria 10954
263 Ga0495661_0119110 3300046665 Bacteria 1460
264 Ga0495649_0000009 3300046694 Bacteria 451725
265 Ga0495660_0022374 3300046810 Bacteria 3610
266 Ga0495683_0181131 3300047323 Bacteria 962
267 Ga0495687_003112 3300047443 Bacteria 12401
268 Ga0495687_022980 3300047443 Bacteria 2985
269 Ga0495687_085242 3300047443 Bacteria 1225
270 Ga0495673_0021761 3300047469 Bacteria 3158
271 Ga0495686_0000843 3300047472 Bacteria 39372
272 Ga0495686_0000973 3300047472 Bacteria 35208
273 Ga0495686_0035201 3300047472 Bacteria 3221
274 Ga0495614_0017847 3300048089 Bacteria 3078
275 Ga0496121_0000026 3300048924 Bacteria 450157
276 Ga0501238_005727 3300049671 Bacteria 1584
277 nmdc:mga0k408_574_c3 3300050493 Bacteria 6199
278 Ga0500646_0002414 3300053090 Bacteria 4855
279 Ga0500583_0003889 3300053092 Bacteria 4784
280 Ga0500569_000136 3300053109 Bacteria 11674
281 Ga0500607_038083 3300053121 Bacteria 2618
282 Ga0500608_001479 3300053122 Bacteria 8394
283 Ga0500618_009521 3300053125 Bacteria 2648
284 Ga0500618_060403 3300053125 Bacteria 852
285 Ga0500658_0002204 3300053134 Bacteria 7564
286 Ga0500559_0044271 3300053136 Bacteria 1946
287 Ga0500577_0006891 3300053142 Bacteria 3157
288 Ga0500616_0021179 3300053153 Bacteria 3649
289 Ga0500622_0000295 3300053156 Bacteria 51064
290 Ga0500622_0001079 3300053156 Bacteria 22688
291 Ga0500624_000118 3300053157 Bacteria 35980
292 Ga0500633_0000392 3300053160 Bacteria 6768
293 Ga0500636_0075202 3300053177 Bacteria 1954
294 Ga0500661_005435 3300055283 Bacteria 2381

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10000212 Ga0105239_1000021237 179
2 3300037418 Ga0395900_0109690 Ga0395900_0109690_151_765 186
3 3300047443 Ga0495687_085242 Ga0495687_085242_45_647 193
4 3300046524 Ga0495648_0141526 Ga0495648_0141526_669_1253 194
5 3300047472 Ga0495686_0000973 Ga0495686_0000973_4022_4621 199
6 3300053136 Ga0500559_0044271 Ga0500559_0044271_1130_1801 201
7 3300053177 Ga0500636_0075202 Ga0500636_0075202_146_817 201
8 3300025921 Ga0207652_10072004 Ga0207652_100720042 203
9 3300003323 rootH1_10193575 rootH1_101935752 204
10 3300013297 Ga0157378_10134718 Ga0157378_101347182 204
11 3300013308 Ga0157375_10031510 Ga0157375_100315103 204
12 3300003320 rootH2_10089997 rootH2_100899972 205
13 3300005327 Ga0070658_10000014 Ga0070658_10000014167 205
14 3300005563 Ga0068855_100115178 Ga0068855_1001151782 205
15 3300009093 Ga0105240_10221296 Ga0105240_102212964 205
16 3300009174 Ga0105241_10047228 Ga0105241_100472283 205
17 3300013296 Ga0157374_10009161 Ga0157374_100091615 205
18 3300025909 Ga0207705_10000107 Ga0207705_1000010724 205
19 3300025949 Ga0207667_10104675 Ga0207667_101046754 205
20 3300045049 Ga0466959_0435701 Ga0466959_0435701_111_731 205
21 3300046660 Ga0495625_0148198 Ga0495625_0148198_285_968 205
22 3300053092 Ga0500583_0003889 Ga0500583_0003889_1221_1904 205
23 3300003316 rootH1_10077670 rootH1_100776703 206
24 3300009093 Ga0105240_10000010 Ga0105240_1000001067 206
25 3300009174 Ga0105241_10222825 Ga0105241_102228252 206
26 3300009545 Ga0105237_10002429 Ga0105237_1000242917 206
27 3300009545 Ga0105237_10391806 Ga0105237_103918061 206
28 3300009551 Ga0105238_10428218 Ga0105238_104282182 206
29 3300010375 Ga0105239_10041432 Ga0105239_100414324 206
30 3300025913 Ga0207695_10000019 Ga0207695_10000019384 206
31 3300025914 Ga0207671_10007187 Ga0207671_100071874 206
32 3300025924 Ga0207694_10301820 Ga0207694_103018202 206
33 3300035115 Ga0373941_0087668 Ga0373941_0087668_247_870 206
34 3300037312 Ga0395899_0022353 Ga0395899_0022353_993_1613 206
35 3300037418 Ga0395900_0010532 Ga0395900_0010532_3953_4573 206
36 3300037471 Ga0395905_0002359 Ga0395905_0002359_4858_5478 206
37 3300038443 Ga0395901_0024555 Ga0395901_0024555_4848_5468 206
38 3300005262 Ga0065165_1012934 Ga0065165_10129343 207
39 3300025208 Ga0209436_101755 Ga0209436_1017554 207
40 3300025302 Ga0207426_1005661 Ga0207426_10056614 207
41 3300044765 Ga0466970_0233450 Ga0466970_0233450_292_936 210
42 3300045049 Ga0466959_0036512 Ga0466959_0036512_2568_3212 210
43 3300028794 Ga0307515_10104050 Ga0307515_101040502 212
44 iso_pu_bacteria 2818991442 2819575742 212
45 iso_pu_bacteria 2821136567 2821138294 212
46 iso_pu_bacteria 2904467357 2904469090 212
47 3300005355 Ga0070671_100011944 Ga0070671_1000119441 213
48 3300005457 Ga0070662_100062444 Ga0070662_1000624442 213
49 3300009093 Ga0105240_10018922 Ga0105240_100189229 213
50 3300009093 Ga0105240_10034933 Ga0105240_100349332 213
51 3300009148 Ga0105243_10048091 Ga0105243_100480912 213
52 3300009174 Ga0105241_10012557 Ga0105241_100125572 213
53 3300009545 Ga0105237_10009567 Ga0105237_100095677 213
54 3300009551 Ga0105238_10009925 Ga0105238_100099254 213
55 3300010375 Ga0105239_10042526 Ga0105239_100425264 213
56 3300013296 Ga0157374_10001060 Ga0157374_1000106020 213
57 3300013297 Ga0157378_10009516 Ga0157378_100095162 213
58 3300013306 Ga0163162_10000010 Ga0163162_10000010268 213
59 3300014969 Ga0157376_10331741 Ga0157376_103317412 213
60 3300025913 Ga0207695_10101889 Ga0207695_101018892 213
61 3300025931 Ga0207644_10018029 Ga0207644_100180292 213
62 3300037312 Ga0395899_0000887 Ga0395899_0000887_13795_14436 213
63 3300037418 Ga0395900_0000143 Ga0395900_0000143_14963_15604 213
64 3300037466 Ga0395898_0070858 Ga0395898_0070858_882_1523 213
65 3300037471 Ga0395905_0000175 Ga0395905_0000175_17077_17718 213
66 3300038443 Ga0395901_0000313 Ga0395901_0000313_13961_14602 213
67 3300003761 Ga0055535_1003443 Ga0055535_10034432 214
68 3300025242 Ga0209258_100098 Ga0209258_100098120 214
69 3300025254 Ga0209148_1000120 Ga0209148_100012094 214
70 3300046519 Ga0495632_0068243 Ga0495632_0068243_390_1037 214
71 3300053090 Ga0500646_0002414 Ga0500646_0002414_3735_4382 214
72 3300053109 Ga0500569_000136 Ga0500569_000136_10342_10989 214
73 3300053121 Ga0500607_038083 Ga0500607_038083_306_953 214
74 3300053134 Ga0500658_0002204 Ga0500658_0002204_236_883 214
75 3300053153 Ga0500616_0021179 Ga0500616_0021179_1749_2396 214
76 3300005539 Ga0068853_100074604 Ga0068853_1000746042 215
77 3300005548 Ga0070665_100000032 Ga0070665_100000032194 215
78 3300013104 Ga0157370_10110972 Ga0157370_101109723 215
79 3300026041 Ga0207639_10032979 Ga0207639_100329792 215
80 3300028379 Ga0268266_10000030 Ga0268266_10000030136 215
81 3300028786 Ga0307517_10001373 Ga0307517_1000137332 215
82 3300033180 Ga0307510_10010205 Ga0307510_100102055 215
83 3300047323 Ga0495683_0181131 Ga0495683_0181131_292_939 215
84 3300053160 Ga0500633_0000392 Ga0500633_0000392_3435_4106 215
85 iso_pu_bacteria 2977232053 2977236456 215
86 3300003322 rootL2_10021199 rootL2_100211991 216
87 3300021361 Ga0213872_10008537 Ga0213872_100085372 216
88 3300025297 Ga0209758_1031512 Ga0209758_10315122 216
89 3300039447 Ga0436361_0924736 Ga0436361_0924736_20709_21380 216
90 3300046453 Ga0495627_008925 Ga0495627_008925_197_859 216
91 3300046558 Ga0495633_0000516 Ga0495633_0000516_11897_12559 216
92 3300048924 Ga0496121_0000026 Ga0496121_0000026_419595_420248 216
93 3300053156 Ga0500622_0000295 Ga0500622_0000295_30857_31525 216
94 iso_pu_bacteria 2599185184 2599480426 216
95 iso_pu_bacteria 2852623160 2852625046 216
96 iso_pu_bacteria 2884933994 2884934063 216
97 iso_pu_bacteria 2919437846 2919438283 216
98 iso_pu_bacteria 2928078545 2928083333 216
99 iso_pu_bacteria 2928147474 2928151405 216
100 iso_pu_bacteria 2932082852 2932087324 216
101 3300001990 JGI24737J22298_10056092 JGI24737J22298_100560922 217
102 3300001991 JGI24743J22301_10043479 JGI24743J22301_100434792 217
103 3300002077 JGI24744J21845_10016587 JGI24744J21845_100165872 217
104 3300003320 rootH2_10005336 rootH2_1000533669 217
105 3300005328 Ga0070676_10000729 Ga0070676_100007299 217
106 3300005354 Ga0070675_100307288 Ga0070675_1003072882 217
107 3300005456 Ga0070678_100015591 Ga0070678_1000155913 217
108 3300005457 Ga0070662_100000014 Ga0070662_10000001457 217
109 3300005459 Ga0068867_100001403 Ga0068867_10000140312 217
110 3300005539 Ga0068853_100003643 Ga0068853_1000036434 217
111 3300005563 Ga0068855_100044045 Ga0068855_1000440452 217
112 3300005563 Ga0068855_100999824 Ga0068855_1009998242 217
113 3300005616 Ga0068852_100011199 Ga0068852_1000111994 217
114 3300005841 Ga0068863_100364415 Ga0068863_1003644152 217
115 3300006237 Ga0097621_100010173 Ga0097621_1000101734 217
116 3300006358 Ga0068871_100000306 Ga0068871_10000030623 217
117 3300006881 Ga0068865_100007153 Ga0068865_1000071534 217
118 3300009093 Ga0105240_10058849 Ga0105240_100588493 217
119 3300009093 Ga0105240_11097073 Ga0105240_110970731 217
120 3300009098 Ga0105245_10800799 Ga0105245_108007991 217
121 3300009174 Ga0105241_10002362 Ga0105241_1000236212 217
122 3300009545 Ga0105237_10003264 Ga0105237_100032642 217
123 3300010375 Ga0105239_10056316 Ga0105239_100563164 217
124 3300013100 Ga0157373_10196817 Ga0157373_101968172 217
125 3300013105 Ga0157369_10187024 Ga0157369_101870242 217
126 3300013296 Ga0157374_10002738 Ga0157374_1000273811 217
127 3300013296 Ga0157374_10428607 Ga0157374_104286073 217
128 3300013306 Ga0163162_10304285 Ga0163162_103042852 217
129 3300013308 Ga0157375_10011593 Ga0157375_100115934 217
130 3300014745 Ga0157377_10011791 Ga0157377_100117913 217
131 3300015262 Ga0182007_10098898 Ga0182007_100988981 217
132 3300025904 Ga0207647_10000680 Ga0207647_1000068018 217
133 3300025907 Ga0207645_10000591 Ga0207645_100005918 217
134 3300025911 Ga0207654_10032090 Ga0207654_100320902 217
135 3300025913 Ga0207695_10039525 Ga0207695_100395252 217
136 3300025913 Ga0207695_10177055 Ga0207695_101770551 217
137 3300025913 Ga0207695_10649054 Ga0207695_106490542 217
138 3300025914 Ga0207671_10010478 Ga0207671_100104785 217
139 3300025924 Ga0207694_10018923 Ga0207694_100189235 217
140 3300025933 Ga0207706_10000057 Ga0207706_1000005779 217
141 3300025934 Ga0207686_10366518 Ga0207686_103665181 217
142 3300025938 Ga0207704_10000266 Ga0207704_100002664 217
143 3300025949 Ga0207667_10582703 Ga0207667_105827032 217
144 3300025960 Ga0207651_10096595 Ga0207651_100965952 217
145 3300026041 Ga0207639_10053759 Ga0207639_100537592 217
146 3300026089 Ga0207648_10005635 Ga0207648_1000563512 217
147 3300026121 Ga0207683_10008342 Ga0207683_100083424 217
148 3300026142 Ga0207698_10079738 Ga0207698_100797382 217
149 3300042005 Ga0439448_0001918 Ga0439448_0001918_4810_5463 217
150 3300046500 Ga0495596_0053928 Ga0495596_0053928_101_754 217
151 3300046519 Ga0495632_0110443 Ga0495632_0110443_428_1081 217
152 3300046665 Ga0495661_0000134 Ga0495661_0000134_62666_63319 217
153 3300047443 Ga0495687_003112 Ga0495687_003112_10774_11427 217
154 3300053122 Ga0500608_001479 Ga0500608_001479_1663_2316 217
155 3300009093 Ga0105240_10159809 Ga0105240_101598092 218
156 3300010375 Ga0105239_10000001 Ga0105239_10000001296 218
157 3300013100 Ga0157373_10000881 Ga0157373_1000088123 218
158 3300013102 Ga0157371_10002946 Ga0157371_1000294620 218
159 3300013104 Ga0157370_10036373 Ga0157370_100363734 218
160 3300013105 Ga0157369_10153439 Ga0157369_101534392 218
161 3300013307 Ga0157372_10000173 Ga0157372_1000017336 218
162 3300025261 Ga0209233_1009172 Ga0209233_10091722 218
163 3300038443 Ga0395901_0150469 Ga0395901_0150469_1706_2365 218
164 3300002737 JGI25162J39368_1000615 JGI25162J39368_100061513 219
165 3300002772 JGI25164J39214_1001761 JGI25164J39214_10017613 219
166 3300003214 JGI25165J46597_1000157 JGI25165J46597_100015730 219
167 3300003320 rootH2_10268268 rootH2_102682682 219
168 3300003323 rootH1_10005851 rootH1_1000585189 219
169 3300003323 rootH1_10017654 rootH1_100176542 219
170 3300003323 rootH1_10323207 rootH1_103232072 219
171 3300005288 Ga0065714_10023151 Ga0065714_100231512 219
172 3300005339 Ga0070660_100004154 Ga0070660_10000415411 219
173 3300005530 Ga0070679_100015039 Ga0070679_1000150394 219
174 3300005563 Ga0068855_100000662 Ga0068855_1000006627 219
175 3300005614 Ga0068856_100025316 Ga0068856_1000253162 219
176 3300009093 Ga0105240_10042668 Ga0105240_100426683 219
177 3300013104 Ga0157370_10357504 Ga0157370_103575042 219
178 3300013306 Ga0163162_10010391 Ga0163162_100103916 219
179 3300020076 Ga0206355_1025687 Ga0206355_10256872 219
180 3300020077 Ga0206351_10763673 Ga0206351_107636732 219
181 3300020610 Ga0154015_1180645 Ga0154015_11806452 219
182 3300022467 Ga0224712_10063924 Ga0224712_100639241 219
183 3300025230 Ga0209563_112929 Ga0209563_1129292 219
184 3300025231 Ga0207427_100025 Ga0207427_100025112 219
185 3300025233 Ga0209437_100010 Ga0209437_100010374 219
186 3300025261 Ga0209233_1000017 Ga0209233_1000017387 219
187 3300025272 Ga0209455_1006632 Ga0209455_10066322 219
188 3300025909 Ga0207705_10128354 Ga0207705_101283542 219
189 3300025912 Ga0207707_10119043 Ga0207707_101190432 219
190 3300025919 Ga0207657_10029807 Ga0207657_100298075 219
191 3300025921 Ga0207652_10006186 Ga0207652_100061866 219
192 3300025949 Ga0207667_10002856 Ga0207667_1000285610 219
193 3300026078 Ga0207702_10109031 Ga0207702_101090311 219
194 3300030522 Ga0307512_10185342 Ga0307512_101853422 219
195 3300044656 Ga0466969_0056993 Ga0466969_0056993_614_1273 219
196 3300044693 Ga0466961_0397903 Ga0466961_0397903_159_818 219
197 3300045049 Ga0466959_0045498 Ga0466959_0045498_2112_2771 219
198 3300046471 Ga0495650_0000162 Ga0495650_0000162_86995_87675 219
199 3300046492 Ga0495585_0000262 Ga0495585_0000262_31062_31742 219
200 3300046506 Ga0495583_0023670 Ga0495583_0023670_1393_2073 219
201 3300046507 Ga0495606_0000033 Ga0495606_0000033_215160_215840 219
202 3300046507 Ga0495606_0139359 Ga0495606_0139359_688_1368 219
203 3300046512 Ga0495610_0018447 Ga0495610_0018447_3103_3783 219
204 3300046513 Ga0495616_0004223 Ga0495616_0004223_5499_6179 219
205 3300046558 Ga0495633_0014364 Ga0495633_0014364_875_1555 219
206 3300046660 Ga0495625_0000131 Ga0495625_0000131_92948_93628 219
207 3300046660 Ga0495625_0042570 Ga0495625_0042570_883_1557 219
208 3300046665 Ga0495661_0003857 Ga0495661_0003857_8960_9640 219
209 3300046665 Ga0495661_0119110 Ga0495661_0119110_94_753 219
210 3300046694 Ga0495649_0000009 Ga0495649_0000009_92938_93618 219
211 3300047469 Ga0495673_0021761 Ga0495673_0021761_607_1287 219
212 3300049671 Ga0501238_005727 Ga0501238_005727_531_1190 219
213 3300053125 Ga0500618_009521 Ga0500618_009521_1045_1725 219
214 3300053125 Ga0500618_060403 Ga0500618_060403_33_713 219
215 3300053142 Ga0500577_0006891 Ga0500577_0006891_2051_2734 219
216 3300053156 Ga0500622_0001079 Ga0500622_0001079_17925_18599 219
217 3300001990 JGI24737J22298_10000071 JGI24737J22298_1000007119 220
218 3300002067 JGI24735J21928_10000013 JGI24735J21928_10000013167 220
219 3300002737 JGI25162J39368_1000107 JGI25162J39368_100010749 220
220 3300003316 rootH1_10003553 rootH1_1000355313 220
221 3300003320 rootH2_10100104 rootH2_101001041 220
222 3300003322 rootL2_10123764 rootL2_101237644 220
223 3300005288 Ga0065714_10110354 Ga0065714_101103541 220
224 3300005288 Ga0065714_10110659 Ga0065714_101106592 220
225 3300005356 Ga0070674_100733756 Ga0070674_1007337561 220
226 3300005366 Ga0070659_100138501 Ga0070659_1001385011 220
227 3300005539 Ga0068853_100122825 Ga0068853_1001228252 220
228 3300005578 Ga0068854_100005184 Ga0068854_1000051844 220
229 3300005614 Ga0068856_100191627 Ga0068856_1001916273 220
230 3300005842 Ga0068858_100223676 Ga0068858_1002236762 220
231 3300006195 Ga0075366_10004640 Ga0075366_100046403 220
232 3300006195 Ga0075366_10006004 Ga0075366_100060044 220
233 3300006195 Ga0075366_10100269 Ga0075366_101002692 220
234 3300009093 Ga0105240_10059864 Ga0105240_100598642 220
235 3300009093 Ga0105240_10276746 Ga0105240_102767462 220
236 3300009545 Ga0105237_10017775 Ga0105237_100177758 220
237 3300009545 Ga0105237_10018280 Ga0105237_100182803 220
238 3300009545 Ga0105237_10019775 Ga0105237_100197757 220
239 3300009545 Ga0105237_10035203 Ga0105237_100352033 220
240 3300009545 Ga0105237_10447778 Ga0105237_104477781 220
241 3300009551 Ga0105238_10048865 Ga0105238_100488652 220
242 3300010375 Ga0105239_10000007 Ga0105239_10000007163 220
243 3300010375 Ga0105239_10000352 Ga0105239_1000035233 220
244 3300010375 Ga0105239_10019157 Ga0105239_100191576 220
245 3300010375 Ga0105239_10217225 Ga0105239_102172252 220
246 3300013102 Ga0157371_10012339 Ga0157371_100123392 220
247 3300013306 Ga0163162_10010995 Ga0163162_100109953 220
248 3300013306 Ga0163162_11670198 Ga0163162_116701981 220
249 3300013307 Ga0157372_10002719 Ga0157372_1000271911 220
250 3300015265 Ga0182005_1000371 Ga0182005_100037112 220
251 3300017792 Ga0163161_10024612 Ga0163161_100246122 220
252 3300025233 Ga0209437_100148 Ga0209437_10014893 220
253 3300025258 Ga0209129_1008736 Ga0209129_10087364 220
254 3300025904 Ga0207647_10005778 Ga0207647_100057787 220
255 3300025913 Ga0207695_10138742 Ga0207695_101387421 220
256 3300025914 Ga0207671_10002702 Ga0207671_100027028 220
257 3300025914 Ga0207671_10003542 Ga0207671_100035428 220
258 3300025914 Ga0207671_10021139 Ga0207671_100211392 220
259 3300025932 Ga0207690_10108403 Ga0207690_101084032 220
260 3300025937 Ga0207669_10732026 Ga0207669_107320261 220
261 3300025949 Ga0207667_10054548 Ga0207667_100545483 220
262 3300025981 Ga0207640_10005183 Ga0207640_100051833 220
263 3300026116 Ga0207674_10269625 Ga0207674_102696252 220
264 3300028794 Ga0307515_10000376 Ga0307515_1000037697 220
265 3300028794 Ga0307515_10005206 Ga0307515_100052066 220
266 3300028794 Ga0307515_10176904 Ga0307515_101769042 220
267 3300033179 Ga0307507_10000032 Ga0307507_10000032139 220
268 3300046462 Ga0495651_0097231 Ga0495651_0097231_724_1389 220
269 3300046492 Ga0495585_0000853 Ga0495585_0000853_18184_18849 220
270 3300046507 Ga0495606_0041225 Ga0495606_0041225_2095_2778 220
271 3300046507 Ga0495606_0093103 Ga0495606_0093103_747_1415 220
272 3300046516 Ga0495628_0078820 Ga0495628_0078820_399_1064 220
273 3300046524 Ga0495648_0012159 Ga0495648_0012159_2587_3252 220
274 3300046528 Ga0495642_0051515 Ga0495642_0051515_662_1330 220
275 3300046529 Ga0495652_0151417 Ga0495652_0151417_725_1390 220
276 3300046530 Ga0495654_0058710 Ga0495654_0058710_234_899 220
277 3300046538 Ga0495609_0071647 Ga0495609_0071647_347_1012 220
278 3300046616 Ga0495668_0000009 Ga0495668_0000009_221420_222082 220
279 3300046660 Ga0495625_0000951 Ga0495625_0000951_21004_21669 220
280 3300046660 Ga0495625_0047979 Ga0495625_0047979_795_1460 220
281 3300046810 Ga0495660_0022374 Ga0495660_0022374_1306_1989 220
282 3300047443 Ga0495687_022980 Ga0495687_022980_1970_2644 220
283 3300047472 Ga0495686_0000843 Ga0495686_0000843_15120_15782 220
284 3300047472 Ga0495686_0035201 Ga0495686_0035201_1805_2467 220
285 3300048089 Ga0495614_0017847 Ga0495614_0017847_347_1012 220
286 3300050493 nmdc:mga0k408_574_c3 nmdc:mga0k408_574_c3_835_1512 220
287 3300053157 Ga0500624_000118 Ga0500624_000118_24222_24887 220
288 3300055283 Ga0500661_005435 Ga0500661_005435_283_1023 220
289 iso_pu_bacteria 2929239360 2929242964 220
290 3300001979 JGI24740J21852_10031384 JGI24740J21852_100313842 221
291 3300003323 rootH1_10043200 rootH1_100432002 221
292 3300005327 Ga0070658_10053216 Ga0070658_100532165 221
293 3300005339 Ga0070660_100052135 Ga0070660_1000521355 221
294 3300005366 Ga0070659_100000242 Ga0070659_10000024226 221
295 3300013102 Ga0157371_10005024 Ga0157371_100050245 221
296 3300013104 Ga0157370_10057969 Ga0157370_100579691 221
297 3300013105 Ga0157369_10014221 Ga0157369_100142216 221
298 3300013296 Ga0157374_10257279 Ga0157374_102572792 221
299 3300013307 Ga0157372_10000073 Ga0157372_1000007318 221
300 3300025909 Ga0207705_10077312 Ga0207705_100773122 221
301 3300025919 Ga0207657_10233450 Ga0207657_102334502 221
302 3300025932 Ga0207690_10000272 Ga0207690_100002723 221
303 3300037312 Ga0395899_0000002 Ga0395899_0000002_539567_540241 221
304 3300037312 Ga0395899_0007044 Ga0395899_0007044_7019_7684 221
305 3300044684 Ga0466966_0013641 Ga0466966_0013641_364_1029 221
306 3300045836 Ga0466958_0017493 Ga0466958_0017493_1595_2260 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01569

PAP2

PAP2 superfamily

105

231

0.91

PF14378

PAP2_3

PAP2 superfamily

85

223

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ebu-assembly1.cif.gz_A crystal structure of aquifex aeolicus lpxe 0.9228 37 199
6ebu-assembly1.cif.gz_A crystal structure of aquifex aeolicus lpxe 0.8643 37 199
1qhb-assembly1.cif.gz_A vanadium bromoperoxidase from red alga corallina officinalis 0.7952 129 194
4usz-assembly1.cif.gz_A crystal structure of the first bacterial vanadium dependant iodoperoxidase 0.7744 106 195
4cit-assembly1.cif.gz_A crystal structure of the first bacterial vanadium dependant iodoperoxidase 0.7688 106 195
ID Description Score Start End Superfamily
af_A0A0N7KFG1_1_446_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.8423 132 198 1.20.144.10
af_Q9Z186_13_195_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.8009 51 196 1.20.144.10
af_Q75HI8_51_243_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.7895 37 197 1.20.144.10
af_F1R7P4_74_293_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.7866 79 199 1.20.144.10
4citA00 Mainly Alpha;Orthogonal Bundle;Vanadium-containing Chloroperoxidase; domain 2; 0.7688 106 195 1.10.606.20
ID Description Score Start End GO Terms
AF-A0A4Q6EG09-F1-model_v4 Phosphatase PAP2 family protein 0.9951 1 216 GO:0008610
GO:0016020
GO:0016787
GO:1901137
AF-A0A367GSZ2-F1-model_v4 Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein 0.9897 1 218 GO:0008610
GO:0016020
GO:0016787
GO:1901137
AF-A0A4V1ZZM1-F1-model_v4 Phosphatase PAP2 family protein 0.9882 43 218 GO:0008610
GO:0016020
GO:0016787
GO:1901137
AF-A0A2W5HCF9-F1-model_v4 Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein 0.9877 5 218 GO:0008610
GO:0016020
GO:0016787
GO:1901137
AF-A0A1Q3UC48-F1-model_v4 Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein 0.9873 1 218 GO:0008610
GO:0016020
GO:0016787
GO:1901137

Feature Viewer

pLDDT pTM Quality
92.59 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map