F398887

General Info

Members Datasets Scaffolds Average Seq Length
306 228 612 109

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0914608|Ga0501039_0914608_42_431
Length 129
Sequence LTFQVAMRIGATLSRLAADRVGARSWCAGIDDAPDSATSDEMTAIDAFNDRLRTDGHWVFAGGLGAPSTATVIDGRGAEPMFTDGPFVETKEWLSGFWIIEAPDLDVALKLASAGSKSCNRRVEVRPFL

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
108 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
109 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
110 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
111 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
114 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
129 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
130 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
228 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.88
Nodule 0
Rhizoplane 11.44
Rhizosphere 81.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0914608 3300049575 Bacteria 683
2 Ga0070677_10137728 3300005333 Bacteria 1122
3 Ga0068868_101879645 3300005338 Bacteria 567
4 Ga0070675_100535637 3300005354 Bacteria 1058
5 Ga0070673_100979327 3300005364 Bacteria 787
6 Ga0070709_10930964 3300005434 Bacteria 688
7 Ga0070714_100541953 3300005435 Bacteria 1113
8 Ga0070705_100406543 3300005440 Bacteria 1009
9 Ga0070708_100177128 3300005445 Bacteria 1993
10 Ga0070708_100246330 3300005445 Bacteria 1678
11 Ga0070663_100301939 3300005455 Bacteria 1282
12 Ga0070706_100006831 3300005467 Bacteria 10771
13 Ga0070679_100057170 3300005530 Bacteria 3888
14 Ga0070679_100535389 3300005530 Bacteria 1115
15 Ga0070684_102155930 3300005535 Bacteria 526
16 Ga0070672_100010648 3300005543 Bacteria 6386
17 Ga0070672_101156265 3300005543 Bacteria 689
18 Ga0070696_100018386 3300005546 Bacteria 4722
19 Ga0070696_100484774 3300005546 Bacteria 981
20 Ga0070665_100252444 3300005548 Bacteria 1764
21 Ga0070704_100309404 3300005549 Bacteria 1320
22 Ga0068855_100574715 3300005563 Bacteria 1218
23 Ga0070664_100241330 3300005564 Bacteria 1622
24 Ga0068861_100941044 3300005719 Bacteria 821
25 Ga0068863_100025461 3300005841 Bacteria 5642
26 Ga0068860_102558960 3300005843 Bacteria 530
27 Ga0081455_10251519 3300005937 Bacteria 1292
28 Ga0081538_10044562 3300005981 Bacteria 2765
29 Ga0081540_1003414 3300005983 Bacteria 12564
30 Ga0070717_10016462 3300006028 Bacteria 5733
31 Ga0075365_10941497 3300006038 Bacteria 609
32 Ga0075368_10003058 3300006042 Bacteria 5540
33 Ga0075363_100014946 3300006048 Bacteria 3806
34 Ga0075363_100301909 3300006048 Bacteria 929
35 Ga0075364_10016901 3300006051 Bacteria 4546
36 Ga0075362_10549258 3300006177 Bacteria 594
37 Ga0075367_10020879 3300006178 Bacteria 3653
38 Ga0097621_102024991 3300006237 Bacteria 550
39 Ga0075370_10007743 3300006353 Bacteria 5485
40 Ga0068871_100126223 3300006358 Bacteria 2166
41 Ga0068871_100496932 3300006358 Bacteria 1099
42 Ga0068871_100591835 3300006358 Bacteria 1008
43 Ga0075428_100275692 3300006844 Bacteria 1810
44 Ga0075428_100556615 3300006844 Bacteria 1226
45 Ga0075430_101058970 3300006846 Bacteria 668
46 Ga0075431_100068799 3300006847 Bacteria 3653
47 Ga0075433_10600261 3300006852 Bacteria 966
48 Ga0075433_10631340 3300006852 Bacteria 940
49 Ga0075434_100499319 3300006871 Bacteria 1237
50 Ga0075434_101515951 3300006871 Bacteria 679
51 Ga0075429_100421141 3300006880 Bacteria 1170
52 Ga0068865_100914113 3300006881 Bacteria 764
53 Ga0075436_100197937 3300006914 Bacteria 1423
54 Ga0075436_100200152 3300006914 Bacteria 1414
55 Ga0075435_100855478 3300007076 Bacteria 792
56 Ga0111539_10132556 3300009094 Bacteria 2918
57 Ga0111539_10597499 3300009094 Bacteria 1285
58 Ga0105245_10115608 3300009098 Bacteria 2500
59 Ga0114129_10036270 3300009147 Bacteria 6963
60 Ga0114129_12032330 3300009147 Bacteria 694
61 Ga0114129_12497803 3300009147 Bacteria 618
62 Ga0105248_10471979 3300009177 Bacteria 1414
63 Ga0105248_10493242 3300009177 Bacteria 1381
64 Ga0105248_12163347 3300009177 Bacteria 633
65 Ga0105248_12356337 3300009177 Bacteria 606
66 Ga0105238_10610249 3300009551 Bacteria 1099
67 Ga0105249_11191396 3300009553 Bacteria 833
68 Ga0099796_10157049 3300010159 Bacteria 899
69 Ga0105239_11555527 3300010375 Bacteria 765
70 Ga0105246_10998771 3300011119 Bacteria 757
71 Ga0157374_11262255 3300013296 Bacteria 760
72 Ga0157378_11547392 3300013297 Bacteria 708
73 Ga0163162_10169322 3300013306 Bacteria 2309
74 Ga0163162_10397202 3300013306 Bacteria 1511
75 Ga0157372_11722316 3300013307 Bacteria 721
76 Ga0157375_12619432 3300013308 Bacteria 603
77 Ga0163163_10021218 3300014325 Bacteria 6125
78 Ga0163163_10167233 3300014325 Bacteria 2245
79 Ga0163163_10430068 3300014325 Bacteria 1379
80 Ga0157380_10599134 3300014326 Bacteria 1090
81 Ga0182008_10450160 3300014497 Bacteria 700
82 Ga0157377_11298271 3300014745 Bacteria 569
83 Ga0157376_10361429 3300014969 Bacteria 1392
84 Ga0157376_11803974 3300014969 Bacteria 648
85 Ga0157376_12058275 3300014969 Bacteria 609
86 Ga0163161_10208287 3300017792 Bacteria 1510
87 Ga0163161_10434294 3300017792 Bacteria 1059
88 Ga0207682_10115674 3300025893 Bacteria 1185
89 Ga0207692_10004059 3300025898 Bacteria 5771
90 Ga0207685_10002556 3300025905 Bacteria 4198
91 Ga0207685_10615583 3300025905 Bacteria 584
92 Ga0207699_10086732 3300025906 Bacteria 1956
93 Ga0207705_10646535 3300025909 Bacteria 822
94 Ga0207684_10030851 3300025910 Bacteria 4562
95 Ga0207707_10079805 3300025912 Bacteria 2857
96 Ga0207671_11544407 3300025914 Bacteria 512
97 Ga0207693_10121089 3300025915 Bacteria 2055
98 Ga0207663_10039002 3300025916 Bacteria 2875
99 Ga0207652_10024464 3300025921 Bacteria 5010
100 Ga0207694_10715288 3300025924 Bacteria 845
101 Ga0207650_10574556 3300025925 Bacteria 946
102 Ga0207659_10441848 3300025926 Bacteria 1094
103 Ga0207687_10089062 3300025927 Bacteria 2246
104 Ga0207687_11361907 3300025927 Bacteria 610
105 Ga0207700_10028478 3300025928 Bacteria 3928
106 Ga0207664_10014102 3300025929 Bacteria 5764
107 Ga0207664_10446708 3300025929 Bacteria 1154
108 Ga0207670_10556202 3300025936 Bacteria 938
109 Ga0207704_11037518 3300025938 Bacteria 695
110 Ga0207704_11627826 3300025938 Bacteria 555
111 Ga0207691_10007177 3300025940 Bacteria 10748
112 Ga0207691_10650586 3300025940 Bacteria 891
113 Ga0207711_10905635 3300025941 Bacteria 820
114 Ga0207711_11855450 3300025941 Bacteria 546
115 Ga0207689_10633463 3300025942 Bacteria 900
116 Ga0207661_10502925 3300025944 Bacteria 1107
117 Ga0207667_10207260 3300025949 Bacteria 2010
118 Ga0207651_10843429 3300025960 Bacteria 814
119 Ga0207677_11792236 3300026023 Bacteria 570
120 Ga0207678_10442313 3300026067 Bacteria 1129
121 Ga0207678_10658012 3300026067 Bacteria 920
122 Ga0207702_10672396 3300026078 Bacteria 1019
123 Ga0207641_10151365 3300026088 Bacteria 2101
124 Ga0207648_11579017 3300026089 Bacteria 617
125 Ga0207676_12458933 3300026095 Bacteria 518
126 Ga0207674_10576891 3300026116 Bacteria 1086
127 Ga0207674_10925881 3300026116 Bacteria 840
128 Ga0207683_10507930 3300026121 Bacteria 1113
129 Ga0207683_10923183 3300026121 Bacteria 810
130 Ga0209813_10007293 3300027866 Bacteria 2751
131 Ga0268266_10610069 3300028379 Bacteria 1048
132 Ga0268264_10519673 3300028381 Bacteria 1164
133 Ga0307512_10005432 3300030522 Bacteria 13312
134 Ga0307513_10003049 3300031456 Bacteria 22850
135 Ga0307407_10521163 3300031903 Bacteria 874
136 Ga0307416_102499659 3300032002 Bacteria 615
137 Ga0307416_102767497 3300032002 Bacteria 586
138 Ga0307411_10946538 3300032005 Bacteria 768
139 Ga0307415_100695838 3300032126 Bacteria 917
140 Ga0373930_0069700 3300034816 Bacteria 798
141 Ga0373950_0025261 3300034818 Bacteria 1072
142 Ga0373938_0017890 3300034957 Bacteria 1400
143 Ga0373928_0060108 3300035084 Bacteria 917
144 Ga0373929_0012940 3300035085 Bacteria 1592
145 Ga0373934_0031902 3300035086 Bacteria 2064
146 Ga0373949_0045590 3300035090 Bacteria 1090
147 Ga0373951_0062824 3300035091 Bacteria 933
148 Ga0373923_0007341 3300035111 Bacteria 3870
149 Ga0373932_0078224 3300035112 Bacteria 1039
150 Ga0373936_0016839 3300035113 Bacteria 2812
151 Ga0373939_0122143 3300035114 Bacteria 920
152 Ga0373941_0120003 3300035115 Bacteria 936
153 Ga0373945_0546357 3300035116 Bacteria 519
154 Ga0373953_0021418 3300035117 Bacteria 2425
155 Ga0373954_0025319 3300035118 Bacteria 2711
156 Ga0373956_0043978 3300035119 Bacteria 1989
157 Ga0373957_0017041 3300035120 Bacteria 2523
158 Ga0373943_0020460 3300035170 Bacteria 3052
159 Ga0373946_0156673 3300035171 Bacteria 1066
160 Ga0373955_0007842 3300035172 Bacteria 4924
161 Ga0373942_0052211 3300035207 Bacteria 1149
162 Ga0373961_0010915 3300035241 Bacteria 2247
163 Ga0373962_0170392 3300035242 Bacteria 723
164 Ga0373924_0016275 3300035410 Bacteria 2837
165 Ga0373931_0064806 3300035691 Bacteria 1978
166 Ga0373931_0749571 3300035691 Bacteria 648
167 Ga0373935_0003563 3300035692 Bacteria 9071
168 Ga0373927_0782629 3300035695 Bacteria 630
169 Ga0373933_0521902 3300035724 Bacteria 778
170 Ga0373947_0100157 3300035725 Bacteria 1820
171 Ga0373937_0093894 3300036401 Bacteria 2781
172 Ga0373925_0268278 3300037068 Bacteria 1372
173 Ga0395899_1002199 3300037312 Bacteria 504
174 Ga0395900_0633237 3300037418 Bacteria 1007
175 Ga0395898_0249988 3300037466 Bacteria 1691
176 Ga0395905_0329470 3300037471 Bacteria 1417
177 Ga0436360_0326876 3300039438 Bacteria 705
178 Ga0451807_0855245 3300041486 Bacteria 632
179 Ga0451853_0617388 3300041512 Bacteria 998
180 Ga0466960_0000880 3300044901 Bacteria 10608
181 Ga0466958_0398775 3300045836 Bacteria 888
182 Ga0466967_0082427 3300045976 Bacteria 2907
183 Ga0466967_0235685 3300045976 Bacteria 1744
184 Ga0466967_0548482 3300045976 Bacteria 1138
185 Ga0466967_0712264 3300045976 Bacteria 994
186 Ga0495592_0054623 3300046454 Bacteria 2958
187 Ga0495629_0005406 3300046459 Bacteria 9524
188 Ga0495638_0117365 3300046460 Bacteria 1575
189 Ga0495651_0139641 3300046462 Bacteria 1758
190 Ga0495653_0061561 3300046463 Bacteria 2839
191 Ga0495653_0313479 3300046463 Bacteria 1019
192 Ga0495580_0889750 3300046472 Bacteria 573
193 Ga0495582_0018926 3300046473 Bacteria 3767
194 Ga0495639_0009490 3300046475 Bacteria 4174
195 Ga0495662_0006566 3300046476 Bacteria 5807
196 Ga0495664_0039539 3300046477 Bacteria 2787
197 Ga0495664_0614496 3300046477 Bacteria 645
198 Ga0495585_0038996 3300046492 Bacteria 2672
199 Ga0495608_0084590 3300046511 Bacteria 2057
200 Ga0495618_0013191 3300046514 Bacteria 5027
201 Ga0495628_0034248 3300046516 Bacteria 4086
202 Ga0495628_0546405 3300046516 Bacteria 832
203 Ga0495630_0158577 3300046517 Bacteria 1722
204 Ga0495666_0114948 3300046526 Bacteria 1263
205 Ga0495652_0074371 3300046529 Bacteria 2825
206 Ga0495665_0002167 3300046531 Bacteria 10617
207 Ga0495640_0016253 3300046533 Bacteria 5571
208 Ga0495586_0035851 3300046535 Bacteria 2664
209 Ga0495587_0124610 3300046536 Bacteria 1474
210 Ga0495645_0068413 3300046543 Bacteria 2564
211 Ga0495645_0071649 3300046543 Bacteria 2498
212 Ga0495667_0024450 3300046559 Bacteria 4067
213 Ga0495634_0085926 3300046642 Bacteria 2049
214 Ga0495634_0729794 3300046642 Bacteria 568
215 Ga0495635_0075342 3300046663 Bacteria 2311
216 Ga0495657_0048364 3300046675 Bacteria 2869
217 Ga0495657_0089654 3300046675 Bacteria 1975
218 Ga0495599_0026833 3300046678 Bacteria 3610
219 Ga0495623_0077649 3300046679 Bacteria 2058
220 Ga0495646_0139211 3300046680 Bacteria 1358
221 Ga0495658_0095347 3300046683 Bacteria 1768
222 Ga0495658_0447280 3300046683 Bacteria 825
223 Ga0495658_0618641 3300046683 Bacteria 694
224 Ga0495613_0046756 3300046689 Bacteria 3199
225 Ga0495613_0164314 3300046689 Bacteria 1578
226 Ga0495624_0023531 3300046690 Bacteria 4062
227 Ga0495600_0004950 3300046809 Bacteria 8000
228 Ga0495581_0070652 3300047315 Bacteria 2019
229 Ga0495604_0056326 3300047317 Bacteria 3026
230 Ga0495674_0230196 3300047319 Bacteria 1529
231 Ga0495680_0023790 3300047322 Bacteria 5090
232 Ga0495675_0056928 3300047444 Bacteria 2478
233 Ga0495684_0038590 3300047471 Bacteria 3661
234 Ga0495593_0014952 3300047673 Bacteria 4406
235 Ga0495602_1126327 3300048088 Bacteria 513
236 Ga0495614_0051988 3300048089 Bacteria 1756
237 Ga0496100_0473634 3300048903 Bacteria 962
238 Ga0496101_0017466 3300048904 Bacteria 4867
239 Ga0496101_0299002 3300048904 Bacteria 1260
240 Ga0496102_0427108 3300048905 Bacteria 1244
241 Ga0496104_0010068 3300048907 Bacteria 8439
242 Ga0496104_0302150 3300048907 Bacteria 1512
243 Ga0496104_0749814 3300048907 Bacteria 883
244 Ga0496105_0113122 3300048908 Bacteria 2240
245 Ga0496105_0131395 3300048908 Bacteria 2064
246 Ga0496105_0613873 3300048908 Bacteria 843
247 Ga0496106_0412027 3300048909 Bacteria 1086
248 Ga0496107_0071196 3300048910 Bacteria 2526
249 Ga0496107_0196127 3300048910 Bacteria 1501
250 Ga0496108_0005939 3300048911 Bacteria 9889
251 Ga0496108_0296983 3300048911 Bacteria 1407
252 Ga0496108_0407008 3300048911 Bacteria 1188
253 Ga0496109_0009280 3300048912 Bacteria 8381
254 Ga0496109_0249781 3300048912 Bacteria 1670
255 Ga0496109_0487720 3300048912 Bacteria 1163
256 Ga0496110_0091533 3300048913 Bacteria 2721
257 Ga0496110_0142301 3300048913 Bacteria 2168
258 Ga0496110_0439620 3300048913 Bacteria 1189
259 Ga0496110_1429571 3300048913 Bacteria 601
260 Ga0496111_0010763 3300048914 Bacteria 6150
261 Ga0496111_0090457 3300048914 Bacteria 2242
262 Ga0496111_0501548 3300048914 Bacteria 893
263 Ga0496112_0022688 3300048915 Bacteria 5986
264 Ga0496112_0055305 3300048915 Bacteria 3902
265 Ga0496112_0091868 3300048915 Bacteria 3004
266 Ga0496112_0313643 3300048915 Bacteria 1513
267 Ga0496113_0316853 3300048916 Bacteria 1250
268 Ga0496113_1016661 3300048916 Bacteria 652
269 Ga0496114_0002654 3300048917 Bacteria 13645
270 Ga0496114_0569977 3300048917 Bacteria 999
271 Ga0501039_0793801 3300049575 Bacteria 739
272 Ga0501041_0078074 3300049577 Bacteria 2037
273 Ga0501043_0998897 3300049579 Bacteria 596
274 Ga0501079_1469160 3300049741 Bacteria 536
275 Ga0501081_0093065 3300049743 Bacteria 2122
276 nmdc:mga03n38_567377_c1 3300050490 Bacteria 643
277 nmdc:mga03n38_8111_c1 3300050490 Bacteria 3751
278 nmdc:mga00v17_14847_c1 3300050491 Bacteria 4357
279 nmdc:mga00v17_364735_c1 3300050491 Bacteria 939
280 nmdc:mga0yw44_215988_c1 3300050492 Bacteria 1270
281 nmdc:mga0yw44_986165_c1 3300050492 Bacteria 570
282 nmdc:mga06z11_44611_c1 3300050494 Bacteria 2237
283 nmdc:mga04h51_7284_c1 3300050495 Bacteria 2912
284 nmdc:mga07m45_8704_c1 3300050496 Bacteria 5228
285 nmdc:mga05p37_428327_c1 3300050507 Bacteria 1538
286 nmdc:mga09592_404558_c1 3300050508 Bacteria 1180
287 nmdc:mga09592_663253_c1 3300050508 Bacteria 890
288 nmdc:mga0qj67_277314_c1 3300050509 Bacteria 1359
289 nmdc:mga06r32_157427_c1 3300050510 Bacteria 2253
290 nmdc:mga08y16_1101696_c1 3300050511 Bacteria 769
291 nmdc:mga08y16_495292_c1 3300050511 Bacteria 1242
292 nmdc:mga0n895_136669_c1 3300050512 Bacteria 2478
293 nmdc:mga0n895_392132_c1 3300050512 Bacteria 1405
294 nmdc:mga0n895_695153_c1 3300050512 Bacteria 1013
295 nmdc:mga0n895_820392_c1 3300050512 Bacteria 919
296 nmdc:mga0rr50_607493_c1 3300050513 Bacteria 933
297 nmdc:mga08x19_66816_c1 3300050514 Bacteria 2338
298 nmdc:mga0a205_113836_c1 3300050515 Bacteria 2604
299 Ga0495601_0131613 3300053077 Bacteria 1629
300 Ga0495601_0416812 3300053077 Bacteria 870
301 Ga0495612_0172925 3300053078 Bacteria 946
302 Ga0495619_0001961 3300053085 Bacteria 13732
303 Ga0495619_0020920 3300053085 Bacteria 4172
304 Ga0495619_0425790 3300053085 Bacteria 916
305 Ga0530510_0116604 3300061734 Bacteria 1958
306 2868093696 2868088558 Bacteria 7609351
307 Ga0501039_0914608
308 Ga0070677_10137728
309 Ga0068868_101879645
310 Ga0070675_100535637
311 Ga0070673_100979327
312 Ga0070709_10930964
313 Ga0070714_100541953
314 Ga0070705_100406543
315 Ga0070708_100177128
316 Ga0070708_100246330
317 Ga0070663_100301939
318 Ga0070706_100006831
319 Ga0070679_100057170
320 Ga0070679_100535389
321 Ga0070684_102155930
322 Ga0070672_100010648
323 Ga0070672_101156265
324 Ga0070696_100018386
325 Ga0070696_100484774
326 Ga0070665_100252444
327 Ga0070704_100309404
328 Ga0068855_100574715
329 Ga0070664_100241330
330 Ga0068861_100941044
331 Ga0068863_100025461
332 Ga0068860_102558960
333 Ga0081455_10251519
334 Ga0081538_10044562
335 Ga0081540_1003414
336 Ga0070717_10016462
337 Ga0075365_10941497
338 Ga0075368_10003058
339 Ga0075363_100014946
340 Ga0075363_100301909
341 Ga0075364_10016901
342 Ga0075362_10549258
343 Ga0075367_10020879
344 Ga0097621_102024991
345 Ga0075370_10007743
346 Ga0068871_100126223
347 Ga0068871_100496932
348 Ga0068871_100591835
349 Ga0075428_100275692
350 Ga0075428_100556615
351 Ga0075430_101058970
352 Ga0075431_100068799
353 Ga0075433_10600261
354 Ga0075433_10631340
355 Ga0075434_100499319
356 Ga0075434_101515951
357 Ga0075429_100421141
358 Ga0068865_100914113
359 Ga0075436_100197937
360 Ga0075436_100200152
361 Ga0075435_100855478
362 Ga0111539_10132556
363 Ga0111539_10597499
364 Ga0105245_10115608
365 Ga0114129_10036270
366 Ga0114129_12032330
367 Ga0114129_12497803
368 Ga0105248_10471979
369 Ga0105248_10493242
370 Ga0105248_12163347
371 Ga0105248_12356337
372 Ga0105238_10610249
373 Ga0105249_11191396
374 Ga0099796_10157049
375 Ga0105239_11555527
376 Ga0105246_10998771
377 Ga0157374_11262255
378 Ga0157378_11547392
379 Ga0163162_10169322
380 Ga0163162_10397202
381 Ga0157372_11722316
382 Ga0157375_12619432
383 Ga0163163_10021218
384 Ga0163163_10167233
385 Ga0163163_10430068
386 Ga0157380_10599134
387 Ga0182008_10450160
388 Ga0157377_11298271
389 Ga0157376_10361429
390 Ga0157376_11803974
391 Ga0157376_12058275
392 Ga0163161_10208287
393 Ga0163161_10434294
394 Ga0207682_10115674
395 Ga0207692_10004059
396 Ga0207685_10002556
397 Ga0207685_10615583
398 Ga0207699_10086732
399 Ga0207705_10646535
400 Ga0207684_10030851
401 Ga0207707_10079805
402 Ga0207671_11544407
403 Ga0207693_10121089
404 Ga0207663_10039002
405 Ga0207652_10024464
406 Ga0207694_10715288
407 Ga0207650_10574556
408 Ga0207659_10441848
409 Ga0207687_10089062
410 Ga0207687_11361907
411 Ga0207700_10028478
412 Ga0207664_10014102
413 Ga0207664_10446708
414 Ga0207670_10556202
415 Ga0207704_11037518
416 Ga0207704_11627826
417 Ga0207691_10007177
418 Ga0207691_10650586
419 Ga0207711_10905635
420 Ga0207711_11855450
421 Ga0207689_10633463
422 Ga0207661_10502925
423 Ga0207667_10207260
424 Ga0207651_10843429
425 Ga0207677_11792236
426 Ga0207678_10442313
427 Ga0207678_10658012
428 Ga0207702_10672396
429 Ga0207641_10151365
430 Ga0207648_11579017
431 Ga0207676_12458933
432 Ga0207674_10576891
433 Ga0207674_10925881
434 Ga0207683_10507930
435 Ga0207683_10923183
436 Ga0209813_10007293
437 Ga0268266_10610069
438 Ga0268264_10519673
439 Ga0307512_10005432
440 Ga0307513_10003049
441 Ga0307407_10521163
442 Ga0307416_102499659
443 Ga0307416_102767497
444 Ga0307411_10946538
445 Ga0307415_100695838
446 Ga0373930_0069700
447 Ga0373950_0025261
448 Ga0373938_0017890
449 Ga0373928_0060108
450 Ga0373929_0012940
451 Ga0373934_0031902
452 Ga0373949_0045590
453 Ga0373951_0062824
454 Ga0373923_0007341
455 Ga0373932_0078224
456 Ga0373936_0016839
457 Ga0373939_0122143
458 Ga0373941_0120003
459 Ga0373945_0546357
460 Ga0373953_0021418
461 Ga0373954_0025319
462 Ga0373956_0043978
463 Ga0373957_0017041
464 Ga0373943_0020460
465 Ga0373946_0156673
466 Ga0373955_0007842
467 Ga0373942_0052211
468 Ga0373961_0010915
469 Ga0373962_0170392
470 Ga0373924_0016275
471 Ga0373931_0064806
472 Ga0373931_0749571
473 Ga0373935_0003563
474 Ga0373927_0782629
475 Ga0373933_0521902
476 Ga0373947_0100157
477 Ga0373937_0093894
478 Ga0373925_0268278
479 Ga0395899_1002199
480 Ga0395900_0633237
481 Ga0395898_0249988
482 Ga0395905_0329470
483 Ga0436360_0326876
484 Ga0451807_0855245
485 Ga0451853_0617388
486 Ga0466960_0000880
487 Ga0466958_0398775
488 Ga0466967_0082427
489 Ga0466967_0235685
490 Ga0466967_0548482
491 Ga0466967_0712264
492 Ga0495592_0054623
493 Ga0495629_0005406
494 Ga0495638_0117365
495 Ga0495651_0139641
496 Ga0495653_0061561
497 Ga0495653_0313479
498 Ga0495580_0889750
499 Ga0495582_0018926
500 Ga0495639_0009490
501 Ga0495662_0006566
502 Ga0495664_0039539
503 Ga0495664_0614496
504 Ga0495585_0038996
505 Ga0495608_0084590
506 Ga0495618_0013191
507 Ga0495628_0034248
508 Ga0495628_0546405
509 Ga0495630_0158577
510 Ga0495666_0114948
511 Ga0495652_0074371
512 Ga0495665_0002167
513 Ga0495640_0016253
514 Ga0495586_0035851
515 Ga0495587_0124610
516 Ga0495645_0068413
517 Ga0495645_0071649
518 Ga0495667_0024450
519 Ga0495634_0085926
520 Ga0495634_0729794
521 Ga0495635_0075342
522 Ga0495657_0048364
523 Ga0495657_0089654
524 Ga0495599_0026833
525 Ga0495623_0077649
526 Ga0495646_0139211
527 Ga0495658_0095347
528 Ga0495658_0447280
529 Ga0495658_0618641
530 Ga0495613_0046756
531 Ga0495613_0164314
532 Ga0495624_0023531
533 Ga0495600_0004950
534 Ga0495581_0070652
535 Ga0495604_0056326
536 Ga0495674_0230196
537 Ga0495680_0023790
538 Ga0495675_0056928
539 Ga0495684_0038590
540 Ga0495593_0014952
541 Ga0495602_1126327
542 Ga0495614_0051988
543 Ga0496100_0473634
544 Ga0496101_0017466
545 Ga0496101_0299002
546 Ga0496102_0427108
547 Ga0496104_0010068
548 Ga0496104_0302150
549 Ga0496104_0749814
550 Ga0496105_0113122
551 Ga0496105_0131395
552 Ga0496105_0613873
553 Ga0496106_0412027
554 Ga0496107_0071196
555 Ga0496107_0196127
556 Ga0496108_0005939
557 Ga0496108_0296983
558 Ga0496108_0407008
559 Ga0496109_0009280
560 Ga0496109_0249781
561 Ga0496109_0487720
562 Ga0496110_0091533
563 Ga0496110_0142301
564 Ga0496110_0439620
565 Ga0496110_1429571
566 Ga0496111_0010763
567 Ga0496111_0090457
568 Ga0496111_0501548
569 Ga0496112_0022688
570 Ga0496112_0055305
571 Ga0496112_0091868
572 Ga0496112_0313643
573 Ga0496113_0316853
574 Ga0496113_1016661
575 Ga0496114_0002654
576 Ga0496114_0569977
577 Ga0501039_0793801
578 Ga0501041_0078074
579 Ga0501043_0998897
580 Ga0501079_1469160
581 Ga0501081_0093065
582 nmdc:mga03n38_567377_c1
583 nmdc:mga03n38_8111_c1
584 nmdc:mga00v17_14847_c1
585 nmdc:mga00v17_364735_c1
586 nmdc:mga0yw44_215988_c1
587 nmdc:mga0yw44_986165_c1
588 nmdc:mga06z11_44611_c1
589 nmdc:mga04h51_7284_c1
590 nmdc:mga07m45_8704_c1
591 nmdc:mga05p37_428327_c1
592 nmdc:mga09592_404558_c1
593 nmdc:mga09592_663253_c1
594 nmdc:mga0qj67_277314_c1
595 nmdc:mga06r32_157427_c1
596 nmdc:mga08y16_1101696_c1
597 nmdc:mga08y16_495292_c1
598 nmdc:mga0n895_136669_c1
599 nmdc:mga0n895_392132_c1
600 nmdc:mga0n895_695153_c1
601 nmdc:mga0n895_820392_c1
602 nmdc:mga0rr50_607493_c1
603 nmdc:mga08x19_66816_c1
604 nmdc:mga0a205_113836_c1
605 Ga0495601_0131613
606 Ga0495601_0416812
607 Ga0495612_0172925
608 Ga0495619_0001961
609 Ga0495619_0020920
610 Ga0495619_0425790
611 Ga0530510_0116604
612 2868093696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

25

128

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xvo-assembly1.cif.gz_E e. fae cas1-cas2/prespacer/target ternary complex revealing dna sampling and half-integration states 0.631 2 38
5zyf-assembly1.cif.gz_A crystal structure of streptococcus pyogenes type ii-a cas2 0.6202 2 38
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.6187 1 111
5zyf-assembly2.cif.gz_D crystal structure of streptococcus pyogenes type ii-a cas2 0.6186 2 38
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.6138 1 110
ID Description Score Start End Superfamily
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6582 1 111 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6285 1 111 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6224 1 109 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6117 1 109 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.584 1 110 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A7Y6PKH6-F1-model_v4 YCII-related domain-containing protein 0.7298 1 110
AF-L7U3K5-F1-model_v4 YCII-related domain-containing protein 0.7236 1 107
AF-A0A2W5TAL7-F1-model_v4 YCII-related domain-containing protein 0.7233 1 111
AF-A0A7Y6PKH6-F1-model_v4 YCII-related domain-containing protein 0.718 1 110
AF-A0A2W5TAL7-F1-model_v4 YCII-related domain-containing protein 0.7173 1 111

Map