F398819

General Info

Members Datasets Scaffolds Average Seq Length
306 178 612 138

Family's Representative Sequence

Representative Sequence 3300046473|Ga0495582_0524326|Ga0495582_0524326_69_551
Length 160
Sequence LSNENRQNDEARMTNNEGTRKMRTVLKAKIRFLWPIIAVAVTCLSLVTVSAAGHQHSTPQEIFDGMRGSFQPAKAKGVHARYQWDLSGPNGGEWWIDVNDGTYKMGTGKIASPSVTFIAKDKDWVAICNDQISGTWAYLTGRLKVRGDQAVARKLGEIFP

Samples

Sample ID Description Type Environment
1 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
83 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.9
Rhizosphere 93.79
Stem 0
Stem Tuber 0
Unclassified 38.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495582_0524326 3300046473 Unclassified 685
2 JGI25406J46586_10022426 3300003203 Bacteria 2515
3 Ga0065704_10199586 3300005289 Bacteria 1146
4 Ga0065712_10002551 3300005290 Bacteria 4927
5 Ga0065712_10083098 3300005290 Bacteria 2862
6 Ga0065712_10083424 3300005290 Bacteria 2791
7 Ga0065712_10594300 3300005290 Unclassified 594
8 Ga0065715_10003559 3300005293 Bacteria 6410
9 Ga0065715_10004134 3300005293 Bacteria 6036
10 Ga0065715_10006865 3300005293 Bacteria 3057
11 Ga0065715_10014119 3300005293 Bacteria 1822
12 Ga0065715_10426580 3300005293 Unclassified 852
13 Ga0065715_10711434 3300005293 Bacteria 648
14 Ga0070683_100006773 3300005329 Bacteria 9630
15 Ga0070683_101547687 3300005329 Bacteria 637
16 Ga0070690_101139411 3300005330 Unclassified 620
17 Ga0070690_101155717 3300005330 Unclassified 616
18 Ga0070670_101064725 3300005331 Unclassified 737
19 Ga0070666_10086152 3300005335 Bacteria 2152
20 Ga0070666_10533123 3300005335 Unclassified 853
21 Ga0068868_100123855 3300005338 Unclassified 2110
22 Ga0070660_100059113 3300005339 Unclassified 2973
23 Ga0070689_100175125 3300005340 Bacteria 1740
24 Ga0070687_100157555 3300005343 Bacteria 1339
25 Ga0070661_100376299 3300005344 Unclassified 1119
26 Ga0070669_100653149 3300005353 Bacteria 885
27 Ga0070671_100269869 3300005355 Bacteria 1446
28 Ga0070673_100066929 3300005364 Bacteria 2871
29 Ga0070688_100011194 3300005365 Bacteria 4980
30 Ga0070688_100114100 3300005365 Bacteria 1801
31 Ga0070667_100056178 3300005367 Bacteria 3325
32 Ga0070709_10173572 3300005434 Bacteria 1508
33 Ga0070714_100080889 3300005435 Bacteria 2827
34 Ga0070713_100058367 3300005436 Unclassified 3218
35 Ga0070713_100505815 3300005436 Bacteria 1140
36 Ga0070713_100793127 3300005436 Unclassified 908
37 Ga0070710_10044779 3300005437 Unclassified 2456
38 Ga0070710_10162529 3300005437 Unclassified 1386
39 Ga0070710_11460017 3300005437 Unclassified 513
40 Ga0070711_100015946 3300005439 Bacteria 4762
41 Ga0070711_100157374 3300005439 Bacteria 1719
42 Ga0070708_100050108 3300005445 Unclassified 3696
43 Ga0070708_100177803 3300005445 Bacteria 1989
44 Ga0070708_100245041 3300005445 Unclassified 1683
45 Ga0070708_100432113 3300005445 Bacteria 1242
46 Ga0070663_100187919 3300005455 Bacteria 1606
47 Ga0070678_100025756 3300005456 Bacteria 3964
48 Ga0070662_100131239 3300005457 Bacteria 1932
49 Ga0070681_10081897 3300005458 Bacteria 3183
50 Ga0070685_10005694 3300005466 Bacteria 6327
51 Ga0070706_100026114 3300005467 Bacteria 5373
52 Ga0070706_100041956 3300005467 Bacteria 4225
53 Ga0070706_100100952 3300005467 Bacteria 2682
54 Ga0070706_100218844 3300005467 Bacteria 1777
55 Ga0070706_100264085 3300005467 Unclassified 1607
56 Ga0070706_100284968 3300005467 Unclassified 1542
57 Ga0070707_100001020 3300005468 Bacteria 27758
58 Ga0070707_100018132 3300005468 Bacteria 6623
59 Ga0070707_100041444 3300005468 Bacteria 4407
60 Ga0070707_100151181 3300005468 Bacteria 2260
61 Ga0070707_100362337 3300005468 Unclassified 1408
62 Ga0070707_100428238 3300005468 Bacteria 1284
63 Ga0070707_100691403 3300005468 Unclassified 983
64 Ga0070707_100984377 3300005468 Unclassified 809
65 Ga0070707_101184984 3300005468 Bacteria 730
66 Ga0070698_100015518 3300005471 Bacteria 8046
67 Ga0070698_100018961 3300005471 Bacteria 7237
68 Ga0070698_101932466 3300005471 Unclassified 543
69 Ga0070699_100014116 3300005518 Bacteria 6873
70 Ga0070699_100155136 3300005518 Bacteria 2026
71 Ga0070699_100591442 3300005518 Unclassified 1011
72 Ga0070679_100657125 3300005530 Unclassified 991
73 Ga0070679_101133706 3300005530 Unclassified 727
74 Ga0070684_100011526 3300005535 Bacteria 7042
75 Ga0070684_100860607 3300005535 Unclassified 849
76 Ga0070697_100011097 3300005536 Bacteria 7040
77 Ga0070697_100017600 3300005536 Bacteria 5626
78 Ga0070697_100259845 3300005536 Bacteria 1486
79 Ga0070672_100213923 3300005543 Unclassified 1615
80 Ga0070686_101312218 3300005544 Unclassified 605
81 Ga0070696_100731583 3300005546 Bacteria 809
82 Ga0070665_100026694 3300005548 Bacteria 5815
83 Ga0070665_100093012 3300005548 Bacteria 3020
84 Ga0070665_100302429 3300005548 Bacteria 1603
85 Ga0070665_100505846 3300005548 Bacteria 1219
86 Ga0070664_100853867 3300005564 Unclassified 852
87 Ga0068856_100757271 3300005614 Bacteria 991
88 Ga0068856_101501063 3300005614 Unclassified 688
89 Ga0068861_101506190 3300005719 Unclassified 660
90 Ga0068863_100359687 3300005841 Unclassified 1419
91 Ga0068858_102181128 3300005842 Unclassified 548
92 Ga0068860_100389020 3300005843 Bacteria 1378
93 Ga0081455_10036032 3300005937 Unclassified 4411
94 Ga0081539_10000511 3300005985 Bacteria 80587
95 Ga0081539_10126806 3300005985 Bacteria 1259
96 Ga0070717_10003206 3300006028 Bacteria 11685
97 Ga0070717_10005229 3300006028 Bacteria 9457
98 Ga0070717_10017145 3300006028 Bacteria 5628
99 Ga0070717_10018266 3300006028 Bacteria 5472
100 Ga0070717_10058607 3300006028 Unclassified 3184
101 Ga0070717_10524966 3300006028 Bacteria 1071
102 Ga0070715_10004898 3300006163 Bacteria 4437
103 Ga0070716_100022115 3300006173 Unclassified 3358
104 Ga0070716_100040212 3300006173 Bacteria 2601
105 Ga0070716_100507025 3300006173 Bacteria 891
106 Ga0070716_100585822 3300006173 Unclassified 837
107 Ga0070712_100028850 3300006175 Bacteria 3715
108 Ga0070712_100033750 3300006175 Bacteria 3464
109 Ga0070712_100171757 3300006175 Bacteria 1682
110 Ga0070712_100300169 3300006175 Unclassified 1300
111 Ga0070712_100498973 3300006175 Unclassified 1020
112 Ga0070712_101553631 3300006175 Bacteria 579
113 Ga0097621_100318040 3300006237 Bacteria 1378
114 Ga0068871_101149380 3300006358 Unclassified 727
115 Ga0068871_101286588 3300006358 Unclassified 687
116 Ga0075433_10400823 3300006852 Unclassified 1210
117 Ga0075434_100207967 3300006871 Unclassified 1978
118 Ga0075434_101380350 3300006871 Unclassified 715
119 Ga0075436_100078271 3300006914 Bacteria 2291
120 Ga0075436_100880527 3300006914 Unclassified 669
121 Ga0099794_10262917 3300007265 Unclassified 891
122 Ga0099794_10466893 3300007265 Unclassified 663
123 Ga0099795_10012091 3300007788 Bacteria 2606
124 Ga0111539_10078486 3300009094 Bacteria 3884
125 Ga0105245_10087411 3300009098 Bacteria 2861
126 Ga0105241_10110638 3300009174 Bacteria 2198
127 Ga0105248_10367499 3300009177 Bacteria 1620
128 Ga0105237_10299984 3300009545 Unclassified 1610
129 Ga0105249_11747655 3300009553 Unclassified 694
130 Ga0099796_10021919 3300010159 Bacteria 1975
131 Ga0099796_10067000 3300010159 Unclassified 1287
132 Ga0105239_10085320 3300010375 Unclassified 3480
133 Ga0105239_10291673 3300010375 Unclassified 1837
134 Ga0105246_10097992 3300011119 Bacteria 2129
135 Ga0157327_1009550 3300012512 Unclassified 896
136 Ga0157374_10017751 3300013296 Bacteria 6270
137 Ga0157374_10019506 3300013296 Bacteria 6002
138 Ga0157374_10062615 3300013296 Bacteria 3487
139 Ga0157374_10085771 3300013296 Bacteria 2995
140 Ga0157374_10223065 3300013296 Bacteria 1850
141 Ga0157374_10493008 3300013296 Bacteria 1229
142 Ga0157374_11766591 3300013296 Unclassified 643
143 Ga0157378_10009660 3300013297 Bacteria 8399
144 Ga0157378_10077111 3300013297 Unclassified 3004
145 Ga0157378_10363691 3300013297 Bacteria 1416
146 Ga0163162_10563077 3300013306 Unclassified 1267
147 Ga0163162_12128461 3300013306 Unclassified 644
148 Ga0157372_10255805 3300013307 Bacteria 2033
149 Ga0157372_10838393 3300013307 Unclassified 1067
150 Ga0157375_10544739 3300013308 Unclassified 1322
151 Ga0163163_10058262 3300014325 Bacteria 3819
152 Ga0182008_10402552 3300014497 Unclassified 736
153 Ga0182008_10915062 3300014497 Unclassified 517
154 Ga0157379_10395524 3300014968 Bacteria 1269
155 Ga0157379_12072894 3300014968 Unclassified 563
156 Ga0157376_10041248 3300014969 Bacteria 3778
157 Ga0157376_10195587 3300014969 Bacteria 1857
158 Ga0182006_1111892 3300015261 Bacteria 958
159 Ga0163161_10185273 3300017792 Bacteria 1598
160 Ga0213874_10347934 3300021377 Unclassified 567
161 Ga0207666_1000088 3300025271 Bacteria 14732
162 Ga0207666_1008269 3300025271 Unclassified 1386
163 Ga0207673_1000599 3300025290 Bacteria 3828
164 Ga0207673_1024470 3300025290 Unclassified 825
165 Ga0207697_10003475 3300025315 Bacteria 7777
166 Ga0207697_10011291 3300025315 Bacteria 3782
167 Ga0207697_10039306 3300025315 Bacteria 1941
168 Ga0207692_10071996 3300025898 Unclassified 1824
169 Ga0207692_10205954 3300025898 Bacteria 1159
170 Ga0207680_10022212 3300025903 Bacteria 3447
171 Ga0207685_10090830 3300025905 Unclassified 1285
172 Ga0207685_10119961 3300025905 Unclassified 1153
173 Ga0207699_10249263 3300025906 Bacteria 1223
174 Ga0207684_10015659 3300025910 Bacteria 6526
175 Ga0207684_10016698 3300025910 Bacteria 6304
176 Ga0207684_10035095 3300025910 Bacteria 4258
177 Ga0207684_10118895 3300025910 Bacteria 2265
178 Ga0207684_10235919 3300025910 Bacteria 1578
179 Ga0207684_10294280 3300025910 Unclassified 1400
180 Ga0207684_10407236 3300025910 Unclassified 1169
181 Ga0207707_10026054 3300025912 Bacteria 5113
182 Ga0207671_10722392 3300025914 Unclassified 792
183 Ga0207693_10039924 3300025915 Bacteria 3696
184 Ga0207693_10155751 3300025915 Bacteria 1797
185 Ga0207693_10233006 3300025915 Unclassified 1446
186 Ga0207693_10686656 3300025915 Unclassified 794
187 Ga0207693_10719231 3300025915 Unclassified 773
188 Ga0207663_10040569 3300025916 Bacteria 2830
189 Ga0207663_10120862 3300025916 Unclassified 1793
190 Ga0207657_11352177 3300025919 Unclassified 536
191 Ga0207649_10091069 3300025920 Bacteria 1997
192 Ga0207652_11034842 3300025921 Bacteria 720
193 Ga0207646_10000683 3300025922 Bacteria 43891
194 Ga0207646_10003687 3300025922 Bacteria 17104
195 Ga0207646_10051432 3300025922 Bacteria 3686
196 Ga0207646_10106086 3300025922 Bacteria 2520
197 Ga0207646_10282369 3300025922 Bacteria 1500
198 Ga0207646_10387875 3300025922 Unclassified 1262
199 Ga0207646_10478785 3300025922 Bacteria 1123
200 Ga0207646_10847772 3300025922 Bacteria 812
201 Ga0207646_10897324 3300025922 Unclassified 786
202 Ga0207646_10945978 3300025922 Bacteria 763
203 Ga0207659_11069197 3300025926 Unclassified 694
204 Ga0207687_10306545 3300025927 Unclassified 1280
205 Ga0207700_10178961 3300025928 Unclassified 1774
206 Ga0207664_10306601 3300025929 Unclassified 1398
207 Ga0207664_10556259 3300025929 Bacteria 1029
208 Ga0207664_10559005 3300025929 Unclassified 1027
209 Ga0207644_10157348 3300025931 Bacteria 1763
210 Ga0207644_10459953 3300025931 Bacteria 1046
211 Ga0207706_10086780 3300025933 Bacteria 2751
212 Ga0207686_10151114 3300025934 Bacteria 1617
213 Ga0207670_10227613 3300025936 Bacteria 1430
214 Ga0207665_10012907 3300025939 Bacteria 5494
215 Ga0207665_10035111 3300025939 Unclassified 3326
216 Ga0207665_10036716 3300025939 Unclassified 3260
217 Ga0207665_10137883 3300025939 Bacteria 1737
218 Ga0207665_10214522 3300025939 Unclassified 1408
219 Ga0207711_11000568 3300025941 Unclassified 775
220 Ga0207661_10017078 3300025944 Bacteria 5362
221 Ga0207679_10205220 3300025945 Bacteria 1649
222 Ga0207651_10024232 3300025960 Bacteria 3749
223 Ga0207668_10129135 3300025972 Unclassified 1927
224 Ga0207658_10059928 3300025986 Bacteria 2838
225 Ga0207678_10136838 3300026067 Bacteria 2090
226 Ga0207702_10385012 3300026078 Bacteria 1349
227 Ga0207641_10228391 3300026088 Bacteria 1729
228 Ga0207683_10009254 3300026121 Bacteria 8392
229 Ga0207698_10133079 3300026142 Bacteria 2129
230 Ga0207428_10111347 3300027907 Unclassified 2106
231 Ga0268266_10015223 3300028379 Bacteria 6605
232 Ga0268266_10024390 3300028379 Bacteria 5144
233 Ga0268266_10843820 3300028379 Unclassified 885
234 Ga0373934_0509416 3300035086 Unclassified 506
235 Ga0373954_0012598 3300035118 Bacteria 3762
236 Ga0373924_0169736 3300035410 Unclassified 959
237 Ga0373935_0195507 3300035692 Unclassified 1395
238 Ga0373927_0621831 3300035695 Unclassified 714
239 Ga0373933_0112146 3300035724 Unclassified 1702
240 Ga0373937_0151896 3300036401 Bacteria 2169
241 Ga0373925_0104286 3300037068 Unclassified 2183
242 Ga0373925_0616180 3300037068 Bacteria 894
243 Ga0395899_0909831 3300037312 Unclassified 536
244 Ga0395900_0704546 3300037418 Bacteria 943
245 Ga0395898_0714070 3300037466 Bacteria 944
246 Ga0395901_0755384 3300038443 Bacteria 965
247 Ga0436363_0500727 3300039450 Bacteria 2001
248 Ga0436363_1398205 3300039450 Unclassified 547
249 Ga0451853_0585545 3300041512 Bacteria 1038
250 Ga0439454_011713 3300042011 Unclassified 1177
251 Ga0495592_0002298 3300046454 Bacteria 13484
252 Ga0495641_0219493 3300046461 Bacteria 853
253 Ga0495651_0672896 3300046462 Bacteria 647
254 Ga0495653_0095534 3300046463 Bacteria 2163
255 Ga0495653_0394554 3300046463 Unclassified 881
256 Ga0495639_0134091 3300046475 Bacteria 1187
257 Ga0495664_0282250 3300046477 Bacteria 1003
258 Ga0495618_0110224 3300046514 Bacteria 1762
259 Ga0495628_0042447 3300046516 Bacteria 3627
260 Ga0495630_0048087 3300046517 Bacteria 3192
261 Ga0495630_0575490 3300046517 Unclassified 863
262 Ga0495652_0051360 3300046529 Bacteria 3521
263 Ga0495640_0099626 3300046533 Bacteria 1909
264 Ga0495586_0021954 3300046535 Bacteria 3406
265 Ga0495587_0116482 3300046536 Unclassified 1532
266 Ga0495645_0016308 3300046543 Bacteria 5302
267 Ga0495667_0097353 3300046559 Bacteria 1905
268 Ga0495659_0249951 3300046664 Unclassified 739
269 Ga0495657_0272227 3300046675 Unclassified 1015
270 Ga0495657_0505778 3300046675 Bacteria 704
271 Ga0495623_0211913 3300046679 Unclassified 1108
272 Ga0495647_0050752 3300046681 Bacteria 1611
273 Ga0495604_0147945 3300047317 Unclassified 1672
274 Ga0495674_0214021 3300047319 Unclassified 1595
275 Ga0495674_0312689 3300047319 Bacteria 1281
276 Ga0495676_0680888 3300047321 Bacteria 666
277 Ga0495680_0208921 3300047322 Bacteria 1398
278 Ga0495680_0537537 3300047322 Bacteria 789
279 Ga0495675_0078356 3300047444 Bacteria 2081
280 Ga0495684_0007546 3300047471 Bacteria 8419
281 Ga0495593_0243010 3300047673 Unclassified 902
282 Ga0495602_0063089 3300048088 Bacteria 3212
283 Ga0496100_0702994 3300048903 Unclassified 789
284 Ga0496104_0182007 3300048907 Bacteria 2012
285 Ga0496104_0925905 3300048907 Unclassified 776
286 Ga0496106_1467886 3300048909 Unclassified 525
287 Ga0496108_0051436 3300048911 Bacteria 3452
288 Ga0496108_0485654 3300048911 Bacteria 1079
289 Ga0496108_1231305 3300048911 Unclassified 632
290 Ga0496109_0014550 3300048912 Bacteria 6845
291 Ga0496109_0069150 3300048912 Bacteria 3238
292 Ga0496109_0322395 3300048912 Unclassified 1458
293 Ga0496110_0354428 3300048913 Bacteria 1337
294 Ga0496112_0190598 3300048915 Bacteria 2012
295 Ga0496112_0396928 3300048915 Unclassified 1319
296 Ga0496112_0772900 3300048915 Unclassified 886
297 Ga0496115_0018934 3300048918 Bacteria 5296
298 nmdc:mga08y16_191996_c1 3300050511 Bacteria 2118
299 nmdc:mga0n895_1249112_c1 3300050512 Unclassified 715
300 nmdc:mga08x19_52124_c1 3300050514 Bacteria 2630
301 nmdc:mga0a205_1113783_c1 3300050515 Bacteria 637
302 Ga0495601_0016991 3300053077 Bacteria 4413
303 Ga0495601_0337515 3300053077 Bacteria 980
304 Ga0495612_0029398 3300053078 Bacteria 2213
305 Ga0495595_0139268 3300053084 Bacteria 1190
306 Ga0495619_0717582 3300053085 Unclassified 679
307 Ga0495582_0524326
308 JGI25406J46586_10022426
309 Ga0065704_10199586
310 Ga0065712_10002551
311 Ga0065712_10083098
312 Ga0065712_10083424
313 Ga0065712_10594300
314 Ga0065715_10003559
315 Ga0065715_10004134
316 Ga0065715_10006865
317 Ga0065715_10014119
318 Ga0065715_10426580
319 Ga0065715_10711434
320 Ga0070683_100006773
321 Ga0070683_101547687
322 Ga0070690_101139411
323 Ga0070690_101155717
324 Ga0070670_101064725
325 Ga0070666_10086152
326 Ga0070666_10533123
327 Ga0068868_100123855
328 Ga0070660_100059113
329 Ga0070689_100175125
330 Ga0070687_100157555
331 Ga0070661_100376299
332 Ga0070669_100653149
333 Ga0070671_100269869
334 Ga0070673_100066929
335 Ga0070688_100011194
336 Ga0070688_100114100
337 Ga0070667_100056178
338 Ga0070709_10173572
339 Ga0070714_100080889
340 Ga0070713_100058367
341 Ga0070713_100505815
342 Ga0070713_100793127
343 Ga0070710_10044779
344 Ga0070710_10162529
345 Ga0070710_11460017
346 Ga0070711_100015946
347 Ga0070711_100157374
348 Ga0070708_100050108
349 Ga0070708_100177803
350 Ga0070708_100245041
351 Ga0070708_100432113
352 Ga0070663_100187919
353 Ga0070678_100025756
354 Ga0070662_100131239
355 Ga0070681_10081897
356 Ga0070685_10005694
357 Ga0070706_100026114
358 Ga0070706_100041956
359 Ga0070706_100100952
360 Ga0070706_100218844
361 Ga0070706_100264085
362 Ga0070706_100284968
363 Ga0070707_100001020
364 Ga0070707_100018132
365 Ga0070707_100041444
366 Ga0070707_100151181
367 Ga0070707_100362337
368 Ga0070707_100428238
369 Ga0070707_100691403
370 Ga0070707_100984377
371 Ga0070707_101184984
372 Ga0070698_100015518
373 Ga0070698_100018961
374 Ga0070698_101932466
375 Ga0070699_100014116
376 Ga0070699_100155136
377 Ga0070699_100591442
378 Ga0070679_100657125
379 Ga0070679_101133706
380 Ga0070684_100011526
381 Ga0070684_100860607
382 Ga0070697_100011097
383 Ga0070697_100017600
384 Ga0070697_100259845
385 Ga0070672_100213923
386 Ga0070686_101312218
387 Ga0070696_100731583
388 Ga0070665_100026694
389 Ga0070665_100093012
390 Ga0070665_100302429
391 Ga0070665_100505846
392 Ga0070664_100853867
393 Ga0068856_100757271
394 Ga0068856_101501063
395 Ga0068861_101506190
396 Ga0068863_100359687
397 Ga0068858_102181128
398 Ga0068860_100389020
399 Ga0081455_10036032
400 Ga0081539_10000511
401 Ga0081539_10126806
402 Ga0070717_10003206
403 Ga0070717_10005229
404 Ga0070717_10017145
405 Ga0070717_10018266
406 Ga0070717_10058607
407 Ga0070717_10524966
408 Ga0070715_10004898
409 Ga0070716_100022115
410 Ga0070716_100040212
411 Ga0070716_100507025
412 Ga0070716_100585822
413 Ga0070712_100028850
414 Ga0070712_100033750
415 Ga0070712_100171757
416 Ga0070712_100300169
417 Ga0070712_100498973
418 Ga0070712_101553631
419 Ga0097621_100318040
420 Ga0068871_101149380
421 Ga0068871_101286588
422 Ga0075433_10400823
423 Ga0075434_100207967
424 Ga0075434_101380350
425 Ga0075436_100078271
426 Ga0075436_100880527
427 Ga0099794_10262917
428 Ga0099794_10466893
429 Ga0099795_10012091
430 Ga0111539_10078486
431 Ga0105245_10087411
432 Ga0105241_10110638
433 Ga0105248_10367499
434 Ga0105237_10299984
435 Ga0105249_11747655
436 Ga0099796_10021919
437 Ga0099796_10067000
438 Ga0105239_10085320
439 Ga0105239_10291673
440 Ga0105246_10097992
441 Ga0157327_1009550
442 Ga0157374_10017751
443 Ga0157374_10019506
444 Ga0157374_10062615
445 Ga0157374_10085771
446 Ga0157374_10223065
447 Ga0157374_10493008
448 Ga0157374_11766591
449 Ga0157378_10009660
450 Ga0157378_10077111
451 Ga0157378_10363691
452 Ga0163162_10563077
453 Ga0163162_12128461
454 Ga0157372_10255805
455 Ga0157372_10838393
456 Ga0157375_10544739
457 Ga0163163_10058262
458 Ga0182008_10402552
459 Ga0182008_10915062
460 Ga0157379_10395524
461 Ga0157379_12072894
462 Ga0157376_10041248
463 Ga0157376_10195587
464 Ga0182006_1111892
465 Ga0163161_10185273
466 Ga0213874_10347934
467 Ga0207666_1000088
468 Ga0207666_1008269
469 Ga0207673_1000599
470 Ga0207673_1024470
471 Ga0207697_10003475
472 Ga0207697_10011291
473 Ga0207697_10039306
474 Ga0207692_10071996
475 Ga0207692_10205954
476 Ga0207680_10022212
477 Ga0207685_10090830
478 Ga0207685_10119961
479 Ga0207699_10249263
480 Ga0207684_10015659
481 Ga0207684_10016698
482 Ga0207684_10035095
483 Ga0207684_10118895
484 Ga0207684_10235919
485 Ga0207684_10294280
486 Ga0207684_10407236
487 Ga0207707_10026054
488 Ga0207671_10722392
489 Ga0207693_10039924
490 Ga0207693_10155751
491 Ga0207693_10233006
492 Ga0207693_10686656
493 Ga0207693_10719231
494 Ga0207663_10040569
495 Ga0207663_10120862
496 Ga0207657_11352177
497 Ga0207649_10091069
498 Ga0207652_11034842
499 Ga0207646_10000683
500 Ga0207646_10003687
501 Ga0207646_10051432
502 Ga0207646_10106086
503 Ga0207646_10282369
504 Ga0207646_10387875
505 Ga0207646_10478785
506 Ga0207646_10847772
507 Ga0207646_10897324
508 Ga0207646_10945978
509 Ga0207659_11069197
510 Ga0207687_10306545
511 Ga0207700_10178961
512 Ga0207664_10306601
513 Ga0207664_10556259
514 Ga0207664_10559005
515 Ga0207644_10157348
516 Ga0207644_10459953
517 Ga0207706_10086780
518 Ga0207686_10151114
519 Ga0207670_10227613
520 Ga0207665_10012907
521 Ga0207665_10035111
522 Ga0207665_10036716
523 Ga0207665_10137883
524 Ga0207665_10214522
525 Ga0207711_11000568
526 Ga0207661_10017078
527 Ga0207679_10205220
528 Ga0207651_10024232
529 Ga0207668_10129135
530 Ga0207658_10059928
531 Ga0207678_10136838
532 Ga0207702_10385012
533 Ga0207641_10228391
534 Ga0207683_10009254
535 Ga0207698_10133079
536 Ga0207428_10111347
537 Ga0268266_10015223
538 Ga0268266_10024390
539 Ga0268266_10843820
540 Ga0373934_0509416
541 Ga0373954_0012598
542 Ga0373924_0169736
543 Ga0373935_0195507
544 Ga0373927_0621831
545 Ga0373933_0112146
546 Ga0373937_0151896
547 Ga0373925_0104286
548 Ga0373925_0616180
549 Ga0395899_0909831
550 Ga0395900_0704546
551 Ga0395898_0714070
552 Ga0395901_0755384
553 Ga0436363_0500727
554 Ga0436363_1398205
555 Ga0451853_0585545
556 Ga0439454_011713
557 Ga0495592_0002298
558 Ga0495641_0219493
559 Ga0495651_0672896
560 Ga0495653_0095534
561 Ga0495653_0394554
562 Ga0495639_0134091
563 Ga0495664_0282250
564 Ga0495618_0110224
565 Ga0495628_0042447
566 Ga0495630_0048087
567 Ga0495630_0575490
568 Ga0495652_0051360
569 Ga0495640_0099626
570 Ga0495586_0021954
571 Ga0495587_0116482
572 Ga0495645_0016308
573 Ga0495667_0097353
574 Ga0495659_0249951
575 Ga0495657_0272227
576 Ga0495657_0505778
577 Ga0495623_0211913
578 Ga0495647_0050752
579 Ga0495604_0147945
580 Ga0495674_0214021
581 Ga0495674_0312689
582 Ga0495676_0680888
583 Ga0495680_0208921
584 Ga0495680_0537537
585 Ga0495675_0078356
586 Ga0495684_0007546
587 Ga0495593_0243010
588 Ga0495602_0063089
589 Ga0496100_0702994
590 Ga0496104_0182007
591 Ga0496104_0925905
592 Ga0496106_1467886
593 Ga0496108_0051436
594 Ga0496108_0485654
595 Ga0496108_1231305
596 Ga0496109_0014550
597 Ga0496109_0069150
598 Ga0496109_0322395
599 Ga0496110_0354428
600 Ga0496112_0190598
601 Ga0496112_0396928
602 Ga0496112_0772900
603 Ga0496115_0018934
604 nmdc:mga08y16_191996_c1
605 nmdc:mga0n895_1249112_c1
606 nmdc:mga08x19_52124_c1
607 nmdc:mga0a205_1113783_c1
608 Ga0495601_0016991
609 Ga0495601_0337515
610 Ga0495612_0029398
611 Ga0495595_0139268
612 Ga0495619_0717582

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02036

SCP2

SCP-2 sterol transfer family

65

160

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4av7-assembly3.cif.gz_F structure determination of the double mutant s233y f250g from the sec- alkyl sulfatase pisa1 0.8915 31 133
4pdx-assembly1.cif.gz_B crystal structure of escherchia coli uncharacterized protein yjcs 0.8391 31 133
2cfz-assembly1.cif.gz_A-2 crystal structure of sdsa1, an alkylsulfatase from pseudomonas aeruginosa, in complex with 1-dodecanol 0.837 23 133
4pdx-assembly1.cif.gz_A crystal structure of escherchia coli uncharacterized protein yjcs 0.8368 31 133
4nur-assembly1.cif.gz_B crystal structure of thermostable alkylsulfatase sdsap from pseudomonas sp. s9 0.836 23 133
ID Description Score Start End Superfamily
af_Q6YN16_304_418_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.878 34 131 3.30.1050.10
af_Q54PA2_1_113_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.873 34 132 3.30.1050.10
af_F1Q9K0_294_407_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8676 31 132 3.30.1050.10
af_Q7KPQ9_334_441_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8555 34 132 3.30.1050.10
af_Q9VB10_297_412_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8372 35 131 3.30.1050.10
ID Description Score Start End GO Terms
AF-A0A2V5KKH1-F1-model_v4 Short-chain dehydrogenase 0.9976 32 134 GO:0016491
AF-A0A2V5KKH1-F1-model_v4 Short-chain dehydrogenase 0.988 32 134 GO:0016491
AF-A0A661RXL3-F1-model_v4 SCP2 domain-containing protein 0.9781 31 133 GO:0005829
AF-A0A354BIT2-F1-model_v4 SCP-2 family sterol carrier protein 0.975 44 134 GO:0005829
GO:0016491
AF-A0A7X9IWX0-F1-model_v4 SCP2 sterol-binding domain-containing protein 0.9729 30 133 GO:0005829

Map