F398911

General Info

Members Datasets Scaffolds Average Seq Length
306 207 612 119

Family's Representative Sequence

Representative Sequence 3300053085|Ga0495619_0998543|Ga0495619_0998543_30_395
Length 121
Sequence MPDHLTNTFAALADPTRRAMLTRLSKGQANVSELAKPFLKNMSLPAVTKHVKVLEHAGLITKTREAQWRRCKLNGNALKDAADWMEQYRQFWEESFDRLEVYLKTVTAKQNMKGKKDGRKK

Samples

Sample ID Description Type Environment
1 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
86 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
87 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
138 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
139 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
140 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
141 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
142 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
147 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
148 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
149 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
150 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
153 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
158 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
159 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
200 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
203 2643221593 Lysobacter sp. Root690 Isolate Unclassified
204 2643221674 Devosia sp. Root436 Isolate Unclassified
205 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
206 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
207 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 0
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.23
Nodule 0
Rhizoplane 5.56
Rhizosphere 85.62
Stem 0
Stem Tuber 0
Unclassified 4.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495619_0998543 3300053085 Unclassified 560
2 JGI25151J46595_10001957 3300003187 Bacteria 13005
3 JGI25404J52841_10008168 3300003659 Bacteria 2224
4 Ga0055526_1000004 3300003771 Bacteria 355037
5 Ga0055537_1000242 3300003773 Bacteria 40009
6 Ga0055524_1000004 3300003775 Bacteria 354710
7 Ga0055534_1000011 3300003784 Bacteria 168909
8 Ga0055528_1000015 3300003790 Bacteria 169011
9 Ga0070658_10235578 3300005327 Bacteria 1551
10 Ga0070690_100440315 3300005330 Unclassified 964
11 Ga0068869_100397479 3300005334 Bacteria 1133
12 Ga0068868_100089762 3300005338 Bacteria 2474
13 Ga0070660_100864229 3300005339 Bacteria 762
14 Ga0070661_100444721 3300005344 Bacteria 1030
15 Ga0070675_100980472 3300005354 Bacteria 776
16 Ga0070674_100222868 3300005356 Bacteria 1468
17 Ga0070673_102366950 3300005364 Bacteria 505
18 Ga0070688_100114589 3300005365 Bacteria 1797
19 Ga0070659_100295870 3300005366 Bacteria 1349
20 Ga0070667_100289658 3300005367 Bacteria 1472
21 Ga0070667_100831989 3300005367 Bacteria 858
22 Ga0070713_100209327 3300005436 Bacteria 1765
23 Ga0070713_100432364 3300005436 Bacteria 1234
24 Ga0070710_11047216 3300005437 Bacteria 597
25 Ga0070711_100240506 3300005439 Bacteria 1415
26 Ga0070711_100749369 3300005439 Bacteria 825
27 Ga0070678_100176153 3300005456 Bacteria 1746
28 Ga0070662_101111673 3300005457 Bacteria 678
29 Ga0070685_10039357 3300005466 Bacteria 2685
30 Ga0070685_10490452 3300005466 Bacteria 868
31 Ga0070706_100028396 3300005467 Bacteria 5151
32 Ga0070707_100031399 3300005468 Bacteria 5060
33 Ga0070698_100005925 3300005471 Bacteria 13331
34 Ga0070698_100638997 3300005471 Bacteria 1005
35 Ga0070684_100041059 3300005535 Bacteria 3986
36 Ga0070686_100376779 3300005544 Bacteria 1073
37 Ga0070665_100050301 3300005548 Bacteria 4182
38 Ga0070665_100212285 3300005548 Bacteria 1936
39 Ga0068855_100637170 3300005563 Bacteria 1146
40 Ga0070664_100269732 3300005564 Bacteria 1533
41 Ga0068857_100182158 3300005577 Bacteria 1911
42 Ga0068857_102243581 3300005577 Bacteria 536
43 Ga0068854_100617958 3300005578 Bacteria 927
44 Ga0068856_100243470 3300005614 Bacteria 1813
45 Ga0068856_100260969 3300005614 Bacteria 1748
46 Ga0068856_101816302 3300005614 Bacteria 621
47 Ga0068864_100055543 3300005618 Bacteria 3420
48 Ga0068864_100093539 3300005618 Bacteria 2656
49 Ga0068864_100110759 3300005618 Bacteria 2445
50 Ga0068851_10231421 3300005834 Bacteria 1042
51 Ga0068863_100220669 3300005841 Bacteria 1827
52 Ga0068858_100111766 3300005842 Bacteria 2552
53 Ga0068860_100846832 3300005843 Bacteria 929
54 Ga0081455_10030789 3300005937 Bacteria 4869
55 Ga0081455_10055778 3300005937 Bacteria 3359
56 Ga0081455_10086676 3300005937 Bacteria 2550
57 Ga0081455_10102089 3300005937 Bacteria 2300
58 Ga0081455_10125325 3300005937 Bacteria 2017
59 Ga0081455_10151382 3300005937 Bacteria 1788
60 Ga0081538_10000185 3300005981 Bacteria 68366
61 Ga0081538_10019207 3300005981 Bacteria 5091
62 Ga0081540_1000853 3300005983 Bacteria 27707
63 Ga0070717_10706146 3300006028 Bacteria 916
64 Ga0070717_10926864 3300006028 Bacteria 793
65 Ga0070715_10005732 3300006163 Bacteria 4169
66 Ga0070712_100189157 3300006175 Bacteria 1609
67 Ga0070712_100190379 3300006175 Bacteria 1605
68 Ga0075427_10005412 3300006194 Bacteria 1819
69 Ga0097621_100158561 3300006237 Bacteria 1944
70 Ga0075428_100001455 3300006844 Bacteria 25325
71 Ga0075428_100354736 3300006844 Bacteria 1574
72 Ga0075428_100470028 3300006844 Bacteria 1346
73 Ga0075428_100786807 3300006844 Bacteria 1011
74 Ga0075430_100009396 3300006846 Bacteria 8263
75 Ga0075430_100248991 3300006846 Bacteria 1472
76 Ga0075430_100935976 3300006846 Bacteria 714
77 Ga0075430_100963222 3300006846 Bacteria 703
78 Ga0075431_100020111 3300006847 Bacteria 6818
79 Ga0075431_100026038 3300006847 Bacteria 5997
80 Ga0075431_100044622 3300006847 Bacteria 4572
81 Ga0075431_100085685 3300006847 Bacteria 3252
82 Ga0075431_100203153 3300006847 Bacteria 2027
83 Ga0075431_100317238 3300006847 Bacteria 1572
84 Ga0075431_101064769 3300006847 Bacteria 774
85 Ga0075433_10845792 3300006852 Bacteria 799
86 Ga0075434_100729872 3300006871 Bacteria 1008
87 Ga0075434_101879956 3300006871 Bacteria 605
88 Ga0075429_100004569 3300006880 Bacteria 11894
89 Ga0075429_100402583 3300006880 Bacteria 1199
90 Ga0075429_100590070 3300006880 Bacteria 973
91 Ga0075429_101140052 3300006880 Bacteria 681
92 Ga0105240_10023446 3300009093 Bacteria 8159
93 Ga0105240_12068165 3300009093 Bacteria 591
94 Ga0111539_10782045 3300009094 Bacteria 1111
95 Ga0111539_11608374 3300009094 Bacteria 754
96 Ga0111539_11806099 3300009094 Bacteria 709
97 Ga0105245_10288805 3300009098 Bacteria 1606
98 Ga0105245_10817242 3300009098 Bacteria 971
99 Ga0105247_10550023 3300009101 Bacteria 849
100 Ga0114129_10283315 3300009147 Bacteria 2214
101 Ga0114129_10298909 3300009147 Bacteria 2146
102 Ga0114129_10370532 3300009147 Bacteria 1893
103 Ga0114129_10580741 3300009147 Bacteria 1454
104 Ga0105243_10163433 3300009148 Bacteria 1922
105 Ga0105243_10679863 3300009148 Unclassified 1001
106 Ga0105243_11276726 3300009148 Bacteria 750
107 Ga0105242_10244144 3300009176 Bacteria 1616
108 Ga0105248_10794759 3300009177 Bacteria 1068
109 Ga0105237_10413368 3300009545 Bacteria 1354
110 Ga0105238_10103163 3300009551 Bacteria 2833
111 Ga0105249_10090378 3300009553 Bacteria 2863
112 Ga0105249_10232724 3300009553 Bacteria 1818
113 Ga0105249_11034911 3300009553 Unclassified 890
114 Ga0105239_10256329 3300010375 Bacteria 1965
115 Ga0105239_10324363 3300010375 Bacteria 1737
116 Ga0105246_10393910 3300011119 Bacteria 1148
117 Ga0157373_11570289 3300013100 Bacteria 503
118 Ga0157370_10439716 3300013104 Bacteria 1199
119 Ga0157369_10920138 3300013105 Bacteria 897
120 Ga0157369_11585000 3300013105 Bacteria 666
121 Ga0157374_10356138 3300013296 Bacteria 1455
122 Ga0157378_10381141 3300013297 Bacteria 1385
123 Ga0163162_10044840 3300013306 Bacteria 4430
124 Ga0157372_10155380 3300013307 Bacteria 2642
125 Ga0157372_10333961 3300013307 Bacteria 1765
126 Ga0157372_10872038 3300013307 Bacteria 1045
127 Ga0157375_13400106 3300013308 Bacteria 530
128 Ga0163163_10285406 3300014325 Bacteria 1703
129 Ga0163163_10378826 3300014325 Bacteria 1472
130 Ga0157377_10143168 3300014745 Bacteria 1471
131 Ga0157379_10124424 3300014968 Bacteria 2320
132 Ga0157379_10353779 3300014968 Bacteria 1345
133 Ga0157376_10253800 3300014969 Bacteria 1644
134 Ga0182005_1157333 3300015265 Bacteria 664
135 Ga0183360_10004 3300015689 Bacteria 289992
136 Ga0213876_10032258 3300021384 Bacteria 2763
137 Ga0228598_1013463 3300024227 Unclassified 1620
138 Ga0207425_1012372 3300025245 Bacteria 2005
139 Ga0209565_1000002 3300025263 Bacteria 1423083
140 Ga0209673_1000002 3300025273 Bacteria 1423083
141 Ga0209675_1000002 3300025291 Bacteria 1423083
142 Ga0209025_1000069 3300025294 Bacteria 290193
143 Ga0209564_1000004 3300025295 Bacteria 1424639
144 Ga0209758_1022670 3300025297 Bacteria 2868
145 Ga0209256_1000004 3300025299 Bacteria 1424643
146 Ga0207656_10250999 3300025321 Bacteria 867
147 Ga0207642_10873060 3300025899 Bacteria 575
148 Ga0207710_10288872 3300025900 Bacteria 826
149 Ga0207688_10059876 3300025901 Bacteria 2144
150 Ga0207680_10865147 3300025903 Bacteria 648
151 Ga0207647_10409374 3300025904 Bacteria 763
152 Ga0207685_10041541 3300025905 Bacteria 1721
153 Ga0207699_10981251 3300025906 Bacteria 624
154 Ga0207684_10025118 3300025910 Bacteria 5078
155 Ga0207684_10217628 3300025910 Bacteria 1648
156 Ga0207684_11692365 3300025910 Bacteria 510
157 Ga0207695_10080917 3300025913 Bacteria 3289
158 Ga0207671_10175536 3300025914 Bacteria 1665
159 Ga0207693_10352460 3300025915 Bacteria 1152
160 Ga0207663_10108795 3300025916 Bacteria 1877
161 Ga0207657_10462959 3300025919 Bacteria 995
162 Ga0207652_10589264 3300025921 Bacteria 998
163 Ga0207646_10044369 3300025922 Bacteria 3990
164 Ga0207646_10549920 3300025922 Bacteria 1038
165 Ga0207694_11303233 3300025924 Bacteria 614
166 Ga0207659_10606264 3300025926 Bacteria 934
167 Ga0207687_10132838 3300025927 Bacteria 1879
168 Ga0207687_10955537 3300025927 Bacteria 734
169 Ga0207700_10269779 3300025928 Bacteria 1460
170 Ga0207700_10497033 3300025928 Bacteria 1079
171 Ga0207700_11506658 3300025928 Bacteria 597
172 Ga0207706_11147352 3300025933 Bacteria 648
173 Ga0207686_10840633 3300025934 Bacteria 738
174 Ga0207670_10313895 3300025936 Bacteria 1231
175 Ga0207669_10615247 3300025937 Bacteria 884
176 Ga0207665_10468907 3300025939 Bacteria 969
177 Ga0207689_10421915 3300025942 Bacteria 1113
178 Ga0207661_10193962 3300025944 Bacteria 1782
179 Ga0207679_10128276 3300025945 Bacteria 2031
180 Ga0207712_10097628 3300025961 Bacteria 2177
181 Ga0207658_10474474 3300025986 Bacteria 1111
182 Ga0207677_10099011 3300026023 Bacteria 2140
183 Ga0207703_10297639 3300026035 Bacteria 1470
184 Ga0207703_10521111 3300026035 Bacteria 1118
185 Ga0207678_10134447 3300026067 Bacteria 2110
186 Ga0207678_10240202 3300026067 Bacteria 1551
187 Ga0207702_10013131 3300026078 Bacteria 6886
188 Ga0207702_10124136 3300026078 Bacteria 2315
189 Ga0207702_11596680 3300026078 Bacteria 645
190 Ga0207641_10257470 3300026088 Bacteria 1632
191 Ga0207641_10439702 3300026088 Bacteria 1259
192 Ga0207641_11761638 3300026088 Bacteria 621
193 Ga0207648_11060125 3300026089 Bacteria 760
194 Ga0207676_10046258 3300026095 Bacteria 3366
195 Ga0207676_10046886 3300026095 Bacteria 3347
196 Ga0207674_10099136 3300026116 Bacteria 2896
197 Ga0207428_10640948 3300027907 Bacteria 763
198 Ga0207428_10946505 3300027907 Bacteria 607
199 Ga0268266_10035687 3300028379 Bacteria 4229
200 Ga0268266_10998217 3300028379 Bacteria 810
201 Ga0268266_11190038 3300028379 Bacteria 737
202 Ga0265338_10155173 3300028800 Unclassified 1774
203 Ga0265324_10162688 3300029957 Bacteria 758
204 Ga0307408_100022057 3300031548 Bacteria 4320
205 Ga0316575_10015918 3300031665 Bacteria 2839
206 Ga0316579_10179251 3300031691 Bacteria 1024
207 Ga0316576_10047282 3300031727 Bacteria 3117
208 Ga0316576_10132545 3300031727 Bacteria 1875
209 Ga0316578_10006468 3300031728 Bacteria 5787
210 Ga0316578_10375270 3300031728 Bacteria 845
211 Ga0316577_10042385 3300031733 Bacteria 2547
212 Ga0326468_10007594 3300031889 Bacteria 1031
213 Ga0307412_11306030 3300031911 Bacteria 653
214 Ga0307409_100480098 3300031995 Bacteria 1206
215 Ga0307416_100997299 3300032002 Bacteria 940
216 Ga0316585_10021901 3300032137 Bacteria 1964
217 Ga0316580_10054205 3300032139 Bacteria 1234
218 Ga0373929_0186928 3300035085 Bacteria 574
219 Ga0373945_0239954 3300035116 Bacteria 763
220 Ga0316574_0007833 3300035398 Bacteria 5889
221 Ga0316574_0149373 3300035398 Bacteria 1506
222 Ga0316574_0778603 3300035398 Bacteria 583
223 Ga0373927_0604820 3300035695 Bacteria 725
224 Ga0316582_0011721 3300036647 Bacteria 4860
225 Ga0316584_0006107 3300036712 Bacteria 8141
226 Ga0436364_1100237 3300037853 Bacteria 1874
227 Ga0400483_283425 3300039062 Bacteria 2441
228 Ga0436365_0051488 3300039437 Bacteria 2873
229 Ga0439447_005689 3300041407 Bacteria 4125
230 Ga0451839_0974292 3300041496 Bacteria 538
231 Ga0439460_0328720 3300042461 Bacteria 537
232 Ga0495603_0148227 3300046455 Bacteria 1363
233 Ga0495608_0004011 3300046511 Bacteria 10564
234 Ga0495667_0000194 3300046559 Bacteria 41198
235 Ga0495668_0001090 3300046616 Bacteria 28207
236 Ga0495658_0206940 3300046683 Bacteria 1225
237 Ga0495676_0886940 3300047321 Bacteria 572
238 Ga0495686_0036970 3300047472 Bacteria 3131
239 Ga0496102_0326616 3300048905 Bacteria 1445
240 Ga0496104_0005073 3300048907 Bacteria 11488
241 Ga0496104_1322255 3300048907 Unclassified 624
242 Ga0496105_0016682 3300048908 Bacteria 5867
243 Ga0496108_0139757 3300048911 Bacteria 2086
244 Ga0496108_0930123 3300048911 Bacteria 745
245 Ga0496109_0019439 3300048912 Bacteria 5992
246 Ga0496109_0029227 3300048912 Bacteria 4936
247 Ga0496109_0400232 3300048912 Bacteria 1297
248 Ga0496109_0568960 3300048912 Bacteria 1068
249 Ga0496110_0005063 3300048913 Bacteria 10298
250 Ga0496110_0026499 3300048913 Bacteria 4962
251 Ga0496110_0647956 3300048913 Bacteria 956
252 Ga0496111_0030121 3300048914 Bacteria 3859
253 Ga0496111_0067553 3300048914 Bacteria 2597
254 Ga0496112_0154863 3300048915 Bacteria 2259
255 Ga0496113_0598219 3300048916 Bacteria 883
256 Ga0496121_0001585 3300048924 Bacteria 37851
257 Ga0501031_0158224 3300049568 Bacteria 1481
258 Ga0501036_0179422 3300049572 Bacteria 1783
259 Ga0501038_0378175 3300049574 Unclassified 1099
260 Ga0501038_0732152 3300049574 Bacteria 739
261 Ga0501041_0038919 3300049577 Bacteria 2884
262 Ga0501041_0117881 3300049577 Bacteria 1649
263 Ga0501046_0268495 3300049580 Unclassified 1252
264 Ga0501048_0143432 3300049582 Bacteria 1689
265 Ga0501070_0252034 3300049586 Bacteria 1444
266 Ga0501071_0235536 3300049587 Unclassified 1380
267 Ga0501072_0992973 3300049588 Unclassified 654
268 Ga0501074_0217657 3300049590 Bacteria 1360
269 Ga0501075_0297484 3300049591 Unclassified 1230
270 Ga0501076_0343638 3300049592 Bacteria 1225
271 Ga0501079_0223318 3300049741 Unclassified 1472
272 Ga0501081_0098258 3300049743 Bacteria 2067
273 Ga0501045_0080004 3300049824 Bacteria 2410
274 nmdc:mga05p37_218881_c1 3300050507 Bacteria 2299
275 nmdc:mga05p37_38244_c1 3300050507 Bacteria 5885
276 nmdc:mga05p37_385041_c1 3300050507 Bacteria 1642
277 nmdc:mga05p37_69589_c1 3300050507 Bacteria 4329
278 nmdc:mga05p37_77198_c1 3300050507 Bacteria 4100
279 nmdc:mga09592_1810_c1 3300050508 Bacteria 17160
280 nmdc:mga09592_327088_c1 3300050508 Bacteria 1328
281 nmdc:mga09592_971741_c1 3300050508 Bacteria 711
282 nmdc:mga0qj67_1534_c1 3300050509 Bacteria 16206
283 nmdc:mga0qj67_450082_c1 3300050509 Bacteria 1037
284 nmdc:mga0qj67_464782_c1 3300050509 Bacteria 1019
285 nmdc:mga0qj67_491432_c1 3300050509 Bacteria 987
286 nmdc:mga06r32_102991_c1 3300050510 Bacteria 2803
287 nmdc:mga06r32_1033697_c1 3300050510 Bacteria 773
288 nmdc:mga06r32_125927_c1 3300050510 Bacteria 2530
289 nmdc:mga06r32_332563_c1 3300050510 Unclassified 1504
290 nmdc:mga06r32_53130_c1 3300050510 Bacteria 3881
291 nmdc:mga06r32_588991_c1 3300050510 Bacteria 1084
292 nmdc:mga06r32_83906_c1 3300050510 Bacteria 3105
293 nmdc:mga08y16_300875_c1 3300050511 Bacteria 1653
294 nmdc:mga08y16_829835_c1 3300050511 Bacteria 915
295 nmdc:mga0n895_1622296_c1 3300050512 Bacteria 611
296 nmdc:mga0n895_363434_c1 3300050512 Bacteria 1465
297 nmdc:mga0rr50_862599_c1 3300050513 Bacteria 772
298 Ga0500556_0000121 3300053104 Bacteria 67560
299 Ga0500661_007618 3300055283 Bacteria 1999
300 Ga0501082_0337466 3300060353 Bacteria 1313
301 2643749678 2643221545 Bacteria 5083237
302 2643973929 2643221593 Bacteria 6296053
303 2644412837 2643221674 Bacteria 3919126
304 2644508635 2643221691 Bacteria 5093099
305 2941492643 2941489479 Bacteria 6313767
306 2995949067 2995948881 Bacteria 6358104
307 Ga0495619_0998543
308 JGI25151J46595_10001957
309 JGI25404J52841_10008168
310 Ga0055526_1000004
311 Ga0055537_1000242
312 Ga0055524_1000004
313 Ga0055534_1000011
314 Ga0055528_1000015
315 Ga0070658_10235578
316 Ga0070690_100440315
317 Ga0068869_100397479
318 Ga0068868_100089762
319 Ga0070660_100864229
320 Ga0070661_100444721
321 Ga0070675_100980472
322 Ga0070674_100222868
323 Ga0070673_102366950
324 Ga0070688_100114589
325 Ga0070659_100295870
326 Ga0070667_100289658
327 Ga0070667_100831989
328 Ga0070713_100209327
329 Ga0070713_100432364
330 Ga0070710_11047216
331 Ga0070711_100240506
332 Ga0070711_100749369
333 Ga0070678_100176153
334 Ga0070662_101111673
335 Ga0070685_10039357
336 Ga0070685_10490452
337 Ga0070706_100028396
338 Ga0070707_100031399
339 Ga0070698_100005925
340 Ga0070698_100638997
341 Ga0070684_100041059
342 Ga0070686_100376779
343 Ga0070665_100050301
344 Ga0070665_100212285
345 Ga0068855_100637170
346 Ga0070664_100269732
347 Ga0068857_100182158
348 Ga0068857_102243581
349 Ga0068854_100617958
350 Ga0068856_100243470
351 Ga0068856_100260969
352 Ga0068856_101816302
353 Ga0068864_100055543
354 Ga0068864_100093539
355 Ga0068864_100110759
356 Ga0068851_10231421
357 Ga0068863_100220669
358 Ga0068858_100111766
359 Ga0068860_100846832
360 Ga0081455_10030789
361 Ga0081455_10055778
362 Ga0081455_10086676
363 Ga0081455_10102089
364 Ga0081455_10125325
365 Ga0081455_10151382
366 Ga0081538_10000185
367 Ga0081538_10019207
368 Ga0081540_1000853
369 Ga0070717_10706146
370 Ga0070717_10926864
371 Ga0070715_10005732
372 Ga0070712_100189157
373 Ga0070712_100190379
374 Ga0075427_10005412
375 Ga0097621_100158561
376 Ga0075428_100001455
377 Ga0075428_100354736
378 Ga0075428_100470028
379 Ga0075428_100786807
380 Ga0075430_100009396
381 Ga0075430_100248991
382 Ga0075430_100935976
383 Ga0075430_100963222
384 Ga0075431_100020111
385 Ga0075431_100026038
386 Ga0075431_100044622
387 Ga0075431_100085685
388 Ga0075431_100203153
389 Ga0075431_100317238
390 Ga0075431_101064769
391 Ga0075433_10845792
392 Ga0075434_100729872
393 Ga0075434_101879956
394 Ga0075429_100004569
395 Ga0075429_100402583
396 Ga0075429_100590070
397 Ga0075429_101140052
398 Ga0105240_10023446
399 Ga0105240_12068165
400 Ga0111539_10782045
401 Ga0111539_11608374
402 Ga0111539_11806099
403 Ga0105245_10288805
404 Ga0105245_10817242
405 Ga0105247_10550023
406 Ga0114129_10283315
407 Ga0114129_10298909
408 Ga0114129_10370532
409 Ga0114129_10580741
410 Ga0105243_10163433
411 Ga0105243_10679863
412 Ga0105243_11276726
413 Ga0105242_10244144
414 Ga0105248_10794759
415 Ga0105237_10413368
416 Ga0105238_10103163
417 Ga0105249_10090378
418 Ga0105249_10232724
419 Ga0105249_11034911
420 Ga0105239_10256329
421 Ga0105239_10324363
422 Ga0105246_10393910
423 Ga0157373_11570289
424 Ga0157370_10439716
425 Ga0157369_10920138
426 Ga0157369_11585000
427 Ga0157374_10356138
428 Ga0157378_10381141
429 Ga0163162_10044840
430 Ga0157372_10155380
431 Ga0157372_10333961
432 Ga0157372_10872038
433 Ga0157375_13400106
434 Ga0163163_10285406
435 Ga0163163_10378826
436 Ga0157377_10143168
437 Ga0157379_10124424
438 Ga0157379_10353779
439 Ga0157376_10253800
440 Ga0182005_1157333
441 Ga0183360_10004
442 Ga0213876_10032258
443 Ga0228598_1013463
444 Ga0207425_1012372
445 Ga0209565_1000002
446 Ga0209673_1000002
447 Ga0209675_1000002
448 Ga0209025_1000069
449 Ga0209564_1000004
450 Ga0209758_1022670
451 Ga0209256_1000004
452 Ga0207656_10250999
453 Ga0207642_10873060
454 Ga0207710_10288872
455 Ga0207688_10059876
456 Ga0207680_10865147
457 Ga0207647_10409374
458 Ga0207685_10041541
459 Ga0207699_10981251
460 Ga0207684_10025118
461 Ga0207684_10217628
462 Ga0207684_11692365
463 Ga0207695_10080917
464 Ga0207671_10175536
465 Ga0207693_10352460
466 Ga0207663_10108795
467 Ga0207657_10462959
468 Ga0207652_10589264
469 Ga0207646_10044369
470 Ga0207646_10549920
471 Ga0207694_11303233
472 Ga0207659_10606264
473 Ga0207687_10132838
474 Ga0207687_10955537
475 Ga0207700_10269779
476 Ga0207700_10497033
477 Ga0207700_11506658
478 Ga0207706_11147352
479 Ga0207686_10840633
480 Ga0207670_10313895
481 Ga0207669_10615247
482 Ga0207665_10468907
483 Ga0207689_10421915
484 Ga0207661_10193962
485 Ga0207679_10128276
486 Ga0207712_10097628
487 Ga0207658_10474474
488 Ga0207677_10099011
489 Ga0207703_10297639
490 Ga0207703_10521111
491 Ga0207678_10134447
492 Ga0207678_10240202
493 Ga0207702_10013131
494 Ga0207702_10124136
495 Ga0207702_11596680
496 Ga0207641_10257470
497 Ga0207641_10439702
498 Ga0207641_11761638
499 Ga0207648_11060125
500 Ga0207676_10046258
501 Ga0207676_10046886
502 Ga0207674_10099136
503 Ga0207428_10640948
504 Ga0207428_10946505
505 Ga0268266_10035687
506 Ga0268266_10998217
507 Ga0268266_11190038
508 Ga0265338_10155173
509 Ga0265324_10162688
510 Ga0307408_100022057
511 Ga0316575_10015918
512 Ga0316579_10179251
513 Ga0316576_10047282
514 Ga0316576_10132545
515 Ga0316578_10006468
516 Ga0316578_10375270
517 Ga0316577_10042385
518 Ga0326468_10007594
519 Ga0307412_11306030
520 Ga0307409_100480098
521 Ga0307416_100997299
522 Ga0316585_10021901
523 Ga0316580_10054205
524 Ga0373929_0186928
525 Ga0373945_0239954
526 Ga0316574_0007833
527 Ga0316574_0149373
528 Ga0316574_0778603
529 Ga0373927_0604820
530 Ga0316582_0011721
531 Ga0316584_0006107
532 Ga0436364_1100237
533 Ga0400483_283425
534 Ga0436365_0051488
535 Ga0439447_005689
536 Ga0451839_0974292
537 Ga0439460_0328720
538 Ga0495603_0148227
539 Ga0495608_0004011
540 Ga0495667_0000194
541 Ga0495668_0001090
542 Ga0495658_0206940
543 Ga0495676_0886940
544 Ga0495686_0036970
545 Ga0496102_0326616
546 Ga0496104_0005073
547 Ga0496104_1322255
548 Ga0496105_0016682
549 Ga0496108_0139757
550 Ga0496108_0930123
551 Ga0496109_0019439
552 Ga0496109_0029227
553 Ga0496109_0400232
554 Ga0496109_0568960
555 Ga0496110_0005063
556 Ga0496110_0026499
557 Ga0496110_0647956
558 Ga0496111_0030121
559 Ga0496111_0067553
560 Ga0496112_0154863
561 Ga0496113_0598219
562 Ga0496121_0001585
563 Ga0501031_0158224
564 Ga0501036_0179422
565 Ga0501038_0378175
566 Ga0501038_0732152
567 Ga0501041_0038919
568 Ga0501041_0117881
569 Ga0501046_0268495
570 Ga0501048_0143432
571 Ga0501070_0252034
572 Ga0501071_0235536
573 Ga0501072_0992973
574 Ga0501074_0217657
575 Ga0501075_0297484
576 Ga0501076_0343638
577 Ga0501079_0223318
578 Ga0501081_0098258
579 Ga0501045_0080004
580 nmdc:mga05p37_218881_c1
581 nmdc:mga05p37_38244_c1
582 nmdc:mga05p37_385041_c1
583 nmdc:mga05p37_69589_c1
584 nmdc:mga05p37_77198_c1
585 nmdc:mga09592_1810_c1
586 nmdc:mga09592_327088_c1
587 nmdc:mga09592_971741_c1
588 nmdc:mga0qj67_1534_c1
589 nmdc:mga0qj67_450082_c1
590 nmdc:mga0qj67_464782_c1
591 nmdc:mga0qj67_491432_c1
592 nmdc:mga06r32_102991_c1
593 nmdc:mga06r32_1033697_c1
594 nmdc:mga06r32_125927_c1
595 nmdc:mga06r32_332563_c1
596 nmdc:mga06r32_53130_c1
597 nmdc:mga06r32_588991_c1
598 nmdc:mga06r32_83906_c1
599 nmdc:mga08y16_300875_c1
600 nmdc:mga08y16_829835_c1
601 nmdc:mga0n895_1622296_c1
602 nmdc:mga0n895_363434_c1
603 nmdc:mga0rr50_862599_c1
604 Ga0500556_0000121
605 Ga0500661_007618
606 Ga0501082_0337466
607 2643749678
608 2643973929
609 2644412837
610 2644508635
611 2941492643
612 2995949067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

12

63

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

14

62

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9369 1 77
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9211 4 92
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9163 1 84
3lmm-assembly4.cif.gz_D crystal structure of the dip2311 protein from corynebacterium diphtheriae, northeast structural genomics consortium target cdr35 0.9062 17 73
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9049 17 73
ID Description Score Start End Superfamily
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9509 17 72 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9409 5 84 1.10.10.10
af_Q5NE14_88_145_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9378 17 72 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9322 15 71 1.10.10.10
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9309 3 82 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1B8WHW7-F1-model_v4 deleted 0.9896 8 84
AF-A0A1Y4RKQ4-F1-model_v4 HTH arsR-type domain-containing protein 0.9847 4 84 GO:0003700
AF-A0A2A4YX94-F1-model_v4 ArsR family transcriptional regulator 0.9839 8 84 GO:0003700
AF-A0A3E0NLZ0-F1-model_v4 ArsR family transcriptional regulator 0.9834 8 84 GO:0003700
AF-A0A2W5VFY7-F1-model_v4 HTH arsR-type domain-containing protein 0.9827 4 85 GO:0003700

Map