F398818

General Info

Members Datasets Scaffolds Average Seq Length
306 153 299 221

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0080220|Ga0495650_0080220_46_834
Length 251
Sequence LFLHRRGVLLKLQLFNLKGIARNYENRNFANFNFVTTMSKIQANTKVAAPETNLGHSGNFVRENQKSLLFIGGAIIALIAIYLLYLKLYLGPREITAADQMHVAQDFWAKKDWDKAIKGDASYPGFEKIINEYSNTRAANLAYFYLGTAYLNKGEYRKAIDNLNNYRGDDNMAAAEAFGGIKAATYFNKAIDKAKNKFLSPLYLKKLGLVYEEQKDNKNAGETYKRIKSEYPESAEAQNIDEYIARAEAKQ

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
5 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
6 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
7 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
8 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
9 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
111 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
129 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
137 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
140 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
145 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
148 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
149 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
150 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
151 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
152 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
153 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0
Isolates 2.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.52
Nodule 0
Rhizoplane 0.65
Rhizosphere 85.95
Stem 0
Stem Tuber 0
Unclassified 5.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001405 3300001904 Bacteria 4406
2 JGI24736J21556_1002231 3300001904 Bacteria 3430
3 JGI24741J21665_1029998 3300001915 Bacteria 816
4 JGI24740J21852_10007444 3300001979 Bacteria 4452
5 JGI24740J21852_10027636 3300001979 Bacteria 1885
6 JGI24740J21852_10075028 3300001979 Bacteria 897
7 JGI24737J22298_10000077 3300001990 Bacteria 28981
8 JGI24737J22298_10003409 3300001990 Bacteria 5619
9 JGI24737J22298_10006057 3300001990 Bacteria 4147
10 JGI24735J21928_10000005 3300002067 Bacteria 356755
11 JGI24735J21928_10054258 3300002067 Bacteria 1155
12 JGI24744J21845_10000710 3300002077 Bacteria 6141
13 JGI24744J21845_10024470 3300002077 Bacteria 1180
14 JGI25162J39368_1000563 3300002737 Bacteria 27213
15 JGI25162J39368_1000596 3300002737 Bacteria 26217
16 JGI25157J39369_1011860 3300002741 Bacteria 1119
17 JGI25165J46597_1000658 3300003214 Bacteria 28305
18 rootH1_10026072 3300003316 Bacteria 16591
19 rootH1_10155653 3300003316 Bacteria 2760
20 rootH2_10024240 3300003320 Bacteria 36961
21 rootH2_10085495 3300003320 Bacteria 1209
22 rootH1_10005386 3300003323 Bacteria 37172
23 rootH1_10006071 3300003323 Bacteria 12892
24 Ga0065714_10010854 3300005288 Bacteria 2496
25 Ga0065714_10091954 3300005288 Bacteria 1893
26 Ga0065714_10121770 3300005288 Bacteria 1339
27 Ga0070658_10000236 3300005327 Bacteria 48963
28 Ga0070658_10193326 3300005327 Bacteria 1715
29 Ga0070676_10000133 3300005328 Bacteria 28281
30 Ga0070683_100012137 3300005329 Bacteria 7477
31 Ga0070680_100001753 3300005336 Bacteria 15938
32 Ga0070660_100112133 3300005339 Bacteria 2171
33 Ga0070660_100365108 3300005339 Bacteria 1190
34 Ga0070660_100545369 3300005339 Bacteria 967
35 Ga0070674_100057080 3300005356 Bacteria 2709
36 Ga0070673_100024633 3300005364 Bacteria 4416
37 Ga0070659_100000094 3300005366 Bacteria 66823
38 Ga0070659_100467846 3300005366 Bacteria 1071
39 Ga0070663_100010790 3300005455 Bacteria 5704
40 Ga0070678_100020119 3300005456 Bacteria 4372
41 Ga0070662_100000003 3300005457 Bacteria 239813
42 Ga0070681_10323809 3300005458 Bacteria 1451
43 Ga0068867_100000624 3300005459 Bacteria 23370
44 Ga0070679_100022268 3300005530 Bacteria 6192
45 Ga0070679_100072018 3300005530 Bacteria 3448
46 Ga0068853_100010556 3300005539 Bacteria 7468
47 Ga0068853_100078882 3300005539 Bacteria 2878
48 Ga0068853_100154590 3300005539 Bacteria 2066
49 Ga0068853_100640486 3300005539 Bacteria 1011
50 Ga0070665_100000212 3300005548 Bacteria 100019
51 Ga0070665_100687427 3300005548 Bacteria 1036
52 Ga0068855_100000127 3300005563 Bacteria 96826
53 Ga0068855_100000201 3300005563 Bacteria 76965
54 Ga0068855_100065287 3300005563 Bacteria 4243
55 Ga0068855_100068031 3300005563 Bacteria 4148
56 Ga0068855_100188330 3300005563 Bacteria 2329
57 Ga0068855_100276231 3300005563 Bacteria 1867
58 Ga0068855_100849101 3300005563 Bacteria 968
59 Ga0068855_101011822 3300005563 Bacteria 873
60 Ga0068856_100000036 3300005614 Bacteria 121468
61 Ga0068856_100005050 3300005614 Bacteria 13063
62 Ga0068856_100025384 3300005614 Bacteria 5779
63 Ga0068856_100079116 3300005614 Bacteria 3260
64 Ga0068856_100560146 3300005614 Bacteria 1164
65 Ga0068852_100004529 3300005616 Bacteria 9834
66 Ga0068852_100097077 3300005616 Bacteria 2650
67 Ga0068852_100348586 3300005616 Bacteria 1445
68 Ga0068852_100801263 3300005616 Bacteria 956
69 Ga0068859_101019803 3300005617 Bacteria 909
70 Ga0068866_10028077 3300005718 Bacteria 2678
71 Ga0068870_10009317 3300005840 Bacteria 4460
72 Ga0075366_10001995 3300006195 Bacteria 10341
73 Ga0075366_10005756 3300006195 Bacteria 6731
74 Ga0075366_10006727 3300006195 Bacteria 6313
75 Ga0097621_100000205 3300006237 Bacteria 38617
76 Ga0068871_100000162 3300006358 Bacteria 44419
77 Ga0068865_100000075 3300006881 Bacteria 51751
78 Ga0097620_101020174 3300006931 Bacteria 909
79 Ga0105240_10030257 3300009093 Bacteria 7038
80 Ga0105240_10044696 3300009093 Bacteria 5625
81 Ga0105240_10046155 3300009093 Bacteria 5522
82 Ga0105240_10067821 3300009093 Bacteria 4421
83 Ga0105240_10075450 3300009093 Bacteria 4159
84 Ga0105240_10109684 3300009093 Bacteria 3342
85 Ga0105240_10604534 3300009093 Bacteria 1207
86 Ga0105245_10146520 3300009098 Bacteria 2228
87 Ga0105245_11110851 3300009098 Bacteria 837
88 Ga0105243_10188655 3300009148 Bacteria 1799
89 Ga0105241_10002920 3300009174 Bacteria 12766
90 Ga0105241_10106365 3300009174 Bacteria 2239
91 Ga0105241_10325254 3300009174 Bacteria 1327
92 Ga0105241_10400526 3300009174 Bacteria 1204
93 Ga0105241_10455376 3300009174 Bacteria 1132
94 Ga0105242_10022443 3300009176 Bacteria 4964
95 Ga0105242_11049180 3300009176 Bacteria 826
96 Ga0105237_10000620 3300009545 Bacteria 49579
97 Ga0105237_10000808 3300009545 Bacteria 42764
98 Ga0105237_10001785 3300009545 Bacteria 27820
99 Ga0105237_10134851 3300009545 Bacteria 2463
100 Ga0105237_10145580 3300009545 Bacteria 2364
101 Ga0105237_10328445 3300009545 Bacteria 1533
102 Ga0105239_10000008 3300010375 Bacteria 376925
103 Ga0105239_10000045 3300010375 Bacteria 186314
104 Ga0105239_10000446 3300010375 Bacteria 60289
105 Ga0105239_10007945 3300010375 Bacteria 12126
106 Ga0105239_10010933 3300010375 Bacteria 10139
107 Ga0105239_10018812 3300010375 Bacteria 7631
108 Ga0105239_10109872 3300010375 Bacteria 3056
109 Ga0157373_10000091 3300013100 Bacteria 75012
110 Ga0157373_10003653 3300013100 Bacteria 11625
111 Ga0157373_10046956 3300013100 Bacteria 3081
112 Ga0157371_10000155 3300013102 Bacteria 100230
113 Ga0157371_10002671 3300013102 Bacteria 16870
114 Ga0157371_10012104 3300013102 Bacteria 6609
115 Ga0157371_10037490 3300013102 Bacteria 3469
116 Ga0157370_10016345 3300013104 Bacteria 7516
117 Ga0157370_10143941 3300013104 Bacteria 2220
118 Ga0157370_10169028 3300013104 Bacteria 2033
119 Ga0157370_10205525 3300013104 Bacteria 1826
120 Ga0157370_10776520 3300013104 Bacteria 872
121 Ga0157369_10001051 3300013105 Bacteria 34842
122 Ga0157369_10092987 3300013105 Bacteria 3219
123 Ga0157369_10561862 3300013105 Bacteria 1179
124 Ga0157374_10001433 3300013296 Bacteria 20152
125 Ga0157374_10012425 3300013296 Bacteria 7407
126 Ga0157374_10186435 3300013296 Bacteria 2028
127 Ga0157378_10018561 3300013297 Bacteria 6113
128 Ga0157378_10023282 3300013297 Bacteria 5451
129 Ga0157378_10129359 3300013297 Bacteria 2336
130 Ga0163162_10000041 3300013306 Bacteria 132375
131 Ga0163162_10005549 3300013306 Bacteria 12198
132 Ga0163162_10139617 3300013306 Bacteria 2535
133 Ga0157372_10000009 3300013307 Bacteria 302051
134 Ga0157372_10002228 3300013307 Bacteria 21035
135 Ga0157372_10004603 3300013307 Bacteria 14664
136 Ga0157372_10007451 3300013307 Bacteria 11640
137 Ga0157372_10084880 3300013307 Bacteria 3591
138 Ga0157372_10104869 3300013307 Bacteria 3233
139 Ga0163163_10846310 3300014325 Bacteria 978
140 Ga0157376_10006003 3300014969 Bacteria 8535
141 Ga0213872_10059866 3300021361 Bacteria 1723
142 Ga0207427_100109 3300025231 Bacteria 116061
143 Ga0209437_100096 3300025233 Bacteria 233558
144 Ga0209437_100507 3300025233 Bacteria 27709
145 Ga0209026_1000225 3300025250 Bacteria 77234
146 Ga0209026_1002625 3300025250 Bacteria 6562
147 Ga0209233_1000029 3300025261 Bacteria 641642
148 Ga0209233_1000701 3300025261 Bacteria 15748
149 Ga0209455_1010103 3300025272 Bacteria 2425
150 Ga0207647_10000135 3300025904 Bacteria 58247
151 Ga0207647_10000698 3300025904 Bacteria 26307
152 Ga0207647_10021205 3300025904 Bacteria 4340
153 Ga0207647_10079357 3300025904 Bacteria 1971
154 Ga0207645_10000014 3300025907 Bacteria 117512
155 Ga0207705_10000111 3300025909 Bacteria 92842
156 Ga0207705_10294000 3300025909 Bacteria 1245
157 Ga0207654_10004371 3300025911 Bacteria 7123
158 Ga0207654_10043401 3300025911 Bacteria 2549
159 Ga0207654_10047718 3300025911 Bacteria 2448
160 Ga0207654_10120813 3300025911 Bacteria 1645
161 Ga0207707_10031546 3300025912 Bacteria 4637
162 Ga0207695_10038681 3300025913 Bacteria 5133
163 Ga0207695_10063126 3300025913 Bacteria 3820
164 Ga0207695_10071078 3300025913 Bacteria 3555
165 Ga0207695_10267758 3300025913 Bacteria 1605
166 Ga0207695_10279728 3300025913 Bacteria 1562
167 Ga0207695_10802422 3300025913 Bacteria 821
168 Ga0207671_10000899 3300025914 Bacteria 37624
169 Ga0207671_10001286 3300025914 Bacteria 29511
170 Ga0207671_10003474 3300025914 Bacteria 15671
171 Ga0207671_10435518 3300025914 Bacteria 1043
172 Ga0207671_10441330 3300025914 Bacteria 1036
173 Ga0207671_10738135 3300025914 Bacteria 782
174 Ga0207660_10280791 3300025917 Bacteria 1321
175 Ga0207657_10120521 3300025919 Bacteria 2158
176 Ga0207657_10327368 3300025919 Bacteria 1211
177 Ga0207657_10623106 3300025919 Bacteria 841
178 Ga0207652_10256665 3300025921 Bacteria 1577
179 Ga0207690_10003190 3300025932 Bacteria 9841
180 Ga0207690_10422177 3300025932 Bacteria 1067
181 Ga0207706_10000009 3300025933 Bacteria 200607
182 Ga0207706_10859602 3300025933 Bacteria 768
183 Ga0207686_10031730 3300025934 Bacteria 3139
184 Ga0207709_10141689 3300025935 Bacteria 1653
185 Ga0207704_10000118 3300025938 Bacteria 43936
186 Ga0207661_10112020 3300025944 Bacteria 2309
187 Ga0207667_10000236 3300025949 Bacteria 77019
188 Ga0207667_10007060 3300025949 Bacteria 13571
189 Ga0207667_10155865 3300025949 Bacteria 2350
190 Ga0207667_10200238 3300025949 Bacteria 2049
191 Ga0207667_10908167 3300025949 Bacteria 872
192 Ga0207651_10010534 3300025960 Bacteria 5129
193 Ga0207639_10001022 3300026041 Bacteria 19034
194 Ga0207639_10040162 3300026041 Bacteria 3491
195 Ga0207639_10107339 3300026041 Bacteria 2268
196 Ga0207639_10490480 3300026041 Bacteria 1121
197 Ga0207678_10168861 3300026067 Unclassified 1868
198 Ga0207702_10000088 3300026078 Bacteria 105505
199 Ga0207702_10027913 3300026078 Bacteria 4690
200 Ga0207702_10052838 3300026078 Bacteria 3439
201 Ga0207702_10083373 3300026078 Bacteria 2781
202 Ga0207702_10424268 3300026078 Bacteria 1287
203 Ga0207702_10805457 3300026078 Unclassified 929
204 Ga0207648_10000963 3300026089 Bacteria 32564
205 Ga0207674_10045110 3300026116 Bacteria 4537
206 Ga0207683_10002362 3300026121 Bacteria 16484
207 Ga0207698_10000733 3300026142 Bacteria 19000
208 Ga0207698_10317769 3300026142 Bacteria 1457
209 Ga0207698_10337630 3300026142 Bacteria 1418
210 Ga0207698_10927771 3300026142 Bacteria 879
211 Ga0268266_10000177 3300028379 Bacteria 114318
212 Ga0268266_10592910 3300028379 Bacteria 1064
213 Ga0307517_10000553 3300028786 Bacteria 63892
214 Ga0307515_10000643 3300028794 Bacteria 80674
215 Ga0307515_10024651 3300028794 Bacteria 10465
216 Ga0265338_10057975 3300028800 Bacteria 3422
217 Ga0307509_10030534 3300031507 Bacteria 5959
218 Ga0307412_10194773 3300031911 Bacteria 1535
219 Ga0307507_10014221 3300033179 Bacteria 9519
220 Ga0307510_10000172 3300033180 Bacteria 54812
221 Ga0395899_0000327 3300037312 Bacteria 60343
222 Ga0395899_0018626 3300037312 Bacteria 5276
223 Ga0395899_0019965 3300037312 Bacteria 5083
224 Ga0395900_0000197 3300037418 Bacteria 95775
225 Ga0395900_0000609 3300037418 Bacteria 48753
226 Ga0395900_0094978 3300037418 Bacteria 3063
227 Ga0395900_0231547 3300037418 Bacteria 1858
228 Ga0395898_0466440 3300037466 Bacteria 1202
229 Ga0395905_0000186 3300037471 Bacteria 99159
230 Ga0395905_0003273 3300037471 Bacteria 17408
231 Ga0395901_0000368 3300038443 Bacteria 54066
232 Ga0395901_0008274 3300038443 Bacteria 10508
233 Ga0395901_0314993 3300038443 Bacteria 1620
234 Ga0395901_0428041 3300038443 Bacteria 1356
235 Ga0436361_0709938 3300039447 Bacteria 3399
236 Ga0451807_0115040 3300041486 Bacteria 1247
237 Ga0439455_0011503 3300042012 Bacteria 1968
238 Ga0466969_0070955 3300044656 Unclassified 1675
239 Ga0466966_0048533 3300044684 Bacteria 2704
240 Ga0466961_0069557 3300044693 Bacteria 2235
241 Ga0466959_0050418 3300045049 Bacteria 3056
242 Ga0466959_0137652 3300045049 Bacteria 1727
243 Ga0466958_0014504 3300045836 Bacteria 4499
244 Ga0495650_0000225 3300046471 Bacteria 117898
245 Ga0495650_0080220 3300046471 Bacteria 1260
246 Ga0495585_0000074 3300046492 Bacteria 102651
247 Ga0495585_0000323 3300046492 Bacteria 47094
248 Ga0495583_0035693 3300046506 Bacteria 2371
249 Ga0495606_0000074 3300046507 Bacteria 170848
250 Ga0495606_0010496 3300046507 Bacteria 7675
251 Ga0495606_0013471 3300046507 Bacteria 6454
252 Ga0495606_0051265 3300046507 Bacteria 2693
253 Ga0495606_0320304 3300046507 Bacteria 833
254 Ga0495610_0001170 3300046512 Bacteria 23824
255 Ga0495616_0002088 3300046513 Bacteria 13429
256 Ga0495628_0591863 3300046516 Bacteria 793
257 Ga0495631_0003005 3300046518 Bacteria 9331
258 Ga0495644_0000790 3300046523 Bacteria 13026
259 Ga0495648_0006718 3300046524 Bacteria 9305
260 Ga0495652_0263723 3300046529 Bacteria 1270
261 Ga0495654_0024729 3300046530 Bacteria 3100
262 Ga0495609_0008096 3300046538 Bacteria 5178
263 Ga0495633_0000006 3300046558 Bacteria 326774
264 Ga0495633_0005434 3300046558 Bacteria 7785
265 Ga0495633_0191023 3300046558 Bacteria 941
266 Ga0495668_0000011 3300046616 Bacteria 472186
267 Ga0495668_0249491 3300046616 Bacteria 972
268 Ga0495625_0000067 3300046660 Bacteria 171483
269 Ga0495625_0000462 3300046660 Bacteria 60985
270 Ga0495625_0000486 3300046660 Bacteria 59478
271 Ga0495661_0031292 3300046665 Bacteria 3379
272 Ga0495658_0360545 3300046683 Bacteria 924
273 Ga0495670_0099117 3300046691 Bacteria 1499
274 Ga0495671_0066962 3300046692 Bacteria 1767
275 Ga0495649_0000054 3300046694 Bacteria 107048
276 Ga0495649_0058062 3300046694 Bacteria 2086
277 Ga0495589_0085339 3300046794 Bacteria 1534
278 Ga0495660_0002682 3300046810 Bacteria 11256
279 Ga0495683_0018852 3300047323 Bacteria 3563
280 Ga0495687_001083 3300047443 Bacteria 26756
281 Ga0495687_002879 3300047443 Bacteria 13149
282 Ga0495687_036103 3300047443 Bacteria 2215
283 Ga0495677_0076055 3300047445 Bacteria 1255
284 Ga0495686_0001571 3300047472 Bacteria 24245
285 Ga0495686_0004631 3300047472 Bacteria 11183
286 Ga0495686_0035242 3300047472 Bacteria 3218
287 Ga0495614_0022639 3300048089 Bacteria 2711
288 Ga0495682_0023894 3300049460 Bacteria 2281
289 nmdc:mga0k408_22_c2 3300050493 Bacteria 93033
290 nmdc:mga0k408_626_c1 3300050493 Bacteria 19472
291 Ga0500635_0000482 3300053080 Bacteria 11190
292 Ga0500608_006782 3300053122 Bacteria 4693
293 Ga0500608_042233 3300053122 Bacteria 2188
294 Ga0500614_007798 3300053123 Bacteria 2262
295 Ga0500618_000148 3300053125 Bacteria 58264
296 Ga0500618_032934 3300053125 Bacteria 1210
297 Ga0500642_0026699 3300053130 Bacteria 2360
298 Ga0500624_002450 3300053157 Bacteria 2514
299 Ga0500634_0066997 3300053161 Bacteria 1890

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0013471 Ga0495606_0013471_332_997 201
2 3300046810 Ga0495660_0002682 Ga0495660_0002682_6919_7584 201
3 3300047472 Ga0495686_0001571 Ga0495686_0001571_3157_3912 203
4 3300005718 Ga0068866_10028077 Ga0068866_100280774 205
5 3300021361 Ga0213872_10059866 Ga0213872_100598662 205
6 3300028786 Ga0307517_10000553 Ga0307517_1000055315 205
7 3300033180 Ga0307510_10000172 Ga0307510_1000017212 205
8 3300039447 Ga0436361_0709938 Ga0436361_0709938_1269_1949 205
9 3300046507 Ga0495606_0320304 Ga0495606_0320304_74_754 205
10 3300046518 Ga0495631_0003005 Ga0495631_0003005_7400_8080 205
11 3300046694 Ga0495649_0058062 Ga0495649_0058062_521_1201 205
12 3300047323 Ga0495683_0018852 Ga0495683_0018852_1438_2118 205
13 3300053122 Ga0500608_006782 Ga0500608_006782_3093_3773 205
14 3300002077 JGI24744J21845_10000710 JGI24744J21845_100007102 206
15 3300005328 Ga0070676_10000133 Ga0070676_1000013325 206
16 3300005364 Ga0070673_100024633 Ga0070673_1000246335 206
17 3300005456 Ga0070678_100020119 Ga0070678_1000201193 206
18 3300005459 Ga0068867_100000624 Ga0068867_1000006242 206
19 3300005539 Ga0068853_100010556 Ga0068853_1000105567 206
20 3300005616 Ga0068852_100004529 Ga0068852_1000045296 206
21 3300005617 Ga0068859_101019803 Ga0068859_1010198031 206
22 3300006237 Ga0097621_100000205 Ga0097621_1000002055 206
23 3300006358 Ga0068871_100000162 Ga0068871_10000016225 206
24 3300006881 Ga0068865_100000075 Ga0068865_10000007518 206
25 3300006931 Ga0097620_101020174 Ga0097620_1010201741 206
26 3300009098 Ga0105245_10146520 Ga0105245_101465201 206
27 3300009098 Ga0105245_11110851 Ga0105245_111108511 206
28 3300009176 Ga0105242_10022443 Ga0105242_100224436 206
29 3300009545 Ga0105237_10000808 Ga0105237_1000080811 206
30 3300010375 Ga0105239_10010933 Ga0105239_100109335 206
31 3300010375 Ga0105239_10109872 Ga0105239_101098725 206
32 3300013296 Ga0157374_10001433 Ga0157374_100014336 206
33 3300013297 Ga0157378_10023282 Ga0157378_100232825 206
34 3300013307 Ga0157372_10104869 Ga0157372_101048692 206
35 3300025907 Ga0207645_10000014 Ga0207645_1000001456 206
36 3300025911 Ga0207654_10047718 Ga0207654_100477181 206
37 3300025914 Ga0207671_10001286 Ga0207671_100012867 206
38 3300025933 Ga0207706_10859602 Ga0207706_108596021 206
39 3300025934 Ga0207686_10031730 Ga0207686_100317303 206
40 3300025938 Ga0207704_10000118 Ga0207704_100001188 206
41 3300025960 Ga0207651_10010534 Ga0207651_100105344 206
42 3300026041 Ga0207639_10001022 Ga0207639_100010228 206
43 3300026089 Ga0207648_10000963 Ga0207648_1000096325 206
44 3300026121 Ga0207683_10002362 Ga0207683_100023623 206
45 3300026142 Ga0207698_10000733 Ga0207698_1000073312 206
46 3300046471 Ga0495650_0000225 Ga0495650_0000225_17441_18118 206
47 3300046506 Ga0495583_0035693 Ga0495583_0035693_50_727 206
48 3300046513 Ga0495616_0002088 Ga0495616_0002088_11259_11936 206
49 3300046660 Ga0495625_0000067 Ga0495625_0000067_78647_79324 206
50 3300046694 Ga0495649_0000054 Ga0495649_0000054_78658_79335 206
51 3300047443 Ga0495687_002879 Ga0495687_002879_8501_9181 206
52 3300009148 Ga0105243_10188655 Ga0105243_101886552 207
53 3300013306 Ga0163162_10139617 Ga0163162_101396172 207
54 3300025935 Ga0207709_10141689 Ga0207709_101416892 207
55 3300046492 Ga0495585_0000074 Ga0495585_0000074_36143_36820 207
56 3300046512 Ga0495610_0001170 Ga0495610_0001170_731_1408 207
57 3300046558 Ga0495633_0005434 Ga0495633_0005434_5103_5780 207
58 3300046665 Ga0495661_0031292 Ga0495661_0031292_196_873 207
59 3300046692 Ga0495671_0066962 Ga0495671_0066962_209_886 207
60 3300046794 Ga0495589_0085339 Ga0495589_0085339_90_767 207
61 3300047443 Ga0495687_001083 Ga0495687_001083_15679_16356 207
62 3300014969 Ga0157376_10006003 Ga0157376_100060032 208
63 3300026041 Ga0207639_10107339 Ga0207639_101073392 209
64 3300003320 rootH2_10024240 rootH2_1002424015 211
65 3300005288 Ga0065714_10121770 Ga0065714_101217702 211
66 3300053125 Ga0500618_032934 Ga0500618_032934_34_711 211
67 3300046471 Ga0495650_0080220 Ga0495650_0080220_46_834 214
68 3300009174 Ga0105241_10106365 Ga0105241_101063654 220
69 3300009174 Ga0105241_10325254 Ga0105241_103252542 220
70 3300053130 Ga0500642_0026699 Ga0500642_0026699_14_676 220
71 iso_pu_bacteria 2852623160 2852625718 220
72 iso_pu_bacteria 2884933994 2884935757 220
73 iso_pu_bacteria 2599185184 2599479986 221
74 iso_pu_bacteria 2928078545 2928081116 221
75 iso_pu_bacteria 2928147474 2928152463 221
76 iso_pu_bacteria 2932082852 2932087766 221
77 iso_pu_bacteria 2977232053 2977235572 221
78 3300026142 Ga0207698_10927771 Ga0207698_109277711 223
79 3300006195 Ga0075366_10001995 Ga0075366_100019956 224
80 3300025250 Ga0209026_1002625 Ga0209026_10026255 224
81 3300037418 Ga0395900_0000609 Ga0395900_0000609_23717_24391 224
82 3300045049 Ga0466959_0137652 Ga0466959_0137652_837_1511 224
83 3300050493 nmdc:mga0k408_626_c1 nmdc:mga0k408_626_c1_13208_13882 224
84 3300001904 JGI24736J21556_1001405 JGI24736J21556_10014056 225
85 3300001904 JGI24736J21556_1002231 JGI24736J21556_10022312 225
86 3300001915 JGI24741J21665_1029998 JGI24741J21665_10299981 225
87 3300001979 JGI24740J21852_10007444 JGI24740J21852_100074442 225
88 3300001979 JGI24740J21852_10027636 JGI24740J21852_100276362 225
89 3300001979 JGI24740J21852_10075028 JGI24740J21852_100750281 225
90 3300001990 JGI24737J22298_10000077 JGI24737J22298_100000779 225
91 3300001990 JGI24737J22298_10003409 JGI24737J22298_100034095 225
92 3300001990 JGI24737J22298_10006057 JGI24737J22298_100060575 225
93 3300002067 JGI24735J21928_10000005 JGI24735J21928_10000005120 225
94 3300002067 JGI24735J21928_10054258 JGI24735J21928_100542581 225
95 3300002077 JGI24744J21845_10024470 JGI24744J21845_100244702 225
96 3300002737 JGI25162J39368_1000563 JGI25162J39368_100056311 225
97 3300002737 JGI25162J39368_1000596 JGI25162J39368_100059613 225
98 3300002741 JGI25157J39369_1011860 JGI25157J39369_10118602 225
99 3300003214 JGI25165J46597_1000658 JGI25165J46597_10006585 225
100 3300003316 rootH1_10026072 rootH1_100260721 225
101 3300003316 rootH1_10155653 rootH1_101556531 225
102 3300003320 rootH2_10085495 rootH2_100854951 225
103 3300003323 rootH1_10005386 rootH1_1000538614 225
104 3300003323 rootH1_10006071 rootH1_100060714 225
105 3300005288 Ga0065714_10010854 Ga0065714_100108543 225
106 3300005288 Ga0065714_10091954 Ga0065714_100919542 225
107 3300005327 Ga0070658_10000236 Ga0070658_1000023625 225
108 3300005327 Ga0070658_10193326 Ga0070658_101933261 225
109 3300005329 Ga0070683_100012137 Ga0070683_1000121379 225
110 3300005336 Ga0070680_100001753 Ga0070680_1000017532 225
111 3300005339 Ga0070660_100112133 Ga0070660_1001121332 225
112 3300005339 Ga0070660_100365108 Ga0070660_1003651082 225
113 3300005339 Ga0070660_100545369 Ga0070660_1005453691 225
114 3300005356 Ga0070674_100057080 Ga0070674_1000570804 225
115 3300005366 Ga0070659_100000094 Ga0070659_1000000946 225
116 3300005366 Ga0070659_100467846 Ga0070659_1004678461 225
117 3300005455 Ga0070663_100010790 Ga0070663_1000107903 225
118 3300005457 Ga0070662_100000003 Ga0070662_100000003129 225
119 3300005458 Ga0070681_10323809 Ga0070681_103238092 225
120 3300005530 Ga0070679_100022268 Ga0070679_1000222684 225
121 3300005530 Ga0070679_100072018 Ga0070679_1000720181 225
122 3300005539 Ga0068853_100078882 Ga0068853_1000788822 225
123 3300005539 Ga0068853_100154590 Ga0068853_1001545902 225
124 3300005539 Ga0068853_100640486 Ga0068853_1006404862 225
125 3300005548 Ga0070665_100000212 Ga0070665_10000021235 225
126 3300005548 Ga0070665_100687427 Ga0070665_1006874272 225
127 3300005563 Ga0068855_100000127 Ga0068855_1000001277 225
128 3300005563 Ga0068855_100000201 Ga0068855_10000020116 225
129 3300005563 Ga0068855_100065287 Ga0068855_1000652872 225
130 3300005563 Ga0068855_100068031 Ga0068855_1000680312 225
131 3300005563 Ga0068855_100188330 Ga0068855_1001883303 225
132 3300005563 Ga0068855_100276231 Ga0068855_1002762314 225
133 3300005563 Ga0068855_100849101 Ga0068855_1008491012 225
134 3300005563 Ga0068855_101011822 Ga0068855_1010118222 225
135 3300005614 Ga0068856_100000036 Ga0068856_10000003698 225
136 3300005614 Ga0068856_100005050 Ga0068856_1000050508 225
137 3300005614 Ga0068856_100025384 Ga0068856_1000253847 225
138 3300005614 Ga0068856_100079116 Ga0068856_1000791162 225
139 3300005614 Ga0068856_100560146 Ga0068856_1005601462 225
140 3300005616 Ga0068852_100097077 Ga0068852_1000970775 225
141 3300005616 Ga0068852_100348586 Ga0068852_1003485861 225
142 3300005616 Ga0068852_100801263 Ga0068852_1008012631 225
143 3300005840 Ga0068870_10009317 Ga0068870_100093173 225
144 3300006195 Ga0075366_10005756 Ga0075366_100057568 225
145 3300006195 Ga0075366_10006727 Ga0075366_100067273 225
146 3300009093 Ga0105240_10030257 Ga0105240_100302574 225
147 3300009093 Ga0105240_10044696 Ga0105240_100446962 225
148 3300009093 Ga0105240_10046155 Ga0105240_100461554 225
149 3300009093 Ga0105240_10067821 Ga0105240_100678214 225
150 3300009093 Ga0105240_10075450 Ga0105240_100754502 225
151 3300009093 Ga0105240_10109684 Ga0105240_101096842 225
152 3300009093 Ga0105240_10604534 Ga0105240_106045342 225
153 3300009174 Ga0105241_10002920 Ga0105241_100029206 225
154 3300009174 Ga0105241_10400526 Ga0105241_104005261 225
155 3300009174 Ga0105241_10455376 Ga0105241_104553761 225
156 3300009176 Ga0105242_11049180 Ga0105242_110491801 225
157 3300009545 Ga0105237_10000620 Ga0105237_1000062026 225
158 3300009545 Ga0105237_10001785 Ga0105237_100017854 225
159 3300009545 Ga0105237_10134851 Ga0105237_101348514 225
160 3300009545 Ga0105237_10145580 Ga0105237_101455802 225
161 3300009545 Ga0105237_10328445 Ga0105237_103284453 225
162 3300010375 Ga0105239_10000008 Ga0105239_10000008165 225
163 3300010375 Ga0105239_10000045 Ga0105239_1000004529 225
164 3300010375 Ga0105239_10000446 Ga0105239_1000044657 225
165 3300010375 Ga0105239_10007945 Ga0105239_100079459 225
166 3300010375 Ga0105239_10018812 Ga0105239_100188126 225
167 3300013100 Ga0157373_10000091 Ga0157373_1000009152 225
168 3300013100 Ga0157373_10003653 Ga0157373_1000365310 225
169 3300013100 Ga0157373_10046956 Ga0157373_100469562 225
170 3300013102 Ga0157371_10000155 Ga0157371_1000015570 225
171 3300013102 Ga0157371_10002671 Ga0157371_100026714 225
172 3300013102 Ga0157371_10012104 Ga0157371_100121041 225
173 3300013102 Ga0157371_10037490 Ga0157371_100374902 225
174 3300013104 Ga0157370_10016345 Ga0157370_100163454 225
175 3300013104 Ga0157370_10143941 Ga0157370_101439412 225
176 3300013104 Ga0157370_10169028 Ga0157370_101690282 225
177 3300013104 Ga0157370_10205525 Ga0157370_102055252 225
178 3300013104 Ga0157370_10776520 Ga0157370_107765202 225
179 3300013105 Ga0157369_10001051 Ga0157369_1000105118 225
180 3300013105 Ga0157369_10092987 Ga0157369_100929875 225
181 3300013105 Ga0157369_10561862 Ga0157369_105618621 225
182 3300013296 Ga0157374_10012425 Ga0157374_100124256 225
183 3300013296 Ga0157374_10186435 Ga0157374_101864353 225
184 3300013297 Ga0157378_10018561 Ga0157378_100185614 225
185 3300013297 Ga0157378_10129359 Ga0157378_101293592 225
186 3300013306 Ga0163162_10000041 Ga0163162_1000004126 225
187 3300013306 Ga0163162_10005549 Ga0163162_1000554910 225
188 3300013307 Ga0157372_10000009 Ga0157372_1000000925 225
189 3300013307 Ga0157372_10002228 Ga0157372_100022287 225
190 3300013307 Ga0157372_10004603 Ga0157372_100046032 225
191 3300013307 Ga0157372_10007451 Ga0157372_100074518 225
192 3300013307 Ga0157372_10084880 Ga0157372_100848804 225
193 3300014325 Ga0163163_10846310 Ga0163163_108463101 225
194 3300025231 Ga0207427_100109 Ga0207427_10010925 225
195 3300025233 Ga0209437_100096 Ga0209437_100096132 225
196 3300025233 Ga0209437_100507 Ga0209437_10050724 225
197 3300025250 Ga0209026_1000225 Ga0209026_100022566 225
198 3300025261 Ga0209233_1000029 Ga0209233_1000029508 225
199 3300025261 Ga0209233_1000701 Ga0209233_100070116 225
200 3300025272 Ga0209455_1010103 Ga0209455_10101031 225
201 3300025904 Ga0207647_10000135 Ga0207647_1000013524 225
202 3300025904 Ga0207647_10000698 Ga0207647_1000069819 225
203 3300025904 Ga0207647_10021205 Ga0207647_100212056 225
204 3300025904 Ga0207647_10079357 Ga0207647_100793574 225
205 3300025909 Ga0207705_10000111 Ga0207705_1000011174 225
206 3300025909 Ga0207705_10294000 Ga0207705_102940001 225
207 3300025911 Ga0207654_10004371 Ga0207654_100043716 225
208 3300025911 Ga0207654_10043401 Ga0207654_100434012 225
209 3300025911 Ga0207654_10120813 Ga0207654_101208131 225
210 3300025912 Ga0207707_10031546 Ga0207707_100315466 225
211 3300025913 Ga0207695_10038681 Ga0207695_100386813 225
212 3300025913 Ga0207695_10063126 Ga0207695_100631263 225
213 3300025913 Ga0207695_10071078 Ga0207695_100710782 225
214 3300025913 Ga0207695_10267758 Ga0207695_102677581 225
215 3300025913 Ga0207695_10279728 Ga0207695_102797282 225
216 3300025913 Ga0207695_10802422 Ga0207695_108024221 225
217 3300025914 Ga0207671_10000899 Ga0207671_1000089920 225
218 3300025914 Ga0207671_10003474 Ga0207671_1000347413 225
219 3300025914 Ga0207671_10435518 Ga0207671_104355182 225
220 3300025914 Ga0207671_10441330 Ga0207671_104413301 225
221 3300025914 Ga0207671_10738135 Ga0207671_107381351 225
222 3300025917 Ga0207660_10280791 Ga0207660_102807911 225
223 3300025919 Ga0207657_10120521 Ga0207657_101205213 225
224 3300025919 Ga0207657_10327368 Ga0207657_103273682 225
225 3300025919 Ga0207657_10623106 Ga0207657_106231062 225
226 3300025921 Ga0207652_10256665 Ga0207652_102566651 225
227 3300025932 Ga0207690_10003190 Ga0207690_1000319010 225
228 3300025932 Ga0207690_10422177 Ga0207690_104221771 225
229 3300025933 Ga0207706_10000009 Ga0207706_10000009138 225
230 3300025944 Ga0207661_10112020 Ga0207661_101120202 225
231 3300025949 Ga0207667_10000236 Ga0207667_1000023645 225
232 3300025949 Ga0207667_10007060 Ga0207667_1000706012 225
233 3300025949 Ga0207667_10155865 Ga0207667_101558652 225
234 3300025949 Ga0207667_10200238 Ga0207667_102002382 225
235 3300025949 Ga0207667_10908167 Ga0207667_109081671 225
236 3300026041 Ga0207639_10040162 Ga0207639_100401624 225
237 3300026041 Ga0207639_10490480 Ga0207639_104904801 225
238 3300026067 Ga0207678_10168861 Ga0207678_101688612 225
239 3300026078 Ga0207702_10000088 Ga0207702_1000008816 225
240 3300026078 Ga0207702_10027913 Ga0207702_100279133 225
241 3300026078 Ga0207702_10052838 Ga0207702_100528382 225
242 3300026078 Ga0207702_10083373 Ga0207702_100833734 225
243 3300026078 Ga0207702_10424268 Ga0207702_104242681 225
244 3300026078 Ga0207702_10805457 Ga0207702_108054572 225
245 3300026116 Ga0207674_10045110 Ga0207674_100451106 225
246 3300026142 Ga0207698_10317769 Ga0207698_103177692 225
247 3300026142 Ga0207698_10337630 Ga0207698_103376302 225
248 3300028379 Ga0268266_10000177 Ga0268266_1000017783 225
249 3300028379 Ga0268266_10592910 Ga0268266_105929102 225
250 3300028794 Ga0307515_10000643 Ga0307515_1000064371 225
251 3300028794 Ga0307515_10024651 Ga0307515_100246516 225
252 3300028800 Ga0265338_10057975 Ga0265338_100579757 225
253 3300031507 Ga0307509_10030534 Ga0307509_100305345 225
254 3300031911 Ga0307412_10194773 Ga0307412_101947732 225
255 3300033179 Ga0307507_10014221 Ga0307507_1001422111 225
256 3300037312 Ga0395899_0000327 Ga0395899_0000327_33372_34052 225
257 3300037312 Ga0395899_0018626 Ga0395899_0018626_4406_5110 225
258 3300037312 Ga0395899_0019965 Ga0395899_0019965_4228_4905 225
259 3300037418 Ga0395900_0000197 Ga0395900_0000197_4614_5291 225
260 3300037418 Ga0395900_0094978 Ga0395900_0094978_2029_2733 225
261 3300037418 Ga0395900_0231547 Ga0395900_0231547_520_1197 225
262 3300037466 Ga0395898_0466440 Ga0395898_0466440_73_750 225
263 3300037471 Ga0395905_0000186 Ga0395905_0000186_97370_98047 225
264 3300037471 Ga0395905_0003273 Ga0395905_0003273_14121_14825 225
265 3300038443 Ga0395901_0000368 Ga0395901_0000368_52164_52841 225
266 3300038443 Ga0395901_0008274 Ga0395901_0008274_5539_6243 225
267 3300038443 Ga0395901_0314993 Ga0395901_0314993_907_1587 225
268 3300038443 Ga0395901_0428041 Ga0395901_0428041_548_1225 225
269 3300041486 Ga0451807_0115040 Ga0451807_0115040_484_1161 225
270 3300042012 Ga0439455_0011503 Ga0439455_0011503_33_710 225
271 3300044656 Ga0466969_0070955 Ga0466969_0070955_271_951 225
272 3300044684 Ga0466966_0048533 Ga0466966_0048533_293_973 225
273 3300044693 Ga0466961_0069557 Ga0466961_0069557_991_1671 225
274 3300045049 Ga0466959_0050418 Ga0466959_0050418_1941_2621 225
275 3300045836 Ga0466958_0014504 Ga0466958_0014504_2465_3145 225
276 3300046492 Ga0495585_0000323 Ga0495585_0000323_32481_33158 225
277 3300046507 Ga0495606_0000074 Ga0495606_0000074_141546_142223 225
278 3300046507 Ga0495606_0010496 Ga0495606_0010496_505_1182 225
279 3300046507 Ga0495606_0051265 Ga0495606_0051265_466_1143 225
280 3300046516 Ga0495628_0591863 Ga0495628_0591863_80_757 225
281 3300046523 Ga0495644_0000790 Ga0495644_0000790_6613_7290 225
282 3300046524 Ga0495648_0006718 Ga0495648_0006718_1752_2429 225
283 3300046529 Ga0495652_0263723 Ga0495652_0263723_249_926 225
284 3300046530 Ga0495654_0024729 Ga0495654_0024729_474_1151 225
285 3300046538 Ga0495609_0008096 Ga0495609_0008096_524_1201 225
286 3300046558 Ga0495633_0000006 Ga0495633_0000006_246653_247330 225
287 3300046558 Ga0495633_0191023 Ga0495633_0191023_57_734 225
288 3300046616 Ga0495668_0000011 Ga0495668_0000011_221975_222652 225
289 3300046616 Ga0495668_0249491 Ga0495668_0249491_206_883 225
290 3300046660 Ga0495625_0000462 Ga0495625_0000462_49509_50186 225
291 3300046660 Ga0495625_0000486 Ga0495625_0000486_6133_6810 225
292 3300046683 Ga0495658_0360545 Ga0495658_0360545_165_842 225
293 3300046691 Ga0495670_0099117 Ga0495670_0099117_583_1260 225
294 3300047443 Ga0495687_036103 Ga0495687_036103_1026_1703 225
295 3300047445 Ga0495677_0076055 Ga0495677_0076055_14_691 225
296 3300047472 Ga0495686_0004631 Ga0495686_0004631_9069_9749 225
297 3300047472 Ga0495686_0035242 Ga0495686_0035242_645_1322 225
298 3300048089 Ga0495614_0022639 Ga0495614_0022639_1716_2393 225
299 3300049460 Ga0495682_0023894 Ga0495682_0023894_256_933 225
300 3300050493 nmdc:mga0k408_22_c2 nmdc:mga0k408_22_c2_23068_23745 225
301 3300053080 Ga0500635_0000482 Ga0500635_0000482_3956_4633 225
302 3300053122 Ga0500608_042233 Ga0500608_042233_1134_1811 225
303 3300053123 Ga0500614_007798 Ga0500614_007798_1515_2192 225
304 3300053125 Ga0500618_000148 Ga0500618_000148_6796_7473 225
305 3300053157 Ga0500624_002450 Ga0500624_002450_1602_2279 225
306 3300053161 Ga0500634_0066997 Ga0500634_0066997_409_1086 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13174

TPR_6

Tetratricopeptide repeat

206

234

0.98

PF13174

TPR_6

Tetratricopeptide repeat

141

178

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vl6-assembly1.cif.gz_B de novo designed tetrahedral nanoparticle t33_dn2 presenting bg505 sosip trimers 0.9018 103 199
8fwd-assembly1.cif.gz_2 fast and versatile sequence- independent protein docking for nanomaterials design using rpxdock 0.8999 103 197
8fwd-assembly1.cif.gz_P fast and versatile sequence- independent protein docking for nanomaterials design using rpxdock 0.8986 103 197
8fwd-assembly1.cif.gz_L fast and versatile sequence- independent protein docking for nanomaterials design using rpxdock 0.8937 103 197
8fwd-assembly1.cif.gz_1 fast and versatile sequence- independent protein docking for nanomaterials design using rpxdock 0.8801 60 208
ID Description Score Start End Superfamily
af_Q5ZBW3_76_160_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9073 103 170 1.25.40.10
af_K7DY99_481_795_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8805 60 202 1.25.40.10
af_B4FDG5_174_307_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8781 75 197 1.25.40.10
af_O94826_105_217_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8753 103 199 1.25.40.10
af_Q4D833_63_177_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8739 103 199 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A4U1C068-F1-model_v4 Tetratricopeptide repeat protein 0.9839 14 225 GO:0016020
AF-A0A7W1PS50-F1-model_v4 Tetratricopeptide repeat protein 0.9826 15 224 GO:0016020
AF-A0A2N5YTL4-F1-model_v4 Uncharacterized protein 0.9815 103 225
AF-A0A520CN01-F1-model_v4 Tetratricopeptide repeat protein 0.9807 41 225
AF-X1UZV7-F1-model_v4 Uncharacterized protein 0.9806 61 224

Feature Viewer

pLDDT pTM Quality
86.88 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map