F398818
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 306 | 153 | 299 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300046471|Ga0495650_0080220|Ga0495650_0080220_46_834 |
| Length | 251 |
| Sequence | LFLHRRGVLLKLQLFNLKGIARNYENRNFANFNFVTTMSKIQANTKVAAPETNLGHSGNFVRENQKSLLFIGGAIIALIAIYLLYLKLYLGPREITAADQMHVAQDFWAKKDWDKAIKGDASYPGFEKIINEYSNTRAANLAYFYLGTAYLNKGEYRKAIDNLNNYRGDDNMAAAEAFGGIKAATYFNKAIDKAKNKFLSPLYLKKLGLVYEEQKDNKNAGETYKRIKSEYPESAEAQNIDEYIARAEAKQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 3 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 4 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 5 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 6 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 7 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 8 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 9 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 15 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 66 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 98 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 99 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 101 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 102 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 103 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 104 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 105 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 106 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 107 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 108 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 109 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 110 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 111 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 112 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 113 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 114 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 115 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 116 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 117 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 147 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 148 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 149 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 150 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 151 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 152 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 153 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.71 |
| Metatranscriptomes | 0 |
| Isolates | 2.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.52 |
| Nodule | 0 |
| Rhizoplane | 0.65 |
| Rhizosphere | 85.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001405 | 3300001904 | Bacteria | 4406 |
| 2 | JGI24736J21556_1002231 | 3300001904 | Bacteria | 3430 |
| 3 | JGI24741J21665_1029998 | 3300001915 | Bacteria | 816 |
| 4 | JGI24740J21852_10007444 | 3300001979 | Bacteria | 4452 |
| 5 | JGI24740J21852_10027636 | 3300001979 | Bacteria | 1885 |
| 6 | JGI24740J21852_10075028 | 3300001979 | Bacteria | 897 |
| 7 | JGI24737J22298_10000077 | 3300001990 | Bacteria | 28981 |
| 8 | JGI24737J22298_10003409 | 3300001990 | Bacteria | 5619 |
| 9 | JGI24737J22298_10006057 | 3300001990 | Bacteria | 4147 |
| 10 | JGI24735J21928_10000005 | 3300002067 | Bacteria | 356755 |
| 11 | JGI24735J21928_10054258 | 3300002067 | Bacteria | 1155 |
| 12 | JGI24744J21845_10000710 | 3300002077 | Bacteria | 6141 |
| 13 | JGI24744J21845_10024470 | 3300002077 | Bacteria | 1180 |
| 14 | JGI25162J39368_1000563 | 3300002737 | Bacteria | 27213 |
| 15 | JGI25162J39368_1000596 | 3300002737 | Bacteria | 26217 |
| 16 | JGI25157J39369_1011860 | 3300002741 | Bacteria | 1119 |
| 17 | JGI25165J46597_1000658 | 3300003214 | Bacteria | 28305 |
| 18 | rootH1_10026072 | 3300003316 | Bacteria | 16591 |
| 19 | rootH1_10155653 | 3300003316 | Bacteria | 2760 |
| 20 | rootH2_10024240 | 3300003320 | Bacteria | 36961 |
| 21 | rootH2_10085495 | 3300003320 | Bacteria | 1209 |
| 22 | rootH1_10005386 | 3300003323 | Bacteria | 37172 |
| 23 | rootH1_10006071 | 3300003323 | Bacteria | 12892 |
| 24 | Ga0065714_10010854 | 3300005288 | Bacteria | 2496 |
| 25 | Ga0065714_10091954 | 3300005288 | Bacteria | 1893 |
| 26 | Ga0065714_10121770 | 3300005288 | Bacteria | 1339 |
| 27 | Ga0070658_10000236 | 3300005327 | Bacteria | 48963 |
| 28 | Ga0070658_10193326 | 3300005327 | Bacteria | 1715 |
| 29 | Ga0070676_10000133 | 3300005328 | Bacteria | 28281 |
| 30 | Ga0070683_100012137 | 3300005329 | Bacteria | 7477 |
| 31 | Ga0070680_100001753 | 3300005336 | Bacteria | 15938 |
| 32 | Ga0070660_100112133 | 3300005339 | Bacteria | 2171 |
| 33 | Ga0070660_100365108 | 3300005339 | Bacteria | 1190 |
| 34 | Ga0070660_100545369 | 3300005339 | Bacteria | 967 |
| 35 | Ga0070674_100057080 | 3300005356 | Bacteria | 2709 |
| 36 | Ga0070673_100024633 | 3300005364 | Bacteria | 4416 |
| 37 | Ga0070659_100000094 | 3300005366 | Bacteria | 66823 |
| 38 | Ga0070659_100467846 | 3300005366 | Bacteria | 1071 |
| 39 | Ga0070663_100010790 | 3300005455 | Bacteria | 5704 |
| 40 | Ga0070678_100020119 | 3300005456 | Bacteria | 4372 |
| 41 | Ga0070662_100000003 | 3300005457 | Bacteria | 239813 |
| 42 | Ga0070681_10323809 | 3300005458 | Bacteria | 1451 |
| 43 | Ga0068867_100000624 | 3300005459 | Bacteria | 23370 |
| 44 | Ga0070679_100022268 | 3300005530 | Bacteria | 6192 |
| 45 | Ga0070679_100072018 | 3300005530 | Bacteria | 3448 |
| 46 | Ga0068853_100010556 | 3300005539 | Bacteria | 7468 |
| 47 | Ga0068853_100078882 | 3300005539 | Bacteria | 2878 |
| 48 | Ga0068853_100154590 | 3300005539 | Bacteria | 2066 |
| 49 | Ga0068853_100640486 | 3300005539 | Bacteria | 1011 |
| 50 | Ga0070665_100000212 | 3300005548 | Bacteria | 100019 |
| 51 | Ga0070665_100687427 | 3300005548 | Bacteria | 1036 |
| 52 | Ga0068855_100000127 | 3300005563 | Bacteria | 96826 |
| 53 | Ga0068855_100000201 | 3300005563 | Bacteria | 76965 |
| 54 | Ga0068855_100065287 | 3300005563 | Bacteria | 4243 |
| 55 | Ga0068855_100068031 | 3300005563 | Bacteria | 4148 |
| 56 | Ga0068855_100188330 | 3300005563 | Bacteria | 2329 |
| 57 | Ga0068855_100276231 | 3300005563 | Bacteria | 1867 |
| 58 | Ga0068855_100849101 | 3300005563 | Bacteria | 968 |
| 59 | Ga0068855_101011822 | 3300005563 | Bacteria | 873 |
| 60 | Ga0068856_100000036 | 3300005614 | Bacteria | 121468 |
| 61 | Ga0068856_100005050 | 3300005614 | Bacteria | 13063 |
| 62 | Ga0068856_100025384 | 3300005614 | Bacteria | 5779 |
| 63 | Ga0068856_100079116 | 3300005614 | Bacteria | 3260 |
| 64 | Ga0068856_100560146 | 3300005614 | Bacteria | 1164 |
| 65 | Ga0068852_100004529 | 3300005616 | Bacteria | 9834 |
| 66 | Ga0068852_100097077 | 3300005616 | Bacteria | 2650 |
| 67 | Ga0068852_100348586 | 3300005616 | Bacteria | 1445 |
| 68 | Ga0068852_100801263 | 3300005616 | Bacteria | 956 |
| 69 | Ga0068859_101019803 | 3300005617 | Bacteria | 909 |
| 70 | Ga0068866_10028077 | 3300005718 | Bacteria | 2678 |
| 71 | Ga0068870_10009317 | 3300005840 | Bacteria | 4460 |
| 72 | Ga0075366_10001995 | 3300006195 | Bacteria | 10341 |
| 73 | Ga0075366_10005756 | 3300006195 | Bacteria | 6731 |
| 74 | Ga0075366_10006727 | 3300006195 | Bacteria | 6313 |
| 75 | Ga0097621_100000205 | 3300006237 | Bacteria | 38617 |
| 76 | Ga0068871_100000162 | 3300006358 | Bacteria | 44419 |
| 77 | Ga0068865_100000075 | 3300006881 | Bacteria | 51751 |
| 78 | Ga0097620_101020174 | 3300006931 | Bacteria | 909 |
| 79 | Ga0105240_10030257 | 3300009093 | Bacteria | 7038 |
| 80 | Ga0105240_10044696 | 3300009093 | Bacteria | 5625 |
| 81 | Ga0105240_10046155 | 3300009093 | Bacteria | 5522 |
| 82 | Ga0105240_10067821 | 3300009093 | Bacteria | 4421 |
| 83 | Ga0105240_10075450 | 3300009093 | Bacteria | 4159 |
| 84 | Ga0105240_10109684 | 3300009093 | Bacteria | 3342 |
| 85 | Ga0105240_10604534 | 3300009093 | Bacteria | 1207 |
| 86 | Ga0105245_10146520 | 3300009098 | Bacteria | 2228 |
| 87 | Ga0105245_11110851 | 3300009098 | Bacteria | 837 |
| 88 | Ga0105243_10188655 | 3300009148 | Bacteria | 1799 |
| 89 | Ga0105241_10002920 | 3300009174 | Bacteria | 12766 |
| 90 | Ga0105241_10106365 | 3300009174 | Bacteria | 2239 |
| 91 | Ga0105241_10325254 | 3300009174 | Bacteria | 1327 |
| 92 | Ga0105241_10400526 | 3300009174 | Bacteria | 1204 |
| 93 | Ga0105241_10455376 | 3300009174 | Bacteria | 1132 |
| 94 | Ga0105242_10022443 | 3300009176 | Bacteria | 4964 |
| 95 | Ga0105242_11049180 | 3300009176 | Bacteria | 826 |
| 96 | Ga0105237_10000620 | 3300009545 | Bacteria | 49579 |
| 97 | Ga0105237_10000808 | 3300009545 | Bacteria | 42764 |
| 98 | Ga0105237_10001785 | 3300009545 | Bacteria | 27820 |
| 99 | Ga0105237_10134851 | 3300009545 | Bacteria | 2463 |
| 100 | Ga0105237_10145580 | 3300009545 | Bacteria | 2364 |
| 101 | Ga0105237_10328445 | 3300009545 | Bacteria | 1533 |
| 102 | Ga0105239_10000008 | 3300010375 | Bacteria | 376925 |
| 103 | Ga0105239_10000045 | 3300010375 | Bacteria | 186314 |
| 104 | Ga0105239_10000446 | 3300010375 | Bacteria | 60289 |
| 105 | Ga0105239_10007945 | 3300010375 | Bacteria | 12126 |
| 106 | Ga0105239_10010933 | 3300010375 | Bacteria | 10139 |
| 107 | Ga0105239_10018812 | 3300010375 | Bacteria | 7631 |
| 108 | Ga0105239_10109872 | 3300010375 | Bacteria | 3056 |
| 109 | Ga0157373_10000091 | 3300013100 | Bacteria | 75012 |
| 110 | Ga0157373_10003653 | 3300013100 | Bacteria | 11625 |
| 111 | Ga0157373_10046956 | 3300013100 | Bacteria | 3081 |
| 112 | Ga0157371_10000155 | 3300013102 | Bacteria | 100230 |
| 113 | Ga0157371_10002671 | 3300013102 | Bacteria | 16870 |
| 114 | Ga0157371_10012104 | 3300013102 | Bacteria | 6609 |
| 115 | Ga0157371_10037490 | 3300013102 | Bacteria | 3469 |
| 116 | Ga0157370_10016345 | 3300013104 | Bacteria | 7516 |
| 117 | Ga0157370_10143941 | 3300013104 | Bacteria | 2220 |
| 118 | Ga0157370_10169028 | 3300013104 | Bacteria | 2033 |
| 119 | Ga0157370_10205525 | 3300013104 | Bacteria | 1826 |
| 120 | Ga0157370_10776520 | 3300013104 | Bacteria | 872 |
| 121 | Ga0157369_10001051 | 3300013105 | Bacteria | 34842 |
| 122 | Ga0157369_10092987 | 3300013105 | Bacteria | 3219 |
| 123 | Ga0157369_10561862 | 3300013105 | Bacteria | 1179 |
| 124 | Ga0157374_10001433 | 3300013296 | Bacteria | 20152 |
| 125 | Ga0157374_10012425 | 3300013296 | Bacteria | 7407 |
| 126 | Ga0157374_10186435 | 3300013296 | Bacteria | 2028 |
| 127 | Ga0157378_10018561 | 3300013297 | Bacteria | 6113 |
| 128 | Ga0157378_10023282 | 3300013297 | Bacteria | 5451 |
| 129 | Ga0157378_10129359 | 3300013297 | Bacteria | 2336 |
| 130 | Ga0163162_10000041 | 3300013306 | Bacteria | 132375 |
| 131 | Ga0163162_10005549 | 3300013306 | Bacteria | 12198 |
| 132 | Ga0163162_10139617 | 3300013306 | Bacteria | 2535 |
| 133 | Ga0157372_10000009 | 3300013307 | Bacteria | 302051 |
| 134 | Ga0157372_10002228 | 3300013307 | Bacteria | 21035 |
| 135 | Ga0157372_10004603 | 3300013307 | Bacteria | 14664 |
| 136 | Ga0157372_10007451 | 3300013307 | Bacteria | 11640 |
| 137 | Ga0157372_10084880 | 3300013307 | Bacteria | 3591 |
| 138 | Ga0157372_10104869 | 3300013307 | Bacteria | 3233 |
| 139 | Ga0163163_10846310 | 3300014325 | Bacteria | 978 |
| 140 | Ga0157376_10006003 | 3300014969 | Bacteria | 8535 |
| 141 | Ga0213872_10059866 | 3300021361 | Bacteria | 1723 |
| 142 | Ga0207427_100109 | 3300025231 | Bacteria | 116061 |
| 143 | Ga0209437_100096 | 3300025233 | Bacteria | 233558 |
| 144 | Ga0209437_100507 | 3300025233 | Bacteria | 27709 |
| 145 | Ga0209026_1000225 | 3300025250 | Bacteria | 77234 |
| 146 | Ga0209026_1002625 | 3300025250 | Bacteria | 6562 |
| 147 | Ga0209233_1000029 | 3300025261 | Bacteria | 641642 |
| 148 | Ga0209233_1000701 | 3300025261 | Bacteria | 15748 |
| 149 | Ga0209455_1010103 | 3300025272 | Bacteria | 2425 |
| 150 | Ga0207647_10000135 | 3300025904 | Bacteria | 58247 |
| 151 | Ga0207647_10000698 | 3300025904 | Bacteria | 26307 |
| 152 | Ga0207647_10021205 | 3300025904 | Bacteria | 4340 |
| 153 | Ga0207647_10079357 | 3300025904 | Bacteria | 1971 |
| 154 | Ga0207645_10000014 | 3300025907 | Bacteria | 117512 |
| 155 | Ga0207705_10000111 | 3300025909 | Bacteria | 92842 |
| 156 | Ga0207705_10294000 | 3300025909 | Bacteria | 1245 |
| 157 | Ga0207654_10004371 | 3300025911 | Bacteria | 7123 |
| 158 | Ga0207654_10043401 | 3300025911 | Bacteria | 2549 |
| 159 | Ga0207654_10047718 | 3300025911 | Bacteria | 2448 |
| 160 | Ga0207654_10120813 | 3300025911 | Bacteria | 1645 |
| 161 | Ga0207707_10031546 | 3300025912 | Bacteria | 4637 |
| 162 | Ga0207695_10038681 | 3300025913 | Bacteria | 5133 |
| 163 | Ga0207695_10063126 | 3300025913 | Bacteria | 3820 |
| 164 | Ga0207695_10071078 | 3300025913 | Bacteria | 3555 |
| 165 | Ga0207695_10267758 | 3300025913 | Bacteria | 1605 |
| 166 | Ga0207695_10279728 | 3300025913 | Bacteria | 1562 |
| 167 | Ga0207695_10802422 | 3300025913 | Bacteria | 821 |
| 168 | Ga0207671_10000899 | 3300025914 | Bacteria | 37624 |
| 169 | Ga0207671_10001286 | 3300025914 | Bacteria | 29511 |
| 170 | Ga0207671_10003474 | 3300025914 | Bacteria | 15671 |
| 171 | Ga0207671_10435518 | 3300025914 | Bacteria | 1043 |
| 172 | Ga0207671_10441330 | 3300025914 | Bacteria | 1036 |
| 173 | Ga0207671_10738135 | 3300025914 | Bacteria | 782 |
| 174 | Ga0207660_10280791 | 3300025917 | Bacteria | 1321 |
| 175 | Ga0207657_10120521 | 3300025919 | Bacteria | 2158 |
| 176 | Ga0207657_10327368 | 3300025919 | Bacteria | 1211 |
| 177 | Ga0207657_10623106 | 3300025919 | Bacteria | 841 |
| 178 | Ga0207652_10256665 | 3300025921 | Bacteria | 1577 |
| 179 | Ga0207690_10003190 | 3300025932 | Bacteria | 9841 |
| 180 | Ga0207690_10422177 | 3300025932 | Bacteria | 1067 |
| 181 | Ga0207706_10000009 | 3300025933 | Bacteria | 200607 |
| 182 | Ga0207706_10859602 | 3300025933 | Bacteria | 768 |
| 183 | Ga0207686_10031730 | 3300025934 | Bacteria | 3139 |
| 184 | Ga0207709_10141689 | 3300025935 | Bacteria | 1653 |
| 185 | Ga0207704_10000118 | 3300025938 | Bacteria | 43936 |
| 186 | Ga0207661_10112020 | 3300025944 | Bacteria | 2309 |
| 187 | Ga0207667_10000236 | 3300025949 | Bacteria | 77019 |
| 188 | Ga0207667_10007060 | 3300025949 | Bacteria | 13571 |
| 189 | Ga0207667_10155865 | 3300025949 | Bacteria | 2350 |
| 190 | Ga0207667_10200238 | 3300025949 | Bacteria | 2049 |
| 191 | Ga0207667_10908167 | 3300025949 | Bacteria | 872 |
| 192 | Ga0207651_10010534 | 3300025960 | Bacteria | 5129 |
| 193 | Ga0207639_10001022 | 3300026041 | Bacteria | 19034 |
| 194 | Ga0207639_10040162 | 3300026041 | Bacteria | 3491 |
| 195 | Ga0207639_10107339 | 3300026041 | Bacteria | 2268 |
| 196 | Ga0207639_10490480 | 3300026041 | Bacteria | 1121 |
| 197 | Ga0207678_10168861 | 3300026067 | Unclassified | 1868 |
| 198 | Ga0207702_10000088 | 3300026078 | Bacteria | 105505 |
| 199 | Ga0207702_10027913 | 3300026078 | Bacteria | 4690 |
| 200 | Ga0207702_10052838 | 3300026078 | Bacteria | 3439 |
| 201 | Ga0207702_10083373 | 3300026078 | Bacteria | 2781 |
| 202 | Ga0207702_10424268 | 3300026078 | Bacteria | 1287 |
| 203 | Ga0207702_10805457 | 3300026078 | Unclassified | 929 |
| 204 | Ga0207648_10000963 | 3300026089 | Bacteria | 32564 |
| 205 | Ga0207674_10045110 | 3300026116 | Bacteria | 4537 |
| 206 | Ga0207683_10002362 | 3300026121 | Bacteria | 16484 |
| 207 | Ga0207698_10000733 | 3300026142 | Bacteria | 19000 |
| 208 | Ga0207698_10317769 | 3300026142 | Bacteria | 1457 |
| 209 | Ga0207698_10337630 | 3300026142 | Bacteria | 1418 |
| 210 | Ga0207698_10927771 | 3300026142 | Bacteria | 879 |
| 211 | Ga0268266_10000177 | 3300028379 | Bacteria | 114318 |
| 212 | Ga0268266_10592910 | 3300028379 | Bacteria | 1064 |
| 213 | Ga0307517_10000553 | 3300028786 | Bacteria | 63892 |
| 214 | Ga0307515_10000643 | 3300028794 | Bacteria | 80674 |
| 215 | Ga0307515_10024651 | 3300028794 | Bacteria | 10465 |
| 216 | Ga0265338_10057975 | 3300028800 | Bacteria | 3422 |
| 217 | Ga0307509_10030534 | 3300031507 | Bacteria | 5959 |
| 218 | Ga0307412_10194773 | 3300031911 | Bacteria | 1535 |
| 219 | Ga0307507_10014221 | 3300033179 | Bacteria | 9519 |
| 220 | Ga0307510_10000172 | 3300033180 | Bacteria | 54812 |
| 221 | Ga0395899_0000327 | 3300037312 | Bacteria | 60343 |
| 222 | Ga0395899_0018626 | 3300037312 | Bacteria | 5276 |
| 223 | Ga0395899_0019965 | 3300037312 | Bacteria | 5083 |
| 224 | Ga0395900_0000197 | 3300037418 | Bacteria | 95775 |
| 225 | Ga0395900_0000609 | 3300037418 | Bacteria | 48753 |
| 226 | Ga0395900_0094978 | 3300037418 | Bacteria | 3063 |
| 227 | Ga0395900_0231547 | 3300037418 | Bacteria | 1858 |
| 228 | Ga0395898_0466440 | 3300037466 | Bacteria | 1202 |
| 229 | Ga0395905_0000186 | 3300037471 | Bacteria | 99159 |
| 230 | Ga0395905_0003273 | 3300037471 | Bacteria | 17408 |
| 231 | Ga0395901_0000368 | 3300038443 | Bacteria | 54066 |
| 232 | Ga0395901_0008274 | 3300038443 | Bacteria | 10508 |
| 233 | Ga0395901_0314993 | 3300038443 | Bacteria | 1620 |
| 234 | Ga0395901_0428041 | 3300038443 | Bacteria | 1356 |
| 235 | Ga0436361_0709938 | 3300039447 | Bacteria | 3399 |
| 236 | Ga0451807_0115040 | 3300041486 | Bacteria | 1247 |
| 237 | Ga0439455_0011503 | 3300042012 | Bacteria | 1968 |
| 238 | Ga0466969_0070955 | 3300044656 | Unclassified | 1675 |
| 239 | Ga0466966_0048533 | 3300044684 | Bacteria | 2704 |
| 240 | Ga0466961_0069557 | 3300044693 | Bacteria | 2235 |
| 241 | Ga0466959_0050418 | 3300045049 | Bacteria | 3056 |
| 242 | Ga0466959_0137652 | 3300045049 | Bacteria | 1727 |
| 243 | Ga0466958_0014504 | 3300045836 | Bacteria | 4499 |
| 244 | Ga0495650_0000225 | 3300046471 | Bacteria | 117898 |
| 245 | Ga0495650_0080220 | 3300046471 | Bacteria | 1260 |
| 246 | Ga0495585_0000074 | 3300046492 | Bacteria | 102651 |
| 247 | Ga0495585_0000323 | 3300046492 | Bacteria | 47094 |
| 248 | Ga0495583_0035693 | 3300046506 | Bacteria | 2371 |
| 249 | Ga0495606_0000074 | 3300046507 | Bacteria | 170848 |
| 250 | Ga0495606_0010496 | 3300046507 | Bacteria | 7675 |
| 251 | Ga0495606_0013471 | 3300046507 | Bacteria | 6454 |
| 252 | Ga0495606_0051265 | 3300046507 | Bacteria | 2693 |
| 253 | Ga0495606_0320304 | 3300046507 | Bacteria | 833 |
| 254 | Ga0495610_0001170 | 3300046512 | Bacteria | 23824 |
| 255 | Ga0495616_0002088 | 3300046513 | Bacteria | 13429 |
| 256 | Ga0495628_0591863 | 3300046516 | Bacteria | 793 |
| 257 | Ga0495631_0003005 | 3300046518 | Bacteria | 9331 |
| 258 | Ga0495644_0000790 | 3300046523 | Bacteria | 13026 |
| 259 | Ga0495648_0006718 | 3300046524 | Bacteria | 9305 |
| 260 | Ga0495652_0263723 | 3300046529 | Bacteria | 1270 |
| 261 | Ga0495654_0024729 | 3300046530 | Bacteria | 3100 |
| 262 | Ga0495609_0008096 | 3300046538 | Bacteria | 5178 |
| 263 | Ga0495633_0000006 | 3300046558 | Bacteria | 326774 |
| 264 | Ga0495633_0005434 | 3300046558 | Bacteria | 7785 |
| 265 | Ga0495633_0191023 | 3300046558 | Bacteria | 941 |
| 266 | Ga0495668_0000011 | 3300046616 | Bacteria | 472186 |
| 267 | Ga0495668_0249491 | 3300046616 | Bacteria | 972 |
| 268 | Ga0495625_0000067 | 3300046660 | Bacteria | 171483 |
| 269 | Ga0495625_0000462 | 3300046660 | Bacteria | 60985 |
| 270 | Ga0495625_0000486 | 3300046660 | Bacteria | 59478 |
| 271 | Ga0495661_0031292 | 3300046665 | Bacteria | 3379 |
| 272 | Ga0495658_0360545 | 3300046683 | Bacteria | 924 |
| 273 | Ga0495670_0099117 | 3300046691 | Bacteria | 1499 |
| 274 | Ga0495671_0066962 | 3300046692 | Bacteria | 1767 |
| 275 | Ga0495649_0000054 | 3300046694 | Bacteria | 107048 |
| 276 | Ga0495649_0058062 | 3300046694 | Bacteria | 2086 |
| 277 | Ga0495589_0085339 | 3300046794 | Bacteria | 1534 |
| 278 | Ga0495660_0002682 | 3300046810 | Bacteria | 11256 |
| 279 | Ga0495683_0018852 | 3300047323 | Bacteria | 3563 |
| 280 | Ga0495687_001083 | 3300047443 | Bacteria | 26756 |
| 281 | Ga0495687_002879 | 3300047443 | Bacteria | 13149 |
| 282 | Ga0495687_036103 | 3300047443 | Bacteria | 2215 |
| 283 | Ga0495677_0076055 | 3300047445 | Bacteria | 1255 |
| 284 | Ga0495686_0001571 | 3300047472 | Bacteria | 24245 |
| 285 | Ga0495686_0004631 | 3300047472 | Bacteria | 11183 |
| 286 | Ga0495686_0035242 | 3300047472 | Bacteria | 3218 |
| 287 | Ga0495614_0022639 | 3300048089 | Bacteria | 2711 |
| 288 | Ga0495682_0023894 | 3300049460 | Bacteria | 2281 |
| 289 | nmdc:mga0k408_22_c2 | 3300050493 | Bacteria | 93033 |
| 290 | nmdc:mga0k408_626_c1 | 3300050493 | Bacteria | 19472 |
| 291 | Ga0500635_0000482 | 3300053080 | Bacteria | 11190 |
| 292 | Ga0500608_006782 | 3300053122 | Bacteria | 4693 |
| 293 | Ga0500608_042233 | 3300053122 | Bacteria | 2188 |
| 294 | Ga0500614_007798 | 3300053123 | Bacteria | 2262 |
| 295 | Ga0500618_000148 | 3300053125 | Bacteria | 58264 |
| 296 | Ga0500618_032934 | 3300053125 | Bacteria | 1210 |
| 297 | Ga0500642_0026699 | 3300053130 | Bacteria | 2360 |
| 298 | Ga0500624_002450 | 3300053157 | Bacteria | 2514 |
| 299 | Ga0500634_0066997 | 3300053161 | Bacteria | 1890 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046507 | Ga0495606_0013471 | Ga0495606_0013471_332_997 | 201 |
| 2 | 3300046810 | Ga0495660_0002682 | Ga0495660_0002682_6919_7584 | 201 |
| 3 | 3300047472 | Ga0495686_0001571 | Ga0495686_0001571_3157_3912 | 203 |
| 4 | 3300005718 | Ga0068866_10028077 | Ga0068866_100280774 | 205 |
| 5 | 3300021361 | Ga0213872_10059866 | Ga0213872_100598662 | 205 |
| 6 | 3300028786 | Ga0307517_10000553 | Ga0307517_1000055315 | 205 |
| 7 | 3300033180 | Ga0307510_10000172 | Ga0307510_1000017212 | 205 |
| 8 | 3300039447 | Ga0436361_0709938 | Ga0436361_0709938_1269_1949 | 205 |
| 9 | 3300046507 | Ga0495606_0320304 | Ga0495606_0320304_74_754 | 205 |
| 10 | 3300046518 | Ga0495631_0003005 | Ga0495631_0003005_7400_8080 | 205 |
| 11 | 3300046694 | Ga0495649_0058062 | Ga0495649_0058062_521_1201 | 205 |
| 12 | 3300047323 | Ga0495683_0018852 | Ga0495683_0018852_1438_2118 | 205 |
| 13 | 3300053122 | Ga0500608_006782 | Ga0500608_006782_3093_3773 | 205 |
| 14 | 3300002077 | JGI24744J21845_10000710 | JGI24744J21845_100007102 | 206 |
| 15 | 3300005328 | Ga0070676_10000133 | Ga0070676_1000013325 | 206 |
| 16 | 3300005364 | Ga0070673_100024633 | Ga0070673_1000246335 | 206 |
| 17 | 3300005456 | Ga0070678_100020119 | Ga0070678_1000201193 | 206 |
| 18 | 3300005459 | Ga0068867_100000624 | Ga0068867_1000006242 | 206 |
| 19 | 3300005539 | Ga0068853_100010556 | Ga0068853_1000105567 | 206 |
| 20 | 3300005616 | Ga0068852_100004529 | Ga0068852_1000045296 | 206 |
| 21 | 3300005617 | Ga0068859_101019803 | Ga0068859_1010198031 | 206 |
| 22 | 3300006237 | Ga0097621_100000205 | Ga0097621_1000002055 | 206 |
| 23 | 3300006358 | Ga0068871_100000162 | Ga0068871_10000016225 | 206 |
| 24 | 3300006881 | Ga0068865_100000075 | Ga0068865_10000007518 | 206 |
| 25 | 3300006931 | Ga0097620_101020174 | Ga0097620_1010201741 | 206 |
| 26 | 3300009098 | Ga0105245_10146520 | Ga0105245_101465201 | 206 |
| 27 | 3300009098 | Ga0105245_11110851 | Ga0105245_111108511 | 206 |
| 28 | 3300009176 | Ga0105242_10022443 | Ga0105242_100224436 | 206 |
| 29 | 3300009545 | Ga0105237_10000808 | Ga0105237_1000080811 | 206 |
| 30 | 3300010375 | Ga0105239_10010933 | Ga0105239_100109335 | 206 |
| 31 | 3300010375 | Ga0105239_10109872 | Ga0105239_101098725 | 206 |
| 32 | 3300013296 | Ga0157374_10001433 | Ga0157374_100014336 | 206 |
| 33 | 3300013297 | Ga0157378_10023282 | Ga0157378_100232825 | 206 |
| 34 | 3300013307 | Ga0157372_10104869 | Ga0157372_101048692 | 206 |
| 35 | 3300025907 | Ga0207645_10000014 | Ga0207645_1000001456 | 206 |
| 36 | 3300025911 | Ga0207654_10047718 | Ga0207654_100477181 | 206 |
| 37 | 3300025914 | Ga0207671_10001286 | Ga0207671_100012867 | 206 |
| 38 | 3300025933 | Ga0207706_10859602 | Ga0207706_108596021 | 206 |
| 39 | 3300025934 | Ga0207686_10031730 | Ga0207686_100317303 | 206 |
| 40 | 3300025938 | Ga0207704_10000118 | Ga0207704_100001188 | 206 |
| 41 | 3300025960 | Ga0207651_10010534 | Ga0207651_100105344 | 206 |
| 42 | 3300026041 | Ga0207639_10001022 | Ga0207639_100010228 | 206 |
| 43 | 3300026089 | Ga0207648_10000963 | Ga0207648_1000096325 | 206 |
| 44 | 3300026121 | Ga0207683_10002362 | Ga0207683_100023623 | 206 |
| 45 | 3300026142 | Ga0207698_10000733 | Ga0207698_1000073312 | 206 |
| 46 | 3300046471 | Ga0495650_0000225 | Ga0495650_0000225_17441_18118 | 206 |
| 47 | 3300046506 | Ga0495583_0035693 | Ga0495583_0035693_50_727 | 206 |
| 48 | 3300046513 | Ga0495616_0002088 | Ga0495616_0002088_11259_11936 | 206 |
| 49 | 3300046660 | Ga0495625_0000067 | Ga0495625_0000067_78647_79324 | 206 |
| 50 | 3300046694 | Ga0495649_0000054 | Ga0495649_0000054_78658_79335 | 206 |
| 51 | 3300047443 | Ga0495687_002879 | Ga0495687_002879_8501_9181 | 206 |
| 52 | 3300009148 | Ga0105243_10188655 | Ga0105243_101886552 | 207 |
| 53 | 3300013306 | Ga0163162_10139617 | Ga0163162_101396172 | 207 |
| 54 | 3300025935 | Ga0207709_10141689 | Ga0207709_101416892 | 207 |
| 55 | 3300046492 | Ga0495585_0000074 | Ga0495585_0000074_36143_36820 | 207 |
| 56 | 3300046512 | Ga0495610_0001170 | Ga0495610_0001170_731_1408 | 207 |
| 57 | 3300046558 | Ga0495633_0005434 | Ga0495633_0005434_5103_5780 | 207 |
| 58 | 3300046665 | Ga0495661_0031292 | Ga0495661_0031292_196_873 | 207 |
| 59 | 3300046692 | Ga0495671_0066962 | Ga0495671_0066962_209_886 | 207 |
| 60 | 3300046794 | Ga0495589_0085339 | Ga0495589_0085339_90_767 | 207 |
| 61 | 3300047443 | Ga0495687_001083 | Ga0495687_001083_15679_16356 | 207 |
| 62 | 3300014969 | Ga0157376_10006003 | Ga0157376_100060032 | 208 |
| 63 | 3300026041 | Ga0207639_10107339 | Ga0207639_101073392 | 209 |
| 64 | 3300003320 | rootH2_10024240 | rootH2_1002424015 | 211 |
| 65 | 3300005288 | Ga0065714_10121770 | Ga0065714_101217702 | 211 |
| 66 | 3300053125 | Ga0500618_032934 | Ga0500618_032934_34_711 | 211 |
| 67 | 3300046471 | Ga0495650_0080220 | Ga0495650_0080220_46_834 | 214 |
| 68 | 3300009174 | Ga0105241_10106365 | Ga0105241_101063654 | 220 |
| 69 | 3300009174 | Ga0105241_10325254 | Ga0105241_103252542 | 220 |
| 70 | 3300053130 | Ga0500642_0026699 | Ga0500642_0026699_14_676 | 220 |
| 71 | iso_pu_bacteria | 2852623160 | 2852625718 | 220 |
| 72 | iso_pu_bacteria | 2884933994 | 2884935757 | 220 |
| 73 | iso_pu_bacteria | 2599185184 | 2599479986 | 221 |
| 74 | iso_pu_bacteria | 2928078545 | 2928081116 | 221 |
| 75 | iso_pu_bacteria | 2928147474 | 2928152463 | 221 |
| 76 | iso_pu_bacteria | 2932082852 | 2932087766 | 221 |
| 77 | iso_pu_bacteria | 2977232053 | 2977235572 | 221 |
| 78 | 3300026142 | Ga0207698_10927771 | Ga0207698_109277711 | 223 |
| 79 | 3300006195 | Ga0075366_10001995 | Ga0075366_100019956 | 224 |
| 80 | 3300025250 | Ga0209026_1002625 | Ga0209026_10026255 | 224 |
| 81 | 3300037418 | Ga0395900_0000609 | Ga0395900_0000609_23717_24391 | 224 |
| 82 | 3300045049 | Ga0466959_0137652 | Ga0466959_0137652_837_1511 | 224 |
| 83 | 3300050493 | nmdc:mga0k408_626_c1 | nmdc:mga0k408_626_c1_13208_13882 | 224 |
| 84 | 3300001904 | JGI24736J21556_1001405 | JGI24736J21556_10014056 | 225 |
| 85 | 3300001904 | JGI24736J21556_1002231 | JGI24736J21556_10022312 | 225 |
| 86 | 3300001915 | JGI24741J21665_1029998 | JGI24741J21665_10299981 | 225 |
| 87 | 3300001979 | JGI24740J21852_10007444 | JGI24740J21852_100074442 | 225 |
| 88 | 3300001979 | JGI24740J21852_10027636 | JGI24740J21852_100276362 | 225 |
| 89 | 3300001979 | JGI24740J21852_10075028 | JGI24740J21852_100750281 | 225 |
| 90 | 3300001990 | JGI24737J22298_10000077 | JGI24737J22298_100000779 | 225 |
| 91 | 3300001990 | JGI24737J22298_10003409 | JGI24737J22298_100034095 | 225 |
| 92 | 3300001990 | JGI24737J22298_10006057 | JGI24737J22298_100060575 | 225 |
| 93 | 3300002067 | JGI24735J21928_10000005 | JGI24735J21928_10000005120 | 225 |
| 94 | 3300002067 | JGI24735J21928_10054258 | JGI24735J21928_100542581 | 225 |
| 95 | 3300002077 | JGI24744J21845_10024470 | JGI24744J21845_100244702 | 225 |
| 96 | 3300002737 | JGI25162J39368_1000563 | JGI25162J39368_100056311 | 225 |
| 97 | 3300002737 | JGI25162J39368_1000596 | JGI25162J39368_100059613 | 225 |
| 98 | 3300002741 | JGI25157J39369_1011860 | JGI25157J39369_10118602 | 225 |
| 99 | 3300003214 | JGI25165J46597_1000658 | JGI25165J46597_10006585 | 225 |
| 100 | 3300003316 | rootH1_10026072 | rootH1_100260721 | 225 |
| 101 | 3300003316 | rootH1_10155653 | rootH1_101556531 | 225 |
| 102 | 3300003320 | rootH2_10085495 | rootH2_100854951 | 225 |
| 103 | 3300003323 | rootH1_10005386 | rootH1_1000538614 | 225 |
| 104 | 3300003323 | rootH1_10006071 | rootH1_100060714 | 225 |
| 105 | 3300005288 | Ga0065714_10010854 | Ga0065714_100108543 | 225 |
| 106 | 3300005288 | Ga0065714_10091954 | Ga0065714_100919542 | 225 |
| 107 | 3300005327 | Ga0070658_10000236 | Ga0070658_1000023625 | 225 |
| 108 | 3300005327 | Ga0070658_10193326 | Ga0070658_101933261 | 225 |
| 109 | 3300005329 | Ga0070683_100012137 | Ga0070683_1000121379 | 225 |
| 110 | 3300005336 | Ga0070680_100001753 | Ga0070680_1000017532 | 225 |
| 111 | 3300005339 | Ga0070660_100112133 | Ga0070660_1001121332 | 225 |
| 112 | 3300005339 | Ga0070660_100365108 | Ga0070660_1003651082 | 225 |
| 113 | 3300005339 | Ga0070660_100545369 | Ga0070660_1005453691 | 225 |
| 114 | 3300005356 | Ga0070674_100057080 | Ga0070674_1000570804 | 225 |
| 115 | 3300005366 | Ga0070659_100000094 | Ga0070659_1000000946 | 225 |
| 116 | 3300005366 | Ga0070659_100467846 | Ga0070659_1004678461 | 225 |
| 117 | 3300005455 | Ga0070663_100010790 | Ga0070663_1000107903 | 225 |
| 118 | 3300005457 | Ga0070662_100000003 | Ga0070662_100000003129 | 225 |
| 119 | 3300005458 | Ga0070681_10323809 | Ga0070681_103238092 | 225 |
| 120 | 3300005530 | Ga0070679_100022268 | Ga0070679_1000222684 | 225 |
| 121 | 3300005530 | Ga0070679_100072018 | Ga0070679_1000720181 | 225 |
| 122 | 3300005539 | Ga0068853_100078882 | Ga0068853_1000788822 | 225 |
| 123 | 3300005539 | Ga0068853_100154590 | Ga0068853_1001545902 | 225 |
| 124 | 3300005539 | Ga0068853_100640486 | Ga0068853_1006404862 | 225 |
| 125 | 3300005548 | Ga0070665_100000212 | Ga0070665_10000021235 | 225 |
| 126 | 3300005548 | Ga0070665_100687427 | Ga0070665_1006874272 | 225 |
| 127 | 3300005563 | Ga0068855_100000127 | Ga0068855_1000001277 | 225 |
| 128 | 3300005563 | Ga0068855_100000201 | Ga0068855_10000020116 | 225 |
| 129 | 3300005563 | Ga0068855_100065287 | Ga0068855_1000652872 | 225 |
| 130 | 3300005563 | Ga0068855_100068031 | Ga0068855_1000680312 | 225 |
| 131 | 3300005563 | Ga0068855_100188330 | Ga0068855_1001883303 | 225 |
| 132 | 3300005563 | Ga0068855_100276231 | Ga0068855_1002762314 | 225 |
| 133 | 3300005563 | Ga0068855_100849101 | Ga0068855_1008491012 | 225 |
| 134 | 3300005563 | Ga0068855_101011822 | Ga0068855_1010118222 | 225 |
| 135 | 3300005614 | Ga0068856_100000036 | Ga0068856_10000003698 | 225 |
| 136 | 3300005614 | Ga0068856_100005050 | Ga0068856_1000050508 | 225 |
| 137 | 3300005614 | Ga0068856_100025384 | Ga0068856_1000253847 | 225 |
| 138 | 3300005614 | Ga0068856_100079116 | Ga0068856_1000791162 | 225 |
| 139 | 3300005614 | Ga0068856_100560146 | Ga0068856_1005601462 | 225 |
| 140 | 3300005616 | Ga0068852_100097077 | Ga0068852_1000970775 | 225 |
| 141 | 3300005616 | Ga0068852_100348586 | Ga0068852_1003485861 | 225 |
| 142 | 3300005616 | Ga0068852_100801263 | Ga0068852_1008012631 | 225 |
| 143 | 3300005840 | Ga0068870_10009317 | Ga0068870_100093173 | 225 |
| 144 | 3300006195 | Ga0075366_10005756 | Ga0075366_100057568 | 225 |
| 145 | 3300006195 | Ga0075366_10006727 | Ga0075366_100067273 | 225 |
| 146 | 3300009093 | Ga0105240_10030257 | Ga0105240_100302574 | 225 |
| 147 | 3300009093 | Ga0105240_10044696 | Ga0105240_100446962 | 225 |
| 148 | 3300009093 | Ga0105240_10046155 | Ga0105240_100461554 | 225 |
| 149 | 3300009093 | Ga0105240_10067821 | Ga0105240_100678214 | 225 |
| 150 | 3300009093 | Ga0105240_10075450 | Ga0105240_100754502 | 225 |
| 151 | 3300009093 | Ga0105240_10109684 | Ga0105240_101096842 | 225 |
| 152 | 3300009093 | Ga0105240_10604534 | Ga0105240_106045342 | 225 |
| 153 | 3300009174 | Ga0105241_10002920 | Ga0105241_100029206 | 225 |
| 154 | 3300009174 | Ga0105241_10400526 | Ga0105241_104005261 | 225 |
| 155 | 3300009174 | Ga0105241_10455376 | Ga0105241_104553761 | 225 |
| 156 | 3300009176 | Ga0105242_11049180 | Ga0105242_110491801 | 225 |
| 157 | 3300009545 | Ga0105237_10000620 | Ga0105237_1000062026 | 225 |
| 158 | 3300009545 | Ga0105237_10001785 | Ga0105237_100017854 | 225 |
| 159 | 3300009545 | Ga0105237_10134851 | Ga0105237_101348514 | 225 |
| 160 | 3300009545 | Ga0105237_10145580 | Ga0105237_101455802 | 225 |
| 161 | 3300009545 | Ga0105237_10328445 | Ga0105237_103284453 | 225 |
| 162 | 3300010375 | Ga0105239_10000008 | Ga0105239_10000008165 | 225 |
| 163 | 3300010375 | Ga0105239_10000045 | Ga0105239_1000004529 | 225 |
| 164 | 3300010375 | Ga0105239_10000446 | Ga0105239_1000044657 | 225 |
| 165 | 3300010375 | Ga0105239_10007945 | Ga0105239_100079459 | 225 |
| 166 | 3300010375 | Ga0105239_10018812 | Ga0105239_100188126 | 225 |
| 167 | 3300013100 | Ga0157373_10000091 | Ga0157373_1000009152 | 225 |
| 168 | 3300013100 | Ga0157373_10003653 | Ga0157373_1000365310 | 225 |
| 169 | 3300013100 | Ga0157373_10046956 | Ga0157373_100469562 | 225 |
| 170 | 3300013102 | Ga0157371_10000155 | Ga0157371_1000015570 | 225 |
| 171 | 3300013102 | Ga0157371_10002671 | Ga0157371_100026714 | 225 |
| 172 | 3300013102 | Ga0157371_10012104 | Ga0157371_100121041 | 225 |
| 173 | 3300013102 | Ga0157371_10037490 | Ga0157371_100374902 | 225 |
| 174 | 3300013104 | Ga0157370_10016345 | Ga0157370_100163454 | 225 |
| 175 | 3300013104 | Ga0157370_10143941 | Ga0157370_101439412 | 225 |
| 176 | 3300013104 | Ga0157370_10169028 | Ga0157370_101690282 | 225 |
| 177 | 3300013104 | Ga0157370_10205525 | Ga0157370_102055252 | 225 |
| 178 | 3300013104 | Ga0157370_10776520 | Ga0157370_107765202 | 225 |
| 179 | 3300013105 | Ga0157369_10001051 | Ga0157369_1000105118 | 225 |
| 180 | 3300013105 | Ga0157369_10092987 | Ga0157369_100929875 | 225 |
| 181 | 3300013105 | Ga0157369_10561862 | Ga0157369_105618621 | 225 |
| 182 | 3300013296 | Ga0157374_10012425 | Ga0157374_100124256 | 225 |
| 183 | 3300013296 | Ga0157374_10186435 | Ga0157374_101864353 | 225 |
| 184 | 3300013297 | Ga0157378_10018561 | Ga0157378_100185614 | 225 |
| 185 | 3300013297 | Ga0157378_10129359 | Ga0157378_101293592 | 225 |
| 186 | 3300013306 | Ga0163162_10000041 | Ga0163162_1000004126 | 225 |
| 187 | 3300013306 | Ga0163162_10005549 | Ga0163162_1000554910 | 225 |
| 188 | 3300013307 | Ga0157372_10000009 | Ga0157372_1000000925 | 225 |
| 189 | 3300013307 | Ga0157372_10002228 | Ga0157372_100022287 | 225 |
| 190 | 3300013307 | Ga0157372_10004603 | Ga0157372_100046032 | 225 |
| 191 | 3300013307 | Ga0157372_10007451 | Ga0157372_100074518 | 225 |
| 192 | 3300013307 | Ga0157372_10084880 | Ga0157372_100848804 | 225 |
| 193 | 3300014325 | Ga0163163_10846310 | Ga0163163_108463101 | 225 |
| 194 | 3300025231 | Ga0207427_100109 | Ga0207427_10010925 | 225 |
| 195 | 3300025233 | Ga0209437_100096 | Ga0209437_100096132 | 225 |
| 196 | 3300025233 | Ga0209437_100507 | Ga0209437_10050724 | 225 |
| 197 | 3300025250 | Ga0209026_1000225 | Ga0209026_100022566 | 225 |
| 198 | 3300025261 | Ga0209233_1000029 | Ga0209233_1000029508 | 225 |
| 199 | 3300025261 | Ga0209233_1000701 | Ga0209233_100070116 | 225 |
| 200 | 3300025272 | Ga0209455_1010103 | Ga0209455_10101031 | 225 |
| 201 | 3300025904 | Ga0207647_10000135 | Ga0207647_1000013524 | 225 |
| 202 | 3300025904 | Ga0207647_10000698 | Ga0207647_1000069819 | 225 |
| 203 | 3300025904 | Ga0207647_10021205 | Ga0207647_100212056 | 225 |
| 204 | 3300025904 | Ga0207647_10079357 | Ga0207647_100793574 | 225 |
| 205 | 3300025909 | Ga0207705_10000111 | Ga0207705_1000011174 | 225 |
| 206 | 3300025909 | Ga0207705_10294000 | Ga0207705_102940001 | 225 |
| 207 | 3300025911 | Ga0207654_10004371 | Ga0207654_100043716 | 225 |
| 208 | 3300025911 | Ga0207654_10043401 | Ga0207654_100434012 | 225 |
| 209 | 3300025911 | Ga0207654_10120813 | Ga0207654_101208131 | 225 |
| 210 | 3300025912 | Ga0207707_10031546 | Ga0207707_100315466 | 225 |
| 211 | 3300025913 | Ga0207695_10038681 | Ga0207695_100386813 | 225 |
| 212 | 3300025913 | Ga0207695_10063126 | Ga0207695_100631263 | 225 |
| 213 | 3300025913 | Ga0207695_10071078 | Ga0207695_100710782 | 225 |
| 214 | 3300025913 | Ga0207695_10267758 | Ga0207695_102677581 | 225 |
| 215 | 3300025913 | Ga0207695_10279728 | Ga0207695_102797282 | 225 |
| 216 | 3300025913 | Ga0207695_10802422 | Ga0207695_108024221 | 225 |
| 217 | 3300025914 | Ga0207671_10000899 | Ga0207671_1000089920 | 225 |
| 218 | 3300025914 | Ga0207671_10003474 | Ga0207671_1000347413 | 225 |
| 219 | 3300025914 | Ga0207671_10435518 | Ga0207671_104355182 | 225 |
| 220 | 3300025914 | Ga0207671_10441330 | Ga0207671_104413301 | 225 |
| 221 | 3300025914 | Ga0207671_10738135 | Ga0207671_107381351 | 225 |
| 222 | 3300025917 | Ga0207660_10280791 | Ga0207660_102807911 | 225 |
| 223 | 3300025919 | Ga0207657_10120521 | Ga0207657_101205213 | 225 |
| 224 | 3300025919 | Ga0207657_10327368 | Ga0207657_103273682 | 225 |
| 225 | 3300025919 | Ga0207657_10623106 | Ga0207657_106231062 | 225 |
| 226 | 3300025921 | Ga0207652_10256665 | Ga0207652_102566651 | 225 |
| 227 | 3300025932 | Ga0207690_10003190 | Ga0207690_1000319010 | 225 |
| 228 | 3300025932 | Ga0207690_10422177 | Ga0207690_104221771 | 225 |
| 229 | 3300025933 | Ga0207706_10000009 | Ga0207706_10000009138 | 225 |
| 230 | 3300025944 | Ga0207661_10112020 | Ga0207661_101120202 | 225 |
| 231 | 3300025949 | Ga0207667_10000236 | Ga0207667_1000023645 | 225 |
| 232 | 3300025949 | Ga0207667_10007060 | Ga0207667_1000706012 | 225 |
| 233 | 3300025949 | Ga0207667_10155865 | Ga0207667_101558652 | 225 |
| 234 | 3300025949 | Ga0207667_10200238 | Ga0207667_102002382 | 225 |
| 235 | 3300025949 | Ga0207667_10908167 | Ga0207667_109081671 | 225 |
| 236 | 3300026041 | Ga0207639_10040162 | Ga0207639_100401624 | 225 |
| 237 | 3300026041 | Ga0207639_10490480 | Ga0207639_104904801 | 225 |
| 238 | 3300026067 | Ga0207678_10168861 | Ga0207678_101688612 | 225 |
| 239 | 3300026078 | Ga0207702_10000088 | Ga0207702_1000008816 | 225 |
| 240 | 3300026078 | Ga0207702_10027913 | Ga0207702_100279133 | 225 |
| 241 | 3300026078 | Ga0207702_10052838 | Ga0207702_100528382 | 225 |
| 242 | 3300026078 | Ga0207702_10083373 | Ga0207702_100833734 | 225 |
| 243 | 3300026078 | Ga0207702_10424268 | Ga0207702_104242681 | 225 |
| 244 | 3300026078 | Ga0207702_10805457 | Ga0207702_108054572 | 225 |
| 245 | 3300026116 | Ga0207674_10045110 | Ga0207674_100451106 | 225 |
| 246 | 3300026142 | Ga0207698_10317769 | Ga0207698_103177692 | 225 |
| 247 | 3300026142 | Ga0207698_10337630 | Ga0207698_103376302 | 225 |
| 248 | 3300028379 | Ga0268266_10000177 | Ga0268266_1000017783 | 225 |
| 249 | 3300028379 | Ga0268266_10592910 | Ga0268266_105929102 | 225 |
| 250 | 3300028794 | Ga0307515_10000643 | Ga0307515_1000064371 | 225 |
| 251 | 3300028794 | Ga0307515_10024651 | Ga0307515_100246516 | 225 |
| 252 | 3300028800 | Ga0265338_10057975 | Ga0265338_100579757 | 225 |
| 253 | 3300031507 | Ga0307509_10030534 | Ga0307509_100305345 | 225 |
| 254 | 3300031911 | Ga0307412_10194773 | Ga0307412_101947732 | 225 |
| 255 | 3300033179 | Ga0307507_10014221 | Ga0307507_1001422111 | 225 |
| 256 | 3300037312 | Ga0395899_0000327 | Ga0395899_0000327_33372_34052 | 225 |
| 257 | 3300037312 | Ga0395899_0018626 | Ga0395899_0018626_4406_5110 | 225 |
| 258 | 3300037312 | Ga0395899_0019965 | Ga0395899_0019965_4228_4905 | 225 |
| 259 | 3300037418 | Ga0395900_0000197 | Ga0395900_0000197_4614_5291 | 225 |
| 260 | 3300037418 | Ga0395900_0094978 | Ga0395900_0094978_2029_2733 | 225 |
| 261 | 3300037418 | Ga0395900_0231547 | Ga0395900_0231547_520_1197 | 225 |
| 262 | 3300037466 | Ga0395898_0466440 | Ga0395898_0466440_73_750 | 225 |
| 263 | 3300037471 | Ga0395905_0000186 | Ga0395905_0000186_97370_98047 | 225 |
| 264 | 3300037471 | Ga0395905_0003273 | Ga0395905_0003273_14121_14825 | 225 |
| 265 | 3300038443 | Ga0395901_0000368 | Ga0395901_0000368_52164_52841 | 225 |
| 266 | 3300038443 | Ga0395901_0008274 | Ga0395901_0008274_5539_6243 | 225 |
| 267 | 3300038443 | Ga0395901_0314993 | Ga0395901_0314993_907_1587 | 225 |
| 268 | 3300038443 | Ga0395901_0428041 | Ga0395901_0428041_548_1225 | 225 |
| 269 | 3300041486 | Ga0451807_0115040 | Ga0451807_0115040_484_1161 | 225 |
| 270 | 3300042012 | Ga0439455_0011503 | Ga0439455_0011503_33_710 | 225 |
| 271 | 3300044656 | Ga0466969_0070955 | Ga0466969_0070955_271_951 | 225 |
| 272 | 3300044684 | Ga0466966_0048533 | Ga0466966_0048533_293_973 | 225 |
| 273 | 3300044693 | Ga0466961_0069557 | Ga0466961_0069557_991_1671 | 225 |
| 274 | 3300045049 | Ga0466959_0050418 | Ga0466959_0050418_1941_2621 | 225 |
| 275 | 3300045836 | Ga0466958_0014504 | Ga0466958_0014504_2465_3145 | 225 |
| 276 | 3300046492 | Ga0495585_0000323 | Ga0495585_0000323_32481_33158 | 225 |
| 277 | 3300046507 | Ga0495606_0000074 | Ga0495606_0000074_141546_142223 | 225 |
| 278 | 3300046507 | Ga0495606_0010496 | Ga0495606_0010496_505_1182 | 225 |
| 279 | 3300046507 | Ga0495606_0051265 | Ga0495606_0051265_466_1143 | 225 |
| 280 | 3300046516 | Ga0495628_0591863 | Ga0495628_0591863_80_757 | 225 |
| 281 | 3300046523 | Ga0495644_0000790 | Ga0495644_0000790_6613_7290 | 225 |
| 282 | 3300046524 | Ga0495648_0006718 | Ga0495648_0006718_1752_2429 | 225 |
| 283 | 3300046529 | Ga0495652_0263723 | Ga0495652_0263723_249_926 | 225 |
| 284 | 3300046530 | Ga0495654_0024729 | Ga0495654_0024729_474_1151 | 225 |
| 285 | 3300046538 | Ga0495609_0008096 | Ga0495609_0008096_524_1201 | 225 |
| 286 | 3300046558 | Ga0495633_0000006 | Ga0495633_0000006_246653_247330 | 225 |
| 287 | 3300046558 | Ga0495633_0191023 | Ga0495633_0191023_57_734 | 225 |
| 288 | 3300046616 | Ga0495668_0000011 | Ga0495668_0000011_221975_222652 | 225 |
| 289 | 3300046616 | Ga0495668_0249491 | Ga0495668_0249491_206_883 | 225 |
| 290 | 3300046660 | Ga0495625_0000462 | Ga0495625_0000462_49509_50186 | 225 |
| 291 | 3300046660 | Ga0495625_0000486 | Ga0495625_0000486_6133_6810 | 225 |
| 292 | 3300046683 | Ga0495658_0360545 | Ga0495658_0360545_165_842 | 225 |
| 293 | 3300046691 | Ga0495670_0099117 | Ga0495670_0099117_583_1260 | 225 |
| 294 | 3300047443 | Ga0495687_036103 | Ga0495687_036103_1026_1703 | 225 |
| 295 | 3300047445 | Ga0495677_0076055 | Ga0495677_0076055_14_691 | 225 |
| 296 | 3300047472 | Ga0495686_0004631 | Ga0495686_0004631_9069_9749 | 225 |
| 297 | 3300047472 | Ga0495686_0035242 | Ga0495686_0035242_645_1322 | 225 |
| 298 | 3300048089 | Ga0495614_0022639 | Ga0495614_0022639_1716_2393 | 225 |
| 299 | 3300049460 | Ga0495682_0023894 | Ga0495682_0023894_256_933 | 225 |
| 300 | 3300050493 | nmdc:mga0k408_22_c2 | nmdc:mga0k408_22_c2_23068_23745 | 225 |
| 301 | 3300053080 | Ga0500635_0000482 | Ga0500635_0000482_3956_4633 | 225 |
| 302 | 3300053122 | Ga0500608_042233 | Ga0500608_042233_1134_1811 | 225 |
| 303 | 3300053123 | Ga0500614_007798 | Ga0500614_007798_1515_2192 | 225 |
| 304 | 3300053125 | Ga0500618_000148 | Ga0500618_000148_6796_7473 | 225 |
| 305 | 3300053157 | Ga0500624_002450 | Ga0500624_002450_1602_2279 | 225 |
| 306 | 3300053161 | Ga0500634_0066997 | Ga0500634_0066997_409_1086 | 225 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6vl6-assembly1.cif.gz_B | de novo designed tetrahedral nanoparticle t33_dn2 presenting bg505 sosip trimers | 0.9018 | 103 | 199 |
| 8fwd-assembly1.cif.gz_2 | fast and versatile sequence- independent protein docking for nanomaterials design using rpxdock | 0.8999 | 103 | 197 |
| 8fwd-assembly1.cif.gz_P | fast and versatile sequence- independent protein docking for nanomaterials design using rpxdock | 0.8986 | 103 | 197 |
| 8fwd-assembly1.cif.gz_L | fast and versatile sequence- independent protein docking for nanomaterials design using rpxdock | 0.8937 | 103 | 197 |
| 8fwd-assembly1.cif.gz_1 | fast and versatile sequence- independent protein docking for nanomaterials design using rpxdock | 0.8801 | 60 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5ZBW3_76_160_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9073 | 103 | 170 | 1.25.40.10 |
| af_K7DY99_481_795_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.8805 | 60 | 202 | 1.25.40.10 |
| af_B4FDG5_174_307_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.8781 | 75 | 197 | 1.25.40.10 |
| af_O94826_105_217_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.8753 | 103 | 199 | 1.25.40.10 |
| af_Q4D833_63_177_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.8739 | 103 | 199 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4U1C068-F1-model_v4 | Tetratricopeptide repeat protein | 0.9839 | 14 | 225 |
GO:0016020
|
| AF-A0A7W1PS50-F1-model_v4 | Tetratricopeptide repeat protein | 0.9826 | 15 | 224 |
GO:0016020
|
| AF-A0A2N5YTL4-F1-model_v4 | Uncharacterized protein | 0.9815 | 103 | 225 |
|
| AF-A0A520CN01-F1-model_v4 | Tetratricopeptide repeat protein | 0.9807 | 41 | 225 |
|
| AF-X1UZV7-F1-model_v4 | Uncharacterized protein | 0.9806 | 61 | 224 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar