F398899

General Info

Members Datasets Scaffolds Average Seq Length
306 155 612 404

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_0105135|Ga0501081_0105135_321_1655
Length 444
Sequence VTGRRAAGAIWEAGLAAGAVEPLIGRALQRQGSRLSLADRSWNLDAVDRVIVLGAGKAGAAMARGVEAVLGDRIAEGFVVVKDGYTSATHRVQLVEAGHPVPDARGQAAAARLLALADSAGGTDLVVFVVSXXXSALTPAPPPGVSLAEKQTVTRLLLASGATINELNAVRKHLSSFKGGQLARAAQPAFVLALILSDVINDPLDVIASGPTAPDPTTFADALDVLARRGVLAEVPRSVRSRLEAGRRGEVEETPKPGDPLFERVCNRIVGNNAIVVEAAAARARALGYQPHVLTRELQGEARDVAADLVGRARRLPPASCLIAGGETTVTVRGRGRGGRCQEFGLAAALSVRPEDDLVVLAAGTDGTDGPTDAAGAVIDAGTVLRGRDAGLDAARALDDNDSYTYLRATGDLVMTGPTNTNLLDLYLVLPASCLSDRRIAPSG

Samples

Sample ID Description Type Environment
1 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
2 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
118 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
119 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 1.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501081_0105135 3300049743 Unclassified 2000
2 JGI26129J50193_1001265 3300003349 Bacteria 1704
3 Ga0070676_10000158 3300005328 Bacteria 27074
4 Ga0070683_100048858 3300005329 Bacteria 3912
5 Ga0070670_100004133 3300005331 Bacteria 12128
6 Ga0068869_100000174 3300005334 Bacteria 32589
7 Ga0068869_100089714 3300005334 Bacteria 2309
8 Ga0070680_100000909 3300005336 Bacteria 20956
9 Ga0070680_100001802 3300005336 Bacteria 15724
10 Ga0070682_100000546 3300005337 Bacteria 23369
11 Ga0070682_100164712 3300005337 Bacteria 1535
12 Ga0068868_100054184 3300005338 Bacteria 3160
13 Ga0070660_100000124 3300005339 Bacteria 48699
14 Ga0070689_100028144 3300005340 Bacteria 4246
15 Ga0070691_10000922 3300005341 Bacteria 11927
16 Ga0070691_10003599 3300005341 Bacteria 6996
17 Ga0070691_10036324 3300005341 Bacteria 2322
18 Ga0070692_10003052 3300005345 Bacteria 6690
19 Ga0070669_100042354 3300005353 Bacteria 3313
20 Ga0070673_100096924 3300005364 Bacteria 2421
21 Ga0070659_100002262 3300005366 Bacteria 13713
22 Ga0070703_10004354 3300005406 Bacteria 3989
23 Ga0070703_10014443 3300005406 Bacteria 2250
24 Ga0070711_100059613 3300005439 Bacteria 2651
25 Ga0070705_100000151 3300005440 Bacteria 40840
26 Ga0070705_100011021 3300005440 Bacteria 4546
27 Ga0070705_100021035 3300005440 Bacteria 3464
28 Ga0070705_100031698 3300005440 Bacteria 2930
29 Ga0070700_100012483 3300005441 Bacteria 4745
30 Ga0070700_100054933 3300005441 Bacteria 2491
31 Ga0070694_100002666 3300005444 Bacteria 10571
32 Ga0070694_100055081 3300005444 Bacteria 2696
33 Ga0070694_100101906 3300005444 Bacteria 2032
34 Ga0070694_100149700 3300005444 Bacteria 1703
35 Ga0070708_100082079 3300005445 Bacteria 2919
36 Ga0070708_100136538 3300005445 Bacteria 2272
37 Ga0070663_100002137 3300005455 Bacteria 11065
38 Ga0070662_100015373 3300005457 Bacteria 5125
39 Ga0070662_100121833 3300005457 Bacteria 2000
40 Ga0070681_10002099 3300005458 Bacteria 18092
41 Ga0068867_100002279 3300005459 Bacteria 13495
42 Ga0070706_100033508 3300005467 Bacteria 4741
43 Ga0070706_100038063 3300005467 Bacteria 4441
44 Ga0070706_100066169 3300005467 Bacteria 3343
45 Ga0070706_100222877 3300005467 Bacteria 1760
46 Ga0070706_100297705 3300005467 Bacteria 1505
47 Ga0070707_100029026 3300005468 Bacteria 5266
48 Ga0070707_100062985 3300005468 Bacteria 3559
49 Ga0070707_100064359 3300005468 Bacteria 3521
50 Ga0070707_100129919 3300005468 Bacteria 2449
51 Ga0070698_100000812 3300005471 Bacteria 34080
52 Ga0070698_100026888 3300005471 Bacteria 5983
53 Ga0070698_100110476 3300005471 Bacteria 2714
54 Ga0070699_100013015 3300005518 Bacteria 7168
55 Ga0070699_100019754 3300005518 Bacteria 5807
56 Ga0070699_100048716 3300005518 Bacteria 3667
57 Ga0070699_100165163 3300005518 Bacteria 1960
58 Ga0070679_100009210 3300005530 Bacteria 9329
59 Ga0070684_100059545 3300005535 Bacteria 3339
60 Ga0070697_100001700 3300005536 Bacteria 16807
61 Ga0070697_100042604 3300005536 Bacteria 3674
62 Ga0070697_100090998 3300005536 Bacteria 2522
63 Ga0070697_100114872 3300005536 Bacteria 2247
64 Ga0070697_100124451 3300005536 Bacteria 2159
65 Ga0068853_100000619 3300005539 Bacteria 24364
66 Ga0068853_100072326 3300005539 Bacteria 3005
67 Ga0070686_100024075 3300005544 Bacteria 3647
68 Ga0070695_100000443 3300005545 Bacteria 21592
69 Ga0070695_100002598 3300005545 Bacteria 10429
70 Ga0070695_100033038 3300005545 Bacteria 3236
71 Ga0070696_100013111 3300005546 Bacteria 5561
72 Ga0070693_100000212 3300005547 Bacteria 27059
73 Ga0070704_100000703 3300005549 Bacteria 16296
74 Ga0070704_100033269 3300005549 Bacteria 3484
75 Ga0068855_100007907 3300005563 Bacteria 12846
76 Ga0070664_100045308 3300005564 Bacteria 3715
77 Ga0068857_100155811 3300005577 Bacteria 2071
78 Ga0068854_100004159 3300005578 Bacteria 9098
79 Ga0068856_100008528 3300005614 Bacteria 9966
80 Ga0068859_100002742 3300005617 Bacteria 17867
81 Ga0068859_100026759 3300005617 Bacteria 5786
82 Ga0068859_100373518 3300005617 Unclassified 1521
83 Ga0068864_100001670 3300005618 Bacteria 18268
84 Ga0068861_100050602 3300005719 Bacteria 3151
85 Ga0068870_10002151 3300005840 Bacteria 8159
86 Ga0068858_100016597 3300005842 Bacteria 6917
87 Ga0068860_100003749 3300005843 Bacteria 15630
88 Ga0068862_100005532 3300005844 Bacteria 10555
89 Ga0068862_100017583 3300005844 Bacteria 5953
90 Ga0068862_100040781 3300005844 Bacteria 3947
91 Ga0081455_10000250 3300005937 Bacteria 70308
92 Ga0081538_10015151 3300005981 Bacteria 5985
93 Ga0070712_100009674 3300006175 Bacteria 6076
94 Ga0075428_100000028 3300006844 Bacteria 119875
95 Ga0075428_100002571 3300006844 Bacteria 19718
96 Ga0075428_100355413 3300006844 Unclassified 1572
97 Ga0075430_100000017 3300006846 Bacteria 88487
98 Ga0075431_100000550 3300006847 Bacteria 31550
99 Ga0075431_100001006 3300006847 Bacteria 25072
100 Ga0075431_100001250 3300006847 Bacteria 23097
101 Ga0075431_100026304 3300006847 Bacteria 5969
102 Ga0075431_100129206 3300006847 Bacteria 2607
103 Ga0075433_10004202 3300006852 Bacteria 11175
104 Ga0075433_10008545 3300006852 Bacteria 8167
105 Ga0075433_10009518 3300006852 Bacteria 7766
106 Ga0075433_10011117 3300006852 Bacteria 7239
107 Ga0075433_10032802 3300006852 Bacteria 4450
108 Ga0075434_100006167 3300006871 Bacteria 10978
109 Ga0075434_100010896 3300006871 Bacteria 8550
110 Ga0075434_100012596 3300006871 Bacteria 8020
111 Ga0075434_100013044 3300006871 Bacteria 7892
112 Ga0075434_100042239 3300006871 Bacteria 4520
113 Ga0075434_100286214 3300006871 Bacteria 1668
114 Ga0075429_100000040 3300006880 Bacteria 59305
115 Ga0075429_100011828 3300006880 Bacteria 7567
116 Ga0075436_100047647 3300006914 Bacteria 2956
117 Ga0097620_100002742 3300006931 Bacteria 17867
118 Ga0097620_100026759 3300006931 Bacteria 5786
119 Ga0097620_100373516 3300006931 Unclassified 1521
120 Ga0075435_100001892 3300007076 Bacteria 13621
121 Ga0075435_100043368 3300007076 Bacteria 3601
122 Ga0075435_100081659 3300007076 Bacteria 2655
123 Ga0075435_100098426 3300007076 Bacteria 2421
124 Ga0099794_10003797 3300007265 Bacteria 5831
125 Ga0099794_10003885 3300007265 Bacteria 5784
126 Ga0105240_10132981 3300009093 Bacteria 2981
127 Ga0111539_10001954 3300009094 Bacteria 27500
128 Ga0111539_10002900 3300009094 Bacteria 22767
129 Ga0114129_10008030 3300009147 Bacteria 15033
130 Ga0114129_10031332 3300009147 Bacteria 7518
131 Ga0114129_10067669 3300009147 Bacteria 4981
132 Ga0114129_10082861 3300009147 Bacteria 4456
133 Ga0114129_10105798 3300009147 Bacteria 3888
134 Ga0114129_10110094 3300009147 Bacteria 3802
135 Ga0114129_10120062 3300009147 Bacteria 3620
136 Ga0114129_10535882 3300009147 Bacteria 1524
137 Ga0105241_10000349 3300009174 Bacteria 35085
138 Ga0105241_10066807 3300009174 Bacteria 2782
139 Ga0105241_10115222 3300009174 Bacteria 2157
140 Ga0105237_10053573 3300009545 Bacteria 4046
141 Ga0105249_10007992 3300009553 Bacteria 9222
142 Ga0105249_10079490 3300009553 Bacteria 3044
143 Ga0105249_10370079 3300009553 Unclassified 1456
144 Ga0105246_10041144 3300011119 Bacteria 3122
145 Ga0157373_10000834 3300013100 Bacteria 23934
146 Ga0157373_10021833 3300013100 Bacteria 4645
147 Ga0157371_10031964 3300013102 Bacteria 3789
148 Ga0163162_10058765 3300013306 Bacteria 3875
149 Ga0163162_10177425 3300013306 Bacteria 2256
150 Ga0157372_10001718 3300013307 Bacteria 23773
151 Ga0157372_10179916 3300013307 Bacteria 2447
152 Ga0207653_10020412 3300025885 Bacteria 2097
153 Ga0207645_10000037 3300025907 Bacteria 88771
154 Ga0207643_10001245 3300025908 Bacteria 14960
155 Ga0207684_10001229 3300025910 Bacteria 28446
156 Ga0207684_10006382 3300025910 Bacteria 10749
157 Ga0207684_10034636 3300025910 Bacteria 4290
158 Ga0207684_10040583 3300025910 Bacteria 3945
159 Ga0207684_10043759 3300025910 Bacteria 3797
160 Ga0207684_10044510 3300025910 Bacteria 3764
161 Ga0207684_10056195 3300025910 Bacteria 3339
162 Ga0207654_10001868 3300025911 Bacteria 10905
163 Ga0207654_10080392 3300025911 Bacteria 1960
164 Ga0207707_10000566 3300025912 Bacteria 37480
165 Ga0207695_10032402 3300025913 Bacteria 5719
166 Ga0207693_10013729 3300025915 Bacteria 6525
167 Ga0207660_10011281 3300025917 Bacteria 5811
168 Ga0207657_10007071 3300025919 Bacteria 11529
169 Ga0207649_10015705 3300025920 Bacteria 4255
170 Ga0207646_10001139 3300025922 Bacteria 33890
171 Ga0207646_10010206 3300025922 Bacteria 9198
172 Ga0207646_10068103 3300025922 Bacteria 3179
173 Ga0207646_10109046 3300025922 Bacteria 2484
174 Ga0207646_10123959 3300025922 Bacteria 2322
175 Ga0207646_10211907 3300025922 Bacteria 1750
176 Ga0207646_10232442 3300025922 Bacteria 1666
177 Ga0207690_10002201 3300025932 Bacteria 11890
178 Ga0207706_10004145 3300025933 Bacteria 13666
179 Ga0207706_10035909 3300025933 Bacteria 4404
180 Ga0207665_10004215 3300025939 Bacteria 9571
181 Ga0207689_10000056 3300025942 Bacteria 86419
182 Ga0207689_10169011 3300025942 Bacteria 1802
183 Ga0207679_10000923 3300025945 Bacteria 18749
184 Ga0207667_10001705 3300025949 Bacteria 27638
185 Ga0207712_10083431 3300025961 Bacteria 2332
186 Ga0207712_10120842 3300025961 Bacteria 1982
187 Ga0207640_10004279 3300025981 Bacteria 7728
188 Ga0207677_10035938 3300026023 Bacteria 3223
189 Ga0207703_10236716 3300026035 Bacteria 1639
190 Ga0207639_10028350 3300026041 Bacteria 4087
191 Ga0207678_10054521 3300026067 Bacteria 3443
192 Ga0207708_10035721 3300026075 Bacteria 3782
193 Ga0207708_10075641 3300026075 Bacteria 2582
194 Ga0207702_10031366 3300026078 Bacteria 4429
195 Ga0207648_10000678 3300026089 Bacteria 38201
196 Ga0207676_10118687 3300026095 Bacteria 2226
197 Ga0207674_10000204 3300026116 Bacteria 73393
198 Ga0207675_100043800 3300026118 Bacteria 4180
199 Ga0207675_100054413 3300026118 Bacteria 3733
200 Ga0207675_100280298 3300026118 Bacteria 1619
201 Ga0209983_1005932 3300027665 Bacteria 2522
202 Ga0209588_1002885 3300027671 Bacteria 4721
203 Ga0209971_1000199 3300027682 Bacteria 17944
204 Ga0209966_1000150 3300027695 Bacteria 29673
205 Ga0209998_10000038 3300027717 Bacteria 53559
206 Ga0207428_10000132 3300027907 Bacteria 101581
207 Ga0207428_10060824 3300027907 Bacteria 2992
208 Ga0268265_10073594 3300028380 Bacteria 2669
209 Ga0268265_10112642 3300028380 Bacteria 2224
210 Ga0268264_10001622 3300028381 Bacteria 20783
211 Ga0268264_10050908 3300028381 Bacteria 3450
212 Ga0268264_10110898 3300028381 Bacteria 2403
213 Ga0307408_100040807 3300031548 Bacteria 3288
214 Ga0307416_100121662 3300032002 Bacteria 2328
215 Ga0307411_10019729 3300032005 Bacteria 3902
216 Ga0373948_0004664 3300034817 Bacteria 2182
217 Ga0439464_0000843 3300042439 Bacteria 6789
218 Ga0439460_0000635 3300042461 Bacteria 7697
219 Ga0451577_0021107 3300042876 Bacteria 5965
220 Ga0451577_0029735 3300042876 Bacteria 4938
221 Ga0453683_0030709 3300044673 Bacteria 3396
222 Ga0453684_0027729 3300044712 Bacteria 8108
223 Ga0453684_0033090 3300044712 Bacteria 7214
224 Ga0451576_0004767 3300045051 Bacteria 17395
225 Ga0451576_0009918 3300045051 Bacteria 10998
226 Ga0451576_0045664 3300045051 Bacteria 4612
227 Ga0451576_0358287 3300045051 Unclassified 1527
228 Ga0495580_0055535 3300046472 Bacteria 2790
229 Ga0495669_0026534 3300046684 Bacteria 2532
230 Ga0501033_0049528 3300049570 Bacteria 3118
231 Ga0501036_0098803 3300049572 Bacteria 2468
232 Ga0501038_0041816 3300049574 Bacteria 3996
233 Ga0501038_0044761 3300049574 Bacteria 3844
234 Ga0501039_0005782 3300049575 Bacteria 9369
235 Ga0501040_0001543 3300049576 Bacteria 14660
236 Ga0501040_0008785 3300049576 Bacteria 6565
237 Ga0501040_0029517 3300049576 Bacteria 3703
238 Ga0501040_0136016 3300049576 Bacteria 1730
239 Ga0501041_0008101 3300049577 Bacteria 6186
240 Ga0501041_0009942 3300049577 Bacteria 5604
241 Ga0501042_0024832 3300049578 Bacteria 4207
242 Ga0501043_0032111 3300049579 Bacteria 4127
243 Ga0501046_0048175 3300049580 Bacteria 3376
244 Ga0501048_0218508 3300049582 Bacteria 1352
245 Ga0501071_0065061 3300049587 Bacteria 2647
246 Ga0501072_0005238 3300049588 Bacteria 9873
247 Ga0501072_0090114 3300049588 Bacteria 2434
248 Ga0501072_0114650 3300049588 Bacteria 2145
249 Ga0501075_0005704 3300049591 Bacteria 8518
250 Ga0501075_0018087 3300049591 Bacteria 5097
251 Ga0501075_0075592 3300049591 Bacteria 2547
252 Ga0501075_0137014 3300049591 Bacteria 1865
253 Ga0501076_0015211 3300049592 Bacteria 5812
254 Ga0501076_0021988 3300049592 Bacteria 4899
255 Ga0501077_0017377 3300049593 Bacteria 4540
256 Ga0501077_0023326 3300049593 Bacteria 3923
257 Ga0501079_0001389 3300049741 Bacteria 17065
258 Ga0501079_0044574 3300049741 Bacteria 3422
259 Ga0501079_0071992 3300049741 Bacteria 2671
260 Ga0501079_0092079 3300049741 Bacteria 2349
261 Ga0501079_0185088 3300049741 Bacteria 1626
262 Ga0501080_0103837 3300049742 Bacteria 2636
263 Ga0501081_0010318 3300049743 Bacteria 6098
264 Ga0501081_0022178 3300049743 Bacteria 4247
265 Ga0501045_0002004 3300049824 Bacteria 13761
266 Ga0501045_0100615 3300049824 Bacteria 2139
267 Ga0501045_0156104 3300049824 Bacteria 1698
268 nmdc:mga05p37_23747_c1 3300050507 Bacteria 7446
269 nmdc:mga05p37_53143_c3 3300050507 Bacteria 3369
270 nmdc:mga05p37_5800_c1 3300050507 Bacteria 14514
271 nmdc:mga05p37_58953_c1 3300050507 Bacteria 4728
272 nmdc:mga09592_18985_c1 3300050508 Bacteria 5642
273 nmdc:mga09592_58554_c1 3300050508 Bacteria 3258
274 nmdc:mga09592_861_c1 3300050508 Bacteria 23697
275 nmdc:mga0qj67_22979_c1 3300050509 Bacteria 4791
276 nmdc:mga0qj67_24670_c1 3300050509 Bacteria 4638
277 nmdc:mga06r32_10904_c1 3300050510 Bacteria 8184
278 nmdc:mga06r32_116590_c1 3300050510 Bacteria 2631
279 nmdc:mga06r32_1372_c1 3300050510 Bacteria 22005
280 nmdc:mga06r32_29718_c1 3300050510 Bacteria 5125
281 nmdc:mga08y16_153562_c1 3300050511 Bacteria 2393
282 nmdc:mga08y16_627_c1 3300050511 Bacteria 33082
283 nmdc:mga0n895_10959_c1 3300050512 Bacteria 8057
284 nmdc:mga0n895_165689_c1 3300050512 Bacteria 2242
285 nmdc:mga0n895_173356_c1 3300050512 Bacteria 2189
286 nmdc:mga0n895_24921_c1 3300050512 Bacteria 5645
287 nmdc:mga0n895_252245_c1 3300050512 Bacteria 1791
288 nmdc:mga0n895_286655_c1 3300050512 Bacteria 1670
289 nmdc:mga0n895_4434_c1 3300050512 Bacteria 11533
290 nmdc:mga0n895_5272_c1 3300050512 Bacteria 10765
291 nmdc:mga0n895_55122_c1 3300050512 Bacteria 3912
292 nmdc:mga0rr50_223681_c1 3300050513 Bacteria 1555
293 nmdc:mga0rr50_3520_c1 3300050513 Bacteria 9031
294 nmdc:mga0rr50_54266_c1 3300050513 Bacteria 2985
295 nmdc:mga08x19_52478_c1 3300050514 Bacteria 2623
296 nmdc:mga0a205_109494_c1 3300050515 Bacteria 2661
297 nmdc:mga0a205_26076_c1 3300050515 Bacteria 5569
298 nmdc:mga0a205_26605_c1 3300050515 Bacteria 5518
299 nmdc:mga0a205_30150_c1 3300050515 Bacteria 5193
300 nmdc:mga0a205_9294_c1 3300050515 Bacteria 8977
301 Ga0501084_0007574 3300054114 Bacteria 8952
302 Ga0501082_0003308 3300060353 Bacteria 14070
303 Ga0501082_0015972 3300060353 Bacteria 6457
304 Ga0530510_0000835 3300061734 Bacteria 20249
305 Ga0530510_0039352 3300061734 Bacteria 3413
306 Ga0530510_0070079 3300061734 Bacteria 2545
307 Ga0501081_0105135
308 JGI26129J50193_1001265
309 Ga0070676_10000158
310 Ga0070683_100048858
311 Ga0070670_100004133
312 Ga0068869_100000174
313 Ga0068869_100089714
314 Ga0070680_100000909
315 Ga0070680_100001802
316 Ga0070682_100000546
317 Ga0070682_100164712
318 Ga0068868_100054184
319 Ga0070660_100000124
320 Ga0070689_100028144
321 Ga0070691_10000922
322 Ga0070691_10003599
323 Ga0070691_10036324
324 Ga0070692_10003052
325 Ga0070669_100042354
326 Ga0070673_100096924
327 Ga0070659_100002262
328 Ga0070703_10004354
329 Ga0070703_10014443
330 Ga0070711_100059613
331 Ga0070705_100000151
332 Ga0070705_100011021
333 Ga0070705_100021035
334 Ga0070705_100031698
335 Ga0070700_100012483
336 Ga0070700_100054933
337 Ga0070694_100002666
338 Ga0070694_100055081
339 Ga0070694_100101906
340 Ga0070694_100149700
341 Ga0070708_100082079
342 Ga0070708_100136538
343 Ga0070663_100002137
344 Ga0070662_100015373
345 Ga0070662_100121833
346 Ga0070681_10002099
347 Ga0068867_100002279
348 Ga0070706_100033508
349 Ga0070706_100038063
350 Ga0070706_100066169
351 Ga0070706_100222877
352 Ga0070706_100297705
353 Ga0070707_100029026
354 Ga0070707_100062985
355 Ga0070707_100064359
356 Ga0070707_100129919
357 Ga0070698_100000812
358 Ga0070698_100026888
359 Ga0070698_100110476
360 Ga0070699_100013015
361 Ga0070699_100019754
362 Ga0070699_100048716
363 Ga0070699_100165163
364 Ga0070679_100009210
365 Ga0070684_100059545
366 Ga0070697_100001700
367 Ga0070697_100042604
368 Ga0070697_100090998
369 Ga0070697_100114872
370 Ga0070697_100124451
371 Ga0068853_100000619
372 Ga0068853_100072326
373 Ga0070686_100024075
374 Ga0070695_100000443
375 Ga0070695_100002598
376 Ga0070695_100033038
377 Ga0070696_100013111
378 Ga0070693_100000212
379 Ga0070704_100000703
380 Ga0070704_100033269
381 Ga0068855_100007907
382 Ga0070664_100045308
383 Ga0068857_100155811
384 Ga0068854_100004159
385 Ga0068856_100008528
386 Ga0068859_100002742
387 Ga0068859_100026759
388 Ga0068859_100373518
389 Ga0068864_100001670
390 Ga0068861_100050602
391 Ga0068870_10002151
392 Ga0068858_100016597
393 Ga0068860_100003749
394 Ga0068862_100005532
395 Ga0068862_100017583
396 Ga0068862_100040781
397 Ga0081455_10000250
398 Ga0081538_10015151
399 Ga0070712_100009674
400 Ga0075428_100000028
401 Ga0075428_100002571
402 Ga0075428_100355413
403 Ga0075430_100000017
404 Ga0075431_100000550
405 Ga0075431_100001006
406 Ga0075431_100001250
407 Ga0075431_100026304
408 Ga0075431_100129206
409 Ga0075433_10004202
410 Ga0075433_10008545
411 Ga0075433_10009518
412 Ga0075433_10011117
413 Ga0075433_10032802
414 Ga0075434_100006167
415 Ga0075434_100010896
416 Ga0075434_100012596
417 Ga0075434_100013044
418 Ga0075434_100042239
419 Ga0075434_100286214
420 Ga0075429_100000040
421 Ga0075429_100011828
422 Ga0075436_100047647
423 Ga0097620_100002742
424 Ga0097620_100026759
425 Ga0097620_100373516
426 Ga0075435_100001892
427 Ga0075435_100043368
428 Ga0075435_100081659
429 Ga0075435_100098426
430 Ga0099794_10003797
431 Ga0099794_10003885
432 Ga0105240_10132981
433 Ga0111539_10001954
434 Ga0111539_10002900
435 Ga0114129_10008030
436 Ga0114129_10031332
437 Ga0114129_10067669
438 Ga0114129_10082861
439 Ga0114129_10105798
440 Ga0114129_10110094
441 Ga0114129_10120062
442 Ga0114129_10535882
443 Ga0105241_10000349
444 Ga0105241_10066807
445 Ga0105241_10115222
446 Ga0105237_10053573
447 Ga0105249_10007992
448 Ga0105249_10079490
449 Ga0105249_10370079
450 Ga0105246_10041144
451 Ga0157373_10000834
452 Ga0157373_10021833
453 Ga0157371_10031964
454 Ga0163162_10058765
455 Ga0163162_10177425
456 Ga0157372_10001718
457 Ga0157372_10179916
458 Ga0207653_10020412
459 Ga0207645_10000037
460 Ga0207643_10001245
461 Ga0207684_10001229
462 Ga0207684_10006382
463 Ga0207684_10034636
464 Ga0207684_10040583
465 Ga0207684_10043759
466 Ga0207684_10044510
467 Ga0207684_10056195
468 Ga0207654_10001868
469 Ga0207654_10080392
470 Ga0207707_10000566
471 Ga0207695_10032402
472 Ga0207693_10013729
473 Ga0207660_10011281
474 Ga0207657_10007071
475 Ga0207649_10015705
476 Ga0207646_10001139
477 Ga0207646_10010206
478 Ga0207646_10068103
479 Ga0207646_10109046
480 Ga0207646_10123959
481 Ga0207646_10211907
482 Ga0207646_10232442
483 Ga0207690_10002201
484 Ga0207706_10004145
485 Ga0207706_10035909
486 Ga0207665_10004215
487 Ga0207689_10000056
488 Ga0207689_10169011
489 Ga0207679_10000923
490 Ga0207667_10001705
491 Ga0207712_10083431
492 Ga0207712_10120842
493 Ga0207640_10004279
494 Ga0207677_10035938
495 Ga0207703_10236716
496 Ga0207639_10028350
497 Ga0207678_10054521
498 Ga0207708_10035721
499 Ga0207708_10075641
500 Ga0207702_10031366
501 Ga0207648_10000678
502 Ga0207676_10118687
503 Ga0207674_10000204
504 Ga0207675_100043800
505 Ga0207675_100054413
506 Ga0207675_100280298
507 Ga0209983_1005932
508 Ga0209588_1002885
509 Ga0209971_1000199
510 Ga0209966_1000150
511 Ga0209998_10000038
512 Ga0207428_10000132
513 Ga0207428_10060824
514 Ga0268265_10073594
515 Ga0268265_10112642
516 Ga0268264_10001622
517 Ga0268264_10050908
518 Ga0268264_10110898
519 Ga0307408_100040807
520 Ga0307416_100121662
521 Ga0307411_10019729
522 Ga0373948_0004664
523 Ga0439464_0000843
524 Ga0439460_0000635
525 Ga0451577_0021107
526 Ga0451577_0029735
527 Ga0453683_0030709
528 Ga0453684_0027729
529 Ga0453684_0033090
530 Ga0451576_0004767
531 Ga0451576_0009918
532 Ga0451576_0045664
533 Ga0451576_0358287
534 Ga0495580_0055535
535 Ga0495669_0026534
536 Ga0501033_0049528
537 Ga0501036_0098803
538 Ga0501038_0041816
539 Ga0501038_0044761
540 Ga0501039_0005782
541 Ga0501040_0001543
542 Ga0501040_0008785
543 Ga0501040_0029517
544 Ga0501040_0136016
545 Ga0501041_0008101
546 Ga0501041_0009942
547 Ga0501042_0024832
548 Ga0501043_0032111
549 Ga0501046_0048175
550 Ga0501048_0218508
551 Ga0501071_0065061
552 Ga0501072_0005238
553 Ga0501072_0090114
554 Ga0501072_0114650
555 Ga0501075_0005704
556 Ga0501075_0018087
557 Ga0501075_0075592
558 Ga0501075_0137014
559 Ga0501076_0015211
560 Ga0501076_0021988
561 Ga0501077_0017377
562 Ga0501077_0023326
563 Ga0501079_0001389
564 Ga0501079_0044574
565 Ga0501079_0071992
566 Ga0501079_0092079
567 Ga0501079_0185088
568 Ga0501080_0103837
569 Ga0501081_0010318
570 Ga0501081_0022178
571 Ga0501045_0002004
572 Ga0501045_0100615
573 Ga0501045_0156104
574 nmdc:mga05p37_23747_c1
575 nmdc:mga05p37_53143_c3
576 nmdc:mga05p37_5800_c1
577 nmdc:mga05p37_58953_c1
578 nmdc:mga09592_18985_c1
579 nmdc:mga09592_58554_c1
580 nmdc:mga09592_861_c1
581 nmdc:mga0qj67_22979_c1
582 nmdc:mga0qj67_24670_c1
583 nmdc:mga06r32_10904_c1
584 nmdc:mga06r32_116590_c1
585 nmdc:mga06r32_1372_c1
586 nmdc:mga06r32_29718_c1
587 nmdc:mga08y16_153562_c1
588 nmdc:mga08y16_627_c1
589 nmdc:mga0n895_10959_c1
590 nmdc:mga0n895_165689_c1
591 nmdc:mga0n895_173356_c1
592 nmdc:mga0n895_24921_c1
593 nmdc:mga0n895_252245_c1
594 nmdc:mga0n895_286655_c1
595 nmdc:mga0n895_4434_c1
596 nmdc:mga0n895_5272_c1
597 nmdc:mga0n895_55122_c1
598 nmdc:mga0rr50_223681_c1
599 nmdc:mga0rr50_3520_c1
600 nmdc:mga0rr50_54266_c1
601 nmdc:mga08x19_52478_c1
602 nmdc:mga0a205_109494_c1
603 nmdc:mga0a205_26076_c1
604 nmdc:mga0a205_26605_c1
605 nmdc:mga0a205_30150_c1
606 nmdc:mga0a205_9294_c1
607 Ga0501084_0007574
608 Ga0501082_0003308
609 Ga0501082_0015972
610 Ga0530510_0000835
611 Ga0530510_0039352
612 Ga0530510_0070079

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05161

MOFRL

MOFRL family

320

425

0.98

PF13660

DUF4147

Domain of unknown function (DUF4147)

6

244

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b8n-assembly2.cif.gz_B crystal structure of glycerate kinase (ec 2.7.1.31) (tm1585) from thermotoga maritima at 2.70 a resolution 0.7903 2 393
2b8n-assembly2.cif.gz_B crystal structure of glycerate kinase (ec 2.7.1.31) (tm1585) from thermotoga maritima at 2.70 a resolution 0.7782 2 393
1x3l-assembly1.cif.gz_A crystal structure of the ph0495 protein from pyrococccus horikoshii ot3 0.7301 1 395
1x3l-assembly1.cif.gz_A crystal structure of the ph0495 protein from pyrococccus horikoshii ot3 0.7239 1 395
8b2d-assembly1.cif.gz_B crystal structure of bacterial flavin containing monooxygenase thermoresistant mutant, in complex with nadp+ 0.6096 36 85
ID Description Score Start End Superfamily
2b8nB01 Alpha Beta;3-Layer(aba) Sandwich;glycerate kinase, domain 1;MOFRL domain 0.8815 253 393 3.40.1480.10
1x3lA01 Alpha Beta;3-Layer(aba) Sandwich;glycerate kinase, domain 1;MOFRL domain 0.8601 252 395 3.40.1480.10
af_Q08BL7_290_493_3.40.1480.10 Alpha Beta;3-Layer(aba) Sandwich;glycerate kinase, domain 1;MOFRL domain 0.7948 257 393 3.40.1480.10
2b8nB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycerate kinase, MOFRL-like N-terminal domain 0.7851 21 250 3.40.50.10180
2b8nB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycerate kinase, MOFRL-like N-terminal domain 0.7759 21 250 3.40.50.10180
ID Description Score Start End GO Terms
AF-A0A2S8K3E5-F1-model_v4 deleted 0.9843 38 119
AF-A0A842Q4C3-F1-model_v4 DUF4147 domain-containing protein 0.9444 39 127 GO:0005737
GO:0008887
AF-A0A257VF04-F1-model_v4 Glycerate kinase 0.9124 1 128 GO:0005737
GO:0008887
AF-A0A7V9D3B3-F1-model_v4 DUF4147 domain-containing protein 0.9068 3 127 GO:0005737
GO:0008887
AF-A0A7C1BNB0-F1-model_v4 Glycerate kinase 0.8938 246 393 GO:0005737
GO:0008887

Map