F398882

General Info

Members Datasets Scaffolds Average Seq Length
306 210 612 304

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0015185|Ga0501033_0015185_3549_4535
Length 328
Sequence MDDSSIAGFPRRVSYRSNDLLKEFPMFAMPPIVQTKVFARLPDSLRCPGRRSAWTDARQHREVHSFLEGPSFDRDGNLYCTDIPYGRIFRIAPDGSFTLIAEYDGEPNGLKIHRDGRLFIADHRRGLLAMDPDSGKIETVLERAYGEGFRGLNDLIFAANGDLYFTDQGQSGMQDPSGRVYRLRAGGALECILDGIPSPNGLALNGDESILYVNVTRANAVWRLPLDKHGHTSKVGVFIHLSGGSGPDGLAVDQAGNLAIAHPGLSAAWVFSASGEPVYRIASCAGTRITNLAFGGKDNRTLYMTESESGSILTAELPTAGLALYSHA

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
131 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
159 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
202 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 2643221651 Afipia sp. Root123D2 Isolate Unclassified
205 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
206 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
207 2952252522 Salinicola sp. DM10 Isolate Unclassified
208 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
209 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
210 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0
Isolates 2.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.58
Nodule 0
Rhizoplane 0.65
Rhizosphere 88.56
Stem 0
Stem Tuber 0
Unclassified 7.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0015185 3300049570 Bacteria 5844
2 JGI24741J21665_1005923 3300001915 Bacteria 2502
3 JGI24740J21852_10001230 3300001979 Bacteria 11590
4 JGI24739J22299_10000927 3300001989 Bacteria 10914
5 JGI24737J22298_10006387 3300001990 Bacteria 4027
6 JGI24738J21930_10000229 3300002075 Bacteria 15217
7 Ga0070658_10379645 3300005327 Bacteria 1212
8 Ga0070683_100075722 3300005329 Bacteria 3145
9 Ga0070683_100248867 3300005329 Bacteria 1690
10 Ga0070690_100198877 3300005330 Bacteria 1394
11 Ga0070670_100162362 3300005331 Bacteria 1936
12 Ga0068869_100007417 3300005334 Bacteria 7008
13 Ga0070666_10086603 3300005335 Bacteria 2147
14 Ga0068868_100136236 3300005338 Bacteria 2013
15 Ga0068868_100293706 3300005338 Bacteria 1378
16 Ga0070660_100006371 3300005339 Bacteria 8180
17 Ga0070661_100037796 3300005344 Unclassified 3512
18 Ga0070661_100148753 3300005344 Bacteria 1769
19 Ga0070669_100206786 3300005353 Unclassified 1547
20 Ga0070671_100029372 3300005355 Bacteria 4533
21 Ga0070674_100083477 3300005356 Bacteria 2288
22 Ga0070674_100317166 3300005356 Bacteria 1248
23 Ga0070673_100024672 3300005364 Bacteria 4413
24 Ga0070673_100171993 3300005364 Bacteria 1849
25 Ga0070659_100006952 3300005366 Bacteria 8194
26 Ga0070714_100264914 3300005435 Bacteria 1592
27 Ga0070701_10145546 3300005438 Bacteria 1359
28 Ga0070694_100403494 3300005444 Bacteria 1071
29 Ga0070663_100057493 3300005455 Bacteria 2790
30 Ga0070678_100071446 3300005456 Bacteria 2598
31 Ga0070662_100018615 3300005457 Bacteria 4701
32 Ga0068867_100028852 3300005459 Bacteria 3996
33 Ga0070685_10165355 3300005466 Bacteria 1414
34 Ga0070706_100059091 3300005467 Bacteria 3538
35 Ga0070684_100028190 3300005535 Bacteria 4748
36 Ga0068853_100284632 3300005539 Bacteria 1524
37 Ga0070672_100004657 3300005543 Bacteria 8992
38 Ga0070672_100110844 3300005543 Bacteria 2236
39 Ga0070693_100049294 3300005547 Bacteria 2402
40 Ga0070665_100081949 3300005548 Bacteria 3232
41 Ga0068855_100000946 3300005563 Bacteria 36185
42 Ga0068855_100065647 3300005563 Bacteria 4231
43 Ga0068857_100243058 3300005577 Bacteria 1648
44 Ga0068854_100013927 3300005578 Bacteria 5290
45 Ga0068854_100016160 3300005578 Bacteria 4967
46 Ga0068856_100207106 3300005614 Bacteria 1976
47 Ga0068856_100311232 3300005614 Bacteria 1592
48 Ga0070702_100235700 3300005615 Bacteria 1232
49 Ga0068852_100101486 3300005616 Bacteria 2598
50 Ga0068852_100477742 3300005616 Bacteria 1238
51 Ga0068859_100068724 3300005617 Bacteria 3577
52 Ga0068859_100282787 3300005617 Bacteria 1752
53 Ga0068864_100020704 3300005618 Bacteria 5505
54 Ga0068864_100151295 3300005618 Unclassified 2102
55 Ga0068864_100217289 3300005618 Bacteria 1762
56 Ga0068861_100059620 3300005719 Bacteria 2923
57 Ga0068851_10013735 3300005834 Bacteria 3834
58 Ga0068870_10059872 3300005840 Bacteria 2042
59 Ga0068870_10070693 3300005840 Bacteria 1903
60 Ga0068863_100057559 3300005841 Bacteria 3679
61 Ga0068863_100267384 3300005841 Bacteria 1654
62 Ga0068858_100094163 3300005842 Bacteria 2790
63 Ga0068862_100097256 3300005844 Bacteria 2570
64 Ga0068862_100502027 3300005844 Unclassified 1152
65 Ga0070717_10141691 3300006028 Bacteria 2074
66 Ga0075368_10010894 3300006042 Bacteria 3297
67 Ga0075363_100027554 3300006048 Unclassified 2915
68 Ga0075363_100094876 3300006048 Bacteria 1645
69 Ga0075364_10077450 3300006051 Bacteria 2195
70 Ga0075362_10014745 3300006177 Bacteria 3163
71 Ga0075366_10066691 3300006195 Bacteria 2141
72 Ga0097621_100010122 3300006237 Bacteria 6882
73 Ga0097621_100390397 3300006237 Bacteria 1244
74 Ga0075370_10126041 3300006353 Bacteria 1492
75 Ga0068871_100022366 3300006358 Bacteria 4872
76 Ga0068871_100033435 3300006358 Bacteria 4072
77 Ga0068871_100295138 3300006358 Bacteria 1421
78 Ga0097620_100282809 3300006931 Bacteria 1752
79 Ga0105245_10004641 3300009098 Bacteria 12137
80 Ga0105245_10203765 3300009098 Bacteria 1901
81 Ga0105247_10016004 3300009101 Bacteria 4494
82 Ga0114129_10274438 3300009147 Bacteria 2255
83 Ga0105243_10072683 3300009148 Bacteria 2785
84 Ga0105241_10004360 3300009174 Bacteria 10464
85 Ga0105241_10027065 3300009174 Bacteria 4268
86 Ga0105241_10081994 3300009174 Bacteria 2527
87 Ga0105241_10304857 3300009174 Bacteria 1368
88 Ga0105242_10229146 3300009176 Bacteria 1664
89 Ga0105248_10018444 3300009177 Bacteria 7710
90 Ga0105248_10041085 3300009177 Bacteria 5184
91 Ga0105248_10150616 3300009177 Bacteria 2624
92 Ga0105237_10064670 3300009545 Bacteria 3653
93 Ga0105238_10112105 3300009551 Unclassified 2707
94 Ga0105238_10240650 3300009551 Bacteria 1787
95 Ga0105239_10000300 3300010375 Bacteria 73306
96 Ga0105246_10128207 3300011119 Bacteria 1891
97 Ga0105246_10132077 3300011119 Bacteria 1866
98 Ga0157373_10005771 3300013100 Bacteria 9269
99 Ga0157370_10059441 3300013104 Bacteria 3632
100 Ga0157369_10074835 3300013105 Bacteria 3632
101 Ga0157374_10121886 3300013296 Bacteria 2517
102 Ga0157374_10168174 3300013296 Bacteria 2138
103 Ga0157378_10028453 3300013297 Bacteria 4932
104 Ga0163162_10083294 3300013306 Bacteria 3272
105 Ga0163162_10092340 3300013306 Bacteria 3110
106 Ga0157372_10030820 3300013307 Bacteria 5868
107 Ga0157375_10005904 3300013308 Bacteria 10671
108 Ga0157375_10291231 3300013308 Bacteria 1796
109 Ga0163163_10171082 3300014325 Bacteria 2219
110 Ga0163163_10579026 3300014325 Bacteria 1185
111 Ga0157380_10128380 3300014326 Bacteria 2159
112 Ga0157377_10051599 3300014745 Bacteria 2320
113 Ga0157377_10225834 3300014745 Bacteria 1201
114 Ga0157379_10045375 3300014968 Bacteria 3922
115 Ga0157379_10210703 3300014968 Bacteria 1759
116 Ga0157376_10000094 3300014969 Bacteria 67036
117 Ga0157376_10054184 3300014969 Bacteria 3343
118 Ga0157376_10095040 3300014969 Bacteria 2591
119 Ga0213874_10048683 3300021377 Bacteria 1293
120 Ga0213875_10000114 3300021388 Bacteria 91363
121 Ga0213875_10000638 3300021388 Bacteria 27913
122 Ga0209256_1000545 3300025299 Bacteria 54076
123 Ga0207697_10010673 3300025315 Bacteria 3920
124 Ga0207697_10090751 3300025315 Bacteria 1294
125 Ga0207656_10012608 3300025321 Bacteria 3217
126 Ga0207682_10016931 3300025893 Bacteria 2845
127 Ga0207647_10004844 3300025904 Bacteria 9954
128 Ga0207645_10018240 3300025907 Bacteria 4622
129 Ga0207645_10064534 3300025907 Bacteria 2340
130 Ga0207643_10072329 3300025908 Bacteria 1986
131 Ga0207705_10401257 3300025909 Bacteria 1060
132 Ga0207684_10051633 3300025910 Bacteria 3489
133 Ga0207684_10253796 3300025910 Bacteria 1517
134 Ga0207654_10003283 3300025911 Bacteria 8175
135 Ga0207654_10012701 3300025911 Bacteria 4320
136 Ga0207654_10027892 3300025911 Bacteria 3074
137 Ga0207695_10003338 3300025913 Bacteria 22726
138 Ga0207695_10095219 3300025913 Bacteria 2983
139 Ga0207671_10005757 3300025914 Bacteria 11292
140 Ga0207657_10002610 3300025919 Bacteria 19473
141 Ga0207649_10034725 3300025920 Bacteria 3024
142 Ga0207649_10150454 3300025920 Bacteria 1602
143 Ga0207646_10034893 3300025922 Bacteria 4547
144 Ga0207681_10168073 3300025923 Unclassified 1660
145 Ga0207694_10000230 3300025924 Bacteria 53897
146 Ga0207694_10076773 3300025924 Unclassified 2617
147 Ga0207650_10190302 3300025925 Unclassified 1639
148 Ga0207650_10313010 3300025925 Bacteria 1284
149 Ga0207659_10001938 3300025926 Bacteria 12273
150 Ga0207659_10016503 3300025926 Bacteria 4807
151 Ga0207687_10001130 3300025927 Bacteria 18169
152 Ga0207687_10139832 3300025927 Bacteria 1835
153 Ga0207644_10034489 3300025931 Bacteria 3541
154 Ga0207644_10345944 3300025931 Bacteria 1206
155 Ga0207690_10000052 3300025932 Bacteria 106112
156 Ga0207706_10004132 3300025933 Bacteria 13697
157 Ga0207669_10049836 3300025937 Bacteria 2499
158 Ga0207669_10248588 3300025937 Bacteria 1323
159 Ga0207691_10011889 3300025940 Bacteria 8354
160 Ga0207691_10050952 3300025940 Bacteria 3788
161 Ga0207691_10099102 3300025940 Bacteria 2602
162 Ga0207711_10069690 3300025941 Bacteria 3049
163 Ga0207689_10002918 3300025942 Bacteria 15782
164 Ga0207689_10305803 3300025942 Bacteria 1318
165 Ga0207667_10004913 3300025949 Bacteria 16326
166 Ga0207667_10004970 3300025949 Bacteria 16239
167 Ga0207667_10089707 3300025949 Bacteria 3177
168 Ga0207651_10003682 3300025960 Bacteria 7574
169 Ga0207651_10465987 3300025960 Bacteria 1086
170 Ga0207640_10002879 3300025981 Bacteria 9230
171 Ga0207640_10017614 3300025981 Bacteria 4183
172 Ga0207658_10220916 3300025986 Bacteria 1594
173 Ga0207658_10254199 3300025986 Bacteria 1494
174 Ga0207677_10003071 3300026023 Bacteria 8819
175 Ga0207639_10022651 3300026041 Bacteria 4526
176 Ga0207678_10020956 3300026067 Bacteria 5729
177 Ga0207702_10007333 3300026078 Bacteria 9420
178 Ga0207648_10070848 3300026089 Bacteria 3039
179 Ga0207676_10011350 3300026095 Bacteria 6369
180 Ga0207676_10161076 3300026095 Bacteria 1944
181 Ga0207676_10305305 3300026095 Bacteria 1454
182 Ga0207674_10061594 3300026116 Bacteria 3791
183 Ga0207675_100073395 3300026118 Bacteria 3202
184 Ga0207675_100290096 3300026118 Bacteria 1591
185 Ga0207683_10003929 3300026121 Bacteria 12893
186 Ga0207683_10020771 3300026121 Bacteria 5618
187 Ga0207698_10005276 3300026142 Bacteria 7953
188 Ga0207698_10010313 3300026142 Bacteria 5993
189 Ga0207698_10404214 3300026142 Bacteria 1306
190 Ga0207698_10520481 3300026142 Bacteria 1161
191 Ga0268266_10216467 3300028379 Bacteria 1759
192 Ga0268266_10241373 3300028379 Bacteria 1668
193 Ga0268264_10108445 3300028381 Bacteria 2427
194 Ga0265318_10006687 3300028577 Bacteria 5282
195 Ga0265338_10002191 3300028800 Bacteria 29919
196 Ga0265338_10122387 3300028800 Bacteria 2071
197 Ga0265332_10003470 3300031238 Bacteria 7592
198 Ga0265328_10032715 3300031239 Bacteria 1929
199 Ga0265340_10077698 3300031247 Unclassified 1566
200 Ga0265331_10009547 3300031250 Bacteria 5441
201 Ga0265327_10052408 3300031251 Unclassified 2125
202 Ga0307508_10046984 3300031616 Bacteria 3853
203 Ga0265314_10003566 3300031711 Bacteria 14999
204 Ga0265342_10064587 3300031712 Bacteria 2147
205 Ga0307516_10092839 3300031730 Bacteria 2845
206 Ga0373944_0090067 3300035089 Unclassified 1024
207 Ga0373935_0131305 3300035692 Bacteria 1683
208 Ga0373927_0037439 3300035695 Unclassified 3153
209 Ga0373947_0001015 3300035725 Bacteria 17133
210 Ga0373937_0134088 3300036401 Unclassified 2315
211 Ga0373937_0179481 3300036401 Bacteria 1988
212 Ga0395900_0006875 3300037418 Bacteria 11801
213 Ga0395898_0116678 3300037466 Bacteria 2558
214 Ga0395905_0003059 3300037471 Bacteria 18116
215 Ga0395905_0004446 3300037471 Bacteria 14569
216 Ga0395905_0092712 3300037471 Bacteria 2833
217 Ga0436364_0169648 3300037853 Bacteria 67675
218 Ga0436364_0169683 3300037853 Bacteria 86149
219 Ga0436364_0600077 3300037853 Bacteria 5325
220 Ga0395901_0010690 3300038443 Bacteria 9305
221 Ga0395901_0222471 3300038443 Bacteria 1973
222 Ga0395901_0271502 3300038443 Bacteria 1764
223 Ga0436360_1283663 3300039438 Unclassified 2336
224 Ga0436363_0868997 3300039450 Bacteria 4548
225 Ga0436362_0116190 3300039453 Bacteria 1677
226 Ga0436362_0584668 3300039453 Bacteria 2701
227 Ga0451853_1831262 3300041512 Bacteria 2295
228 Ga0495603_0001015 3300046455 Bacteria 16213
229 Ga0495629_0002149 3300046459 Bacteria 15268
230 Ga0495641_0031438 3300046461 Unclassified 2536
231 Ga0495651_0262831 3300046462 Unclassified 1174
232 Ga0495582_0053237 3300046473 Bacteria 2232
233 Ga0495639_0010795 3300046475 Bacteria 3932
234 Ga0495662_0036106 3300046476 Bacteria 2386
235 Ga0495594_0014133 3300046499 Bacteria 4180
236 Ga0495618_0032721 3300046514 Bacteria 3257
237 Ga0495628_0028421 3300046516 Bacteria 4544
238 Ga0495630_0086599 3300046517 Unclassified 2366
239 Ga0495665_0050013 3300046531 Unclassified 2216
240 Ga0495598_0013652 3300046537 Bacteria 2019
241 Ga0495621_0075973 3300046539 Bacteria 1246
242 Ga0495634_0001754 3300046642 Bacteria 18794
243 Ga0495647_0061835 3300046681 Unclassified 1479
244 Ga0495613_0061562 3300046689 Unclassified 2748
245 Ga0495581_0085935 3300047315 Bacteria 1824
246 Ga0495674_0005258 3300047319 Bacteria 12419
247 Ga0495676_0001135 3300047321 Bacteria 22588
248 Ga0496108_0030901 3300048911 Bacteria 4439
249 Ga0496111_0049698 3300048914 Bacteria 3024
250 Ga0496121_0001529 3300048924 Bacteria 38730
251 Ga0496121_0012654 3300048924 Bacteria 9165
252 Ga0496125_0000328 3300048928 Bacteria 91806
253 Ga0496126_0001434 3300048929 Bacteria 37437
254 Ga0501031_0029895 3300049568 Bacteria 3554
255 Ga0501033_0015059 3300049570 Bacteria 5868
256 Ga0501033_0206846 3300049570 Bacteria 1400
257 Ga0501034_0019146 3300049571 Bacteria 7009
258 Ga0501034_0045004 3300049571 Bacteria 4461
259 Ga0501034_0046894 3300049571 Bacteria 4365
260 Ga0501034_0113377 3300049571 Bacteria 2701
261 Ga0501036_0080475 3300049572 Bacteria 2754
262 Ga0501037_0072406 3300049573 Bacteria 2507
263 Ga0501037_0185116 3300049573 Bacteria 1476
264 Ga0501038_0033803 3300049574 Bacteria 4500
265 Ga0501038_0372928 3300049574 Bacteria 1108
266 Ga0501043_0158272 3300049579 Bacteria 1771
267 Ga0501043_0205325 3300049579 Bacteria 1528
268 Ga0501043_0234239 3300049579 Bacteria 1417
269 Ga0501047_0005565 3300049581 Bacteria 11862
270 Ga0501047_0104732 3300049581 Bacteria 2709
271 Ga0501047_0131357 3300049581 Bacteria 2385
272 Ga0501047_0179429 3300049581 Bacteria 1984
273 Ga0501047_0188367 3300049581 Bacteria 1928
274 Ga0501048_0173280 3300049582 Bacteria 1529
275 Ga0501067_0054436 3300049583 Bacteria 2217
276 Ga0501070_0021694 3300049586 Bacteria 5385
277 Ga0501070_0112471 3300049586 Bacteria 2250
278 Ga0501070_0204030 3300049586 Bacteria 1623
279 Ga0501074_0292027 3300049590 Bacteria 1158
280 Ga0501075_0119786 3300049591 Bacteria 2003
281 Ga0501079_0277513 3300049741 Bacteria 1310
282 Ga0501080_0280633 3300049742 Bacteria 1515
283 Ga0501081_0352137 3300049743 Bacteria 1085
284 Ga0501083_0031631 3300049744 Bacteria 3631
285 Ga0501035_0005879 3300049822 Bacteria 11555
286 Ga0501035_0027089 3300049822 Bacteria 5240
287 Ga0501035_0049185 3300049822 Bacteria 3779
288 Ga0501035_0138740 3300049822 Bacteria 2115
289 Ga0501035_0152359 3300049822 Bacteria 2005
290 Ga0501044_0003746 3300049823 Bacteria 17086
291 Ga0501044_0024814 3300049823 Bacteria 6360
292 nmdc:mga03n38_101453_c1 3300050490 Unclassified 1388
293 nmdc:mga00v17_65775_c1 3300050491 Bacteria 2237
294 nmdc:mga0k408_193181_c1 3300050493 Bacteria 1215
295 nmdc:mga06z11_123933_c1 3300050494 Bacteria 1444
296 Ga0495619_0009504 3300053085 Bacteria 6134
297 Ga0500595_001254 3300053119 Bacteria 13973
298 Ga0500637_0174353 3300053178 Bacteria 1235
299 Ga0501084_0172279 3300054114 Bacteria 1827
300 2644288989 2643221651 Bacteria 4798932
301 2738948163 2738541317 Bacteria 5340176
302 2913312989 2913308742 Bacteria 5350706
303 2952253894 2952252522 Bacteria 4171745
304 3000020360 3000017691 Bacteria 3772574
305 8054567622 8054563764 Bacteria 5592885
306 8057161149 8057160832 Bacteria 3268302
307 Ga0501033_0015185
308 JGI24741J21665_1005923
309 JGI24740J21852_10001230
310 JGI24739J22299_10000927
311 JGI24737J22298_10006387
312 JGI24738J21930_10000229
313 Ga0070658_10379645
314 Ga0070683_100075722
315 Ga0070683_100248867
316 Ga0070690_100198877
317 Ga0070670_100162362
318 Ga0068869_100007417
319 Ga0070666_10086603
320 Ga0068868_100136236
321 Ga0068868_100293706
322 Ga0070660_100006371
323 Ga0070661_100037796
324 Ga0070661_100148753
325 Ga0070669_100206786
326 Ga0070671_100029372
327 Ga0070674_100083477
328 Ga0070674_100317166
329 Ga0070673_100024672
330 Ga0070673_100171993
331 Ga0070659_100006952
332 Ga0070714_100264914
333 Ga0070701_10145546
334 Ga0070694_100403494
335 Ga0070663_100057493
336 Ga0070678_100071446
337 Ga0070662_100018615
338 Ga0068867_100028852
339 Ga0070685_10165355
340 Ga0070706_100059091
341 Ga0070684_100028190
342 Ga0068853_100284632
343 Ga0070672_100004657
344 Ga0070672_100110844
345 Ga0070693_100049294
346 Ga0070665_100081949
347 Ga0068855_100000946
348 Ga0068855_100065647
349 Ga0068857_100243058
350 Ga0068854_100013927
351 Ga0068854_100016160
352 Ga0068856_100207106
353 Ga0068856_100311232
354 Ga0070702_100235700
355 Ga0068852_100101486
356 Ga0068852_100477742
357 Ga0068859_100068724
358 Ga0068859_100282787
359 Ga0068864_100020704
360 Ga0068864_100151295
361 Ga0068864_100217289
362 Ga0068861_100059620
363 Ga0068851_10013735
364 Ga0068870_10059872
365 Ga0068870_10070693
366 Ga0068863_100057559
367 Ga0068863_100267384
368 Ga0068858_100094163
369 Ga0068862_100097256
370 Ga0068862_100502027
371 Ga0070717_10141691
372 Ga0075368_10010894
373 Ga0075363_100027554
374 Ga0075363_100094876
375 Ga0075364_10077450
376 Ga0075362_10014745
377 Ga0075366_10066691
378 Ga0097621_100010122
379 Ga0097621_100390397
380 Ga0075370_10126041
381 Ga0068871_100022366
382 Ga0068871_100033435
383 Ga0068871_100295138
384 Ga0097620_100282809
385 Ga0105245_10004641
386 Ga0105245_10203765
387 Ga0105247_10016004
388 Ga0114129_10274438
389 Ga0105243_10072683
390 Ga0105241_10004360
391 Ga0105241_10027065
392 Ga0105241_10081994
393 Ga0105241_10304857
394 Ga0105242_10229146
395 Ga0105248_10018444
396 Ga0105248_10041085
397 Ga0105248_10150616
398 Ga0105237_10064670
399 Ga0105238_10112105
400 Ga0105238_10240650
401 Ga0105239_10000300
402 Ga0105246_10128207
403 Ga0105246_10132077
404 Ga0157373_10005771
405 Ga0157370_10059441
406 Ga0157369_10074835
407 Ga0157374_10121886
408 Ga0157374_10168174
409 Ga0157378_10028453
410 Ga0163162_10083294
411 Ga0163162_10092340
412 Ga0157372_10030820
413 Ga0157375_10005904
414 Ga0157375_10291231
415 Ga0163163_10171082
416 Ga0163163_10579026
417 Ga0157380_10128380
418 Ga0157377_10051599
419 Ga0157377_10225834
420 Ga0157379_10045375
421 Ga0157379_10210703
422 Ga0157376_10000094
423 Ga0157376_10054184
424 Ga0157376_10095040
425 Ga0213874_10048683
426 Ga0213875_10000114
427 Ga0213875_10000638
428 Ga0209256_1000545
429 Ga0207697_10010673
430 Ga0207697_10090751
431 Ga0207656_10012608
432 Ga0207682_10016931
433 Ga0207647_10004844
434 Ga0207645_10018240
435 Ga0207645_10064534
436 Ga0207643_10072329
437 Ga0207705_10401257
438 Ga0207684_10051633
439 Ga0207684_10253796
440 Ga0207654_10003283
441 Ga0207654_10012701
442 Ga0207654_10027892
443 Ga0207695_10003338
444 Ga0207695_10095219
445 Ga0207671_10005757
446 Ga0207657_10002610
447 Ga0207649_10034725
448 Ga0207649_10150454
449 Ga0207646_10034893
450 Ga0207681_10168073
451 Ga0207694_10000230
452 Ga0207694_10076773
453 Ga0207650_10190302
454 Ga0207650_10313010
455 Ga0207659_10001938
456 Ga0207659_10016503
457 Ga0207687_10001130
458 Ga0207687_10139832
459 Ga0207644_10034489
460 Ga0207644_10345944
461 Ga0207690_10000052
462 Ga0207706_10004132
463 Ga0207669_10049836
464 Ga0207669_10248588
465 Ga0207691_10011889
466 Ga0207691_10050952
467 Ga0207691_10099102
468 Ga0207711_10069690
469 Ga0207689_10002918
470 Ga0207689_10305803
471 Ga0207667_10004913
472 Ga0207667_10004970
473 Ga0207667_10089707
474 Ga0207651_10003682
475 Ga0207651_10465987
476 Ga0207640_10002879
477 Ga0207640_10017614
478 Ga0207658_10220916
479 Ga0207658_10254199
480 Ga0207677_10003071
481 Ga0207639_10022651
482 Ga0207678_10020956
483 Ga0207702_10007333
484 Ga0207648_10070848
485 Ga0207676_10011350
486 Ga0207676_10161076
487 Ga0207676_10305305
488 Ga0207674_10061594
489 Ga0207675_100073395
490 Ga0207675_100290096
491 Ga0207683_10003929
492 Ga0207683_10020771
493 Ga0207698_10005276
494 Ga0207698_10010313
495 Ga0207698_10404214
496 Ga0207698_10520481
497 Ga0268266_10216467
498 Ga0268266_10241373
499 Ga0268264_10108445
500 Ga0265318_10006687
501 Ga0265338_10002191
502 Ga0265338_10122387
503 Ga0265332_10003470
504 Ga0265328_10032715
505 Ga0265340_10077698
506 Ga0265331_10009547
507 Ga0265327_10052408
508 Ga0307508_10046984
509 Ga0265314_10003566
510 Ga0265342_10064587
511 Ga0307516_10092839
512 Ga0373944_0090067
513 Ga0373935_0131305
514 Ga0373927_0037439
515 Ga0373947_0001015
516 Ga0373937_0134088
517 Ga0373937_0179481
518 Ga0395900_0006875
519 Ga0395898_0116678
520 Ga0395905_0003059
521 Ga0395905_0004446
522 Ga0395905_0092712
523 Ga0436364_0169648
524 Ga0436364_0169683
525 Ga0436364_0600077
526 Ga0395901_0010690
527 Ga0395901_0222471
528 Ga0395901_0271502
529 Ga0436360_1283663
530 Ga0436363_0868997
531 Ga0436362_0116190
532 Ga0436362_0584668
533 Ga0451853_1831262
534 Ga0495603_0001015
535 Ga0495629_0002149
536 Ga0495641_0031438
537 Ga0495651_0262831
538 Ga0495582_0053237
539 Ga0495639_0010795
540 Ga0495662_0036106
541 Ga0495594_0014133
542 Ga0495618_0032721
543 Ga0495628_0028421
544 Ga0495630_0086599
545 Ga0495665_0050013
546 Ga0495598_0013652
547 Ga0495621_0075973
548 Ga0495634_0001754
549 Ga0495647_0061835
550 Ga0495613_0061562
551 Ga0495581_0085935
552 Ga0495674_0005258
553 Ga0495676_0001135
554 Ga0496108_0030901
555 Ga0496111_0049698
556 Ga0496121_0001529
557 Ga0496121_0012654
558 Ga0496125_0000328
559 Ga0496126_0001434
560 Ga0501031_0029895
561 Ga0501033_0015059
562 Ga0501033_0206846
563 Ga0501034_0019146
564 Ga0501034_0045004
565 Ga0501034_0046894
566 Ga0501034_0113377
567 Ga0501036_0080475
568 Ga0501037_0072406
569 Ga0501037_0185116
570 Ga0501038_0033803
571 Ga0501038_0372928
572 Ga0501043_0158272
573 Ga0501043_0205325
574 Ga0501043_0234239
575 Ga0501047_0005565
576 Ga0501047_0104732
577 Ga0501047_0131357
578 Ga0501047_0179429
579 Ga0501047_0188367
580 Ga0501048_0173280
581 Ga0501067_0054436
582 Ga0501070_0021694
583 Ga0501070_0112471
584 Ga0501070_0204030
585 Ga0501074_0292027
586 Ga0501075_0119786
587 Ga0501079_0277513
588 Ga0501080_0280633
589 Ga0501081_0352137
590 Ga0501083_0031631
591 Ga0501035_0005879
592 Ga0501035_0027089
593 Ga0501035_0049185
594 Ga0501035_0138740
595 Ga0501035_0152359
596 Ga0501044_0003746
597 Ga0501044_0024814
598 nmdc:mga03n38_101453_c1
599 nmdc:mga00v17_65775_c1
600 nmdc:mga0k408_193181_c1
601 nmdc:mga06z11_123933_c1
602 Ga0495619_0009504
603 Ga0500595_001254
604 Ga0500637_0174353
605 Ga0501084_0172279
606 2644288989
607 2738948163
608 2913312989
609 2952253894
610 3000020360
611 8054567622
612 8057161149

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

66

308

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dk0-assembly1.cif.gz_A crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound (s)gamma-valerolactone 0.9023 36 300
7riz-assembly1.cif.gz_A crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound 2-hydroxyquinoline 0.8913 36 300
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.8666 33 294
3g4e-assembly1.cif.gz_A crystal structure of human senescence marker protein-30(smp30)(calcium bound) 0.8623 36 302
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.8587 8 299
ID Description Score Start End Superfamily
af_Q6TLF6_1_295_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8657 36 302 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.864 8 299 2.120.10.30
2dg0A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8612 5 304 2.120.10.30
af_Q4DLZ5_134_347_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8606 106 289 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8562 33 294 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A848NP17-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9899 226 299
AF-A0A8A5XEJ2-F1-model_v4 deleted 0.9863 1 304
AF-A0A840Y9K6-F1-model_v4 Sugar lactone lactonase YvrE 0.9822 35 103 GO:0016787
AF-A0A7G2M378-F1-model_v4 Gluconolactonase 0.9807 44 172 GO:0016787
AF-A0A7Y4J735-F1-model_v4 deleted 0.9779 51 194

Map