F398749

General Info

Members Datasets Scaffolds Average Seq Length
306 188 612 77

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_101356210|Ga0307416_1013562102
Length 86
Sequence VSANKAGRGPVRRPFTREQRTTIIYGMLAFILILVILQLWLLTATMNAYLGGDEAVIWPAAAASMFCLLLNAGLLRYLYYIERVRR

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
147 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
169 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
188 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 0
Rhizosphere 98.69
Stem 0
Stem Tuber 0
Unclassified 24.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_101356210 3300032002 Bacteria 817
2 MBSR1b_contig_3325057 2162886012 Unclassified 915
3 Ga0065707_10472318 3300005295 Bacteria 781
4 Ga0065707_11069021 3300005295 Bacteria 522
5 Ga0070670_100129959 3300005331 Bacteria 2175
6 Ga0070670_100441771 3300005331 Bacteria 1152
7 Ga0070670_100606332 3300005331 Bacteria 980
8 Ga0070666_10212539 3300005335 Bacteria 1363
9 Ga0070689_100642858 3300005340 Bacteria 922
10 Ga0070691_10001764 3300005341 Bacteria 9412
11 Ga0070687_100142294 3300005343 Bacteria 1398
12 Ga0070668_100984747 3300005347 Unclassified 757
13 Ga0070669_100998199 3300005353 Bacteria 718
14 Ga0070669_101223678 3300005353 Bacteria 649
15 Ga0070669_101238654 3300005353 Bacteria 645
16 Ga0070669_101310349 3300005353 Bacteria 627
17 Ga0070669_101799429 3300005353 Bacteria 534
18 Ga0070675_100139050 3300005354 Bacteria 2075
19 Ga0070675_100372718 3300005354 Bacteria 1269
20 Ga0070675_100965272 3300005354 Bacteria 782
21 Ga0070675_101341865 3300005354 Unclassified 659
22 Ga0070671_100529420 3300005355 Unclassified 1015
23 Ga0070671_100539166 3300005355 Unclassified 1006
24 Ga0070671_101337324 3300005355 Unclassified 632
25 Ga0070674_101046733 3300005356 Unclassified 718
26 Ga0070673_100368892 3300005364 Bacteria 1278
27 Ga0070688_100935807 3300005365 Bacteria 685
28 Ga0070659_101251398 3300005366 Bacteria 657
29 Ga0070667_100173051 3300005367 Bacteria 1907
30 Ga0070667_101038588 3300005367 Unclassified 765
31 Ga0070714_100005531 3300005435 Bacteria 9649
32 Ga0070714_100209508 3300005435 Unclassified 1786
33 Ga0070714_100491788 3300005435 Bacteria 1169
34 Ga0070701_10239213 3300005438 Bacteria 1091
35 Ga0070701_10566648 3300005438 Bacteria 747
36 Ga0070701_11012567 3300005438 Unclassified 580
37 Ga0070705_100055886 3300005440 Bacteria 2322
38 Ga0070705_101623359 3300005440 Unclassified 545
39 Ga0070700_100008636 3300005441 Bacteria 5553
40 Ga0070700_100558813 3300005441 Bacteria 890
41 Ga0070700_100597232 3300005441 Bacteria 864
42 Ga0070694_100408844 3300005444 Bacteria 1064
43 Ga0068867_100254628 3300005459 Bacteria 1429
44 Ga0070698_101026811 3300005471 Bacteria 772
45 Ga0070699_101375692 3300005518 Unclassified 647
46 Ga0070672_100192159 3300005543 Bacteria 1705
47 Ga0070672_100674370 3300005543 Bacteria 904
48 Ga0070672_102158379 3300005543 Unclassified 502
49 Ga0070686_101724375 3300005544 Unclassified 532
50 Ga0070695_100904479 3300005545 Bacteria 713
51 Ga0070696_100057800 3300005546 Bacteria 2707
52 Ga0070665_101426277 3300005548 Unclassified 701
53 Ga0070665_101579418 3300005548 Bacteria 664
54 Ga0070704_100341386 3300005549 Bacteria 1261
55 Ga0070704_100896981 3300005549 Unclassified 797
56 Ga0068855_100479867 3300005563 Unclassified 1353
57 Ga0068855_102164125 3300005563 Bacteria 559
58 Ga0070664_100103849 3300005564 Archaea 2474
59 Ga0068854_100677433 3300005578 Bacteria 888
60 Ga0068856_100336965 3300005614 Unclassified 1526
61 Ga0070702_100516319 3300005615 Unclassified 880
62 Ga0068859_102422268 3300005617 Bacteria 578
63 Ga0068864_102162775 3300005618 Bacteria 563
64 Ga0068861_100010652 3300005719 Bacteria 6385
65 Ga0068861_100443976 3300005719 Bacteria 1161
66 Ga0068861_101143122 3300005719 Unclassified 750
67 Ga0068861_101360128 3300005719 Bacteria 692
68 Ga0068861_101492025 3300005719 Bacteria 663
69 Ga0068861_102554995 3300005719 Unclassified 514
70 Ga0068863_100064197 3300005841 Bacteria 3473
71 Ga0068860_100307052 3300005843 Bacteria 1555
72 Ga0068860_101967982 3300005843 Unclassified 606
73 Ga0068862_100281322 3300005844 Bacteria 1525
74 Ga0068862_100876189 3300005844 Bacteria 881
75 Ga0068862_102668238 3300005844 Unclassified 511
76 Ga0068871_102085427 3300006358 Bacteria 540
77 Ga0075431_100627133 3300006847 Bacteria 1057
78 Ga0075429_101200676 3300006880 Bacteria 662
79 Ga0068865_100867058 3300006881 Unclassified 783
80 Ga0075436_101486196 3300006914 Unclassified 514
81 Ga0097620_102421199 3300006931 Bacteria 578
82 Ga0105240_10219420 3300009093 Bacteria 2216
83 Ga0105240_10349270 3300009093 Bacteria 1678
84 Ga0111539_10134807 3300009094 Bacteria 2892
85 Ga0111539_12214467 3300009094 Bacteria 638
86 Ga0105245_10000186 3300009098 Bacteria 58710
87 Ga0105247_10231357 3300009101 Bacteria 1255
88 Ga0105241_12464326 3300009174 Unclassified 520
89 Ga0105248_10199076 3300009177 Bacteria 2257
90 Ga0105248_10341786 3300009177 Bacteria 1685
91 Ga0105248_13241137 3300009177 Unclassified 518
92 Ga0105249_11043992 3300009553 Bacteria 887
93 Ga0105246_10617049 3300011119 Unclassified 939
94 Ga0157373_10296044 3300013100 Unclassified 1148
95 Ga0157370_10088419 3300013104 Unclassified 2910
96 Ga0157369_10300130 3300013105 Bacteria 1671
97 Ga0157369_10349668 3300013105 Bacteria 1535
98 Ga0157369_10775295 3300013105 Bacteria 986
99 Ga0157369_12238662 3300013105 Bacteria 554
100 Ga0157374_10117311 3300013296 Bacteria 2565
101 Ga0157378_11468063 3300013297 Bacteria 726
102 Ga0163162_10012824 3300013306 Bacteria 8186
103 Ga0163162_12462268 3300013306 Bacteria 598
104 Ga0163162_13280079 3300013306 Unclassified 518
105 Ga0157372_10070680 3300013307 Bacteria 3928
106 Ga0157372_10569695 3300013307 Bacteria 1320
107 Ga0157372_10728313 3300013307 Unclassified 1153
108 Ga0157372_10833415 3300013307 Bacteria 1071
109 Ga0157375_10549189 3300013308 Bacteria 1317
110 Ga0163163_12330557 3300014325 Unclassified 594
111 Ga0157380_10188365 3300014326 Bacteria 1819
112 Ga0157380_11801825 3300014326 Bacteria 671
113 Ga0157377_10749684 3300014745 Bacteria 714
114 Ga0207688_10924301 3300025901 Unclassified 552
115 Ga0207680_10365805 3300025903 Unclassified 1015
116 Ga0207645_10012483 3300025907 Bacteria 5761
117 Ga0207707_10301103 3300025912 Bacteria 1386
118 Ga0207695_10002596 3300025913 Bacteria 26488
119 Ga0207695_10078005 3300025913 Bacteria 3362
120 Ga0207660_10064674 3300025917 Bacteria 2641
121 Ga0207662_10171225 3300025918 Bacteria 1392
122 Ga0207662_10195724 3300025918 Unclassified 1306
123 Ga0207662_11029190 3300025918 Bacteria 585
124 Ga0207652_10064367 3300025921 Bacteria 3172
125 Ga0207646_11753734 3300025922 Bacteria 532
126 Ga0207681_10533289 3300025923 Bacteria 964
127 Ga0207681_10569063 3300025923 Unclassified 934
128 Ga0207681_11230765 3300025923 Unclassified 629
129 Ga0207681_11378608 3300025923 Bacteria 592
130 Ga0207650_10085863 3300025925 Bacteria 2395
131 Ga0207650_10351112 3300025925 Bacteria 1213
132 Ga0207659_10000080 3300025926 Bacteria 60332
133 Ga0207659_10086616 3300025926 Bacteria 2330
134 Ga0207659_10184500 3300025926 Bacteria 1655
135 Ga0207659_10307353 3300025926 Bacteria 1304
136 Ga0207659_10535023 3300025926 Bacteria 995
137 Ga0207687_10000725 3300025927 Bacteria 22382
138 Ga0207664_10139265 3300025929 Bacteria 2051
139 Ga0207644_11722984 3300025931 Bacteria 525
140 Ga0207690_11565081 3300025932 Bacteria 551
141 Ga0207706_10474311 3300025933 Unclassified 1081
142 Ga0207670_10539391 3300025936 Unclassified 952
143 Ga0207670_10560061 3300025936 Bacteria 935
144 Ga0207704_10934884 3300025938 Unclassified 731
145 Ga0207691_10325922 3300025940 Bacteria 1316
146 Ga0207711_11100516 3300025941 Unclassified 735
147 Ga0207679_10599699 3300025945 Unclassified 992
148 Ga0207667_10775555 3300025949 Unclassified 957
149 Ga0207651_10364404 3300025960 Bacteria 1221
150 Ga0207712_10858512 3300025961 Unclassified 800
151 Ga0207712_10969983 3300025961 Bacteria 753
152 Ga0207668_10955583 3300025972 Unclassified 764
153 Ga0207640_12096271 3300025981 Bacteria 513
154 Ga0207658_10328008 3300025986 Bacteria 1327
155 Ga0207703_11584927 3300026035 Unclassified 630
156 Ga0207708_10014645 3300026075 Bacteria 5869
157 Ga0207708_11403761 3300026075 Bacteria 613
158 Ga0207708_11649925 3300026075 Unclassified 563
159 Ga0207641_10206350 3300026088 Bacteria 1815
160 Ga0207648_10009113 3300026089 Bacteria 9540
161 Ga0207676_10902261 3300026095 Bacteria 867
162 Ga0207675_100057364 3300026118 Bacteria 3633
163 Ga0207675_102231504 3300026118 Bacteria 562
164 Ga0207675_102246058 3300026118 Unclassified 560
165 Ga0207675_102420875 3300026118 Bacteria 537
166 Ga0207683_11582622 3300026121 Bacteria 604
167 Ga0207428_10051568 3300027907 Bacteria 3289
168 Ga0268266_11180580 3300028379 Unclassified 740
169 Ga0268266_11399026 3300028379 Unclassified 675
170 Ga0268265_10299642 3300028380 Bacteria 1447
171 Ga0268264_12042413 3300028381 Unclassified 582
172 Ga0307405_10112084 3300031731 Bacteria 1850
173 Ga0307413_10219256 3300031824 Bacteria 1388
174 Ga0307410_10800768 3300031852 Bacteria 801
175 Ga0307410_11555096 3300031852 Unclassified 584
176 Ga0307406_11286758 3300031901 Bacteria 638
177 Ga0307407_10733626 3300031903 Bacteria 747
178 Ga0307412_10430358 3300031911 Bacteria 1082
179 Ga0307412_10451284 3300031911 Bacteria 1059
180 Ga0307409_100097276 3300031995 Bacteria 2431
181 Ga0307409_100438292 3300031995 Bacteria 1258
182 Ga0307409_100911798 3300031995 Bacteria 893
183 Ga0307416_100078495 3300032002 Bacteria 2778
184 Ga0307416_100147117 3300032002 Bacteria 2153
185 Ga0307416_101503610 3300032002 Bacteria 779
186 Ga0307414_10167724 3300032004 Bacteria 1752
187 Ga0307411_10080593 3300032005 Bacteria 2239
188 Ga0307411_11551235 3300032005 Bacteria 610
189 Ga0307415_100393894 3300032126 Bacteria 1180
190 Ga0307415_100992870 3300032126 Unclassified 780
191 Ga0373948_0006201 3300034817 Bacteria 1969
192 Ga0373923_0254368 3300035111 Bacteria 823
193 Ga0373956_0112575 3300035119 Bacteria 1268
194 Ga0373937_0062585 3300036401 Bacteria 3421
195 Ga0373937_0613493 3300036401 Bacteria 1033
196 Ga0373925_1692137 3300037068 Unclassified 517
197 Ga0451853_1202376 3300041512 Bacteria 736
198 Ga0439435_0006464 3300042436 Bacteria 2635
199 Ga0495592_0682072 3300046454 Bacteria 620
200 Ga0495603_0403333 3300046455 Unclassified 784
201 Ga0495629_0507920 3300046459 Bacteria 812
202 Ga0495653_0513360 3300046463 Bacteria 746
203 Ga0495639_0057532 3300046475 Bacteria 1777
204 Ga0495618_0258664 3300046514 Bacteria 1090
205 Ga0495618_0465544 3300046514 Unclassified 766
206 Ga0495628_0727762 3300046516 Bacteria 699
207 Ga0495640_0105522 3300046533 Archaea 1846
208 Ga0495640_0448909 3300046533 Bacteria 788
209 Ga0495587_0630982 3300046536 Bacteria 589
210 Ga0495667_0169060 3300046559 Bacteria 1405
211 Ga0495667_1001454 3300046559 Unclassified 510
212 Ga0495634_0209552 3300046642 Bacteria 1207
213 Ga0495635_0103169 3300046663 Bacteria 1949
214 Ga0495635_0186516 3300046663 Archaea 1409
215 Ga0495599_0599005 3300046678 Bacteria 642
216 Ga0495658_0257363 3300046683 Bacteria 1098
217 Ga0495613_0134204 3300046689 Archaea 1772
218 Ga0495600_0749315 3300046809 Bacteria 585
219 Ga0495581_0431691 3300047315 Bacteria 768
220 Ga0495604_0046764 3300047317 Bacteria 3374
221 Ga0495604_0101903 3300047317 Bacteria 2108
222 Ga0495674_0861523 3300047319 Unclassified 701
223 Ga0495674_1187984 3300047319 Unclassified 577
224 Ga0495675_0206808 3300047444 Bacteria 1193
225 Ga0495675_0791135 3300047444 Unclassified 526
226 Ga0495684_0014303 3300047471 Bacteria 6109
227 Ga0495684_0400449 3300047471 Bacteria 964
228 Ga0495602_0274789 3300048088 Bacteria 1244
229 Ga0501298_092819 3300049521 Bacteria 679
230 Ga0501299_044676 3300049522 Unclassified 899
231 Ga0501033_0121637 3300049570 Bacteria 1894
232 Ga0501034_0014249 3300049571 Bacteria 8196
233 Ga0501034_0303171 3300049571 Bacteria 1534
234 Ga0501034_1559036 3300049571 Bacteria 534
235 Ga0501036_0016068 3300049572 Bacteria 6254
236 Ga0501037_0008278 3300049573 Bacteria 7624
237 Ga0501037_0534297 3300049573 Bacteria 793
238 Ga0501038_0098335 3300049574 Bacteria 2440
239 Ga0501039_0268375 3300049575 Bacteria 1341
240 Ga0501040_0001996 3300049576 Bacteria 13159
241 Ga0501040_0183808 3300049576 Bacteria 1482
242 Ga0501041_0005352 3300049577 Bacteria 7514
243 Ga0501041_0248591 3300049577 Unclassified 1118
244 Ga0501042_0129906 3300049578 Bacteria 1815
245 Ga0501043_0021200 3300049579 Bacteria 5094
246 Ga0501046_0122994 3300049580 Bacteria 1973
247 Ga0501047_0012159 3300049581 Bacteria 8147
248 Ga0501047_0056381 3300049581 Bacteria 3799
249 Ga0501047_0170649 3300049581 Bacteria 2044
250 Ga0501048_0643017 3300049582 Archaea 761
251 Ga0501048_1281586 3300049582 Unclassified 527
252 Ga0501068_0074502 3300049584 Bacteria 2075
253 Ga0501070_0073955 3300049586 Bacteria 2820
254 Ga0501070_0074219 3300049586 Bacteria 2816
255 Ga0501070_0109436 3300049586 Bacteria 2283
256 Ga0501070_0821567 3300049586 Unclassified 729
257 Ga0501070_1029036 3300049586 Bacteria 638
258 Ga0501072_0113786 3300049588 Bacteria 2154
259 Ga0501074_0059480 3300049590 Bacteria 2753
260 Ga0501074_0060969 3300049590 Bacteria 2718
261 Ga0501074_0075855 3300049590 Bacteria 2414
262 Ga0501074_0918817 3300049590 Unclassified 616
263 Ga0501075_0003616 3300049591 Bacteria 10368
264 Ga0501075_0071624 3300049591 Bacteria 2620
265 Ga0501075_1517497 3300049591 Unclassified 507
266 Ga0501076_0000714 3300049592 Bacteria 21429
267 Ga0501076_0005455 3300049592 Bacteria 9152
268 Ga0501077_0349552 3300049593 Unclassified 943
269 Ga0501077_0680747 3300049593 Unclassified 661
270 Ga0501207_070610 3300049654 Bacteria 655
271 Ga0501235_151274 3300049669 Bacteria 601
272 Ga0501079_0011475 3300049741 Bacteria 6763
273 Ga0501080_0060052 3300049742 Bacteria 3538
274 Ga0501080_0071633 3300049742 Bacteria 3224
275 Ga0501080_0226803 3300049742 Bacteria 1708
276 Ga0501081_0008125 3300049743 Bacteria 6811
277 Ga0501081_0016525 3300049743 Bacteria 4879
278 Ga0501081_0937335 3300049743 Unclassified 653
279 Ga0501083_0076218 3300049744 Bacteria 2226
280 Ga0501035_0084836 3300049822 Bacteria 2793
281 Ga0501035_0455860 3300049822 Unclassified 1057
282 Ga0501044_0000230 3300049823 Bacteria 70210
283 Ga0501044_0005183 3300049823 Bacteria 14507
284 Ga0501044_0009239 3300049823 Bacteria 10766
285 Ga0501045_0037192 3300049824 Bacteria 3538
286 Ga0501045_0056715 3300049824 Bacteria 2865
287 nmdc:mga03683_389467_c1 3300050489 Bacteria 664
288 nmdc:mga0yw44_1217540_c1 3300050492 Bacteria 508
289 nmdc:mga0qj67_350395_c1 3300050509 Bacteria 1194
290 nmdc:mga06r32_375132_c1 3300050510 Bacteria 1405
291 Ga0495601_0413770 3300053077 Bacteria 873
292 Ga0495619_0061619 3300053085 Bacteria 2496
293 Ga0495619_0117599 3300053085 Bacteria 1821
294 Ga0495619_0562063 3300053085 Bacteria 782
295 Ga0501084_0021649 3300054114 Bacteria 5360
296 Ga0501084_0128502 3300054114 Bacteria 2133
297 Ga0501084_0627401 3300054114 Bacteria 908
298 Ga0501084_1107097 3300054114 Bacteria 665
299 Ga0590071_159303 3300059421 Unclassified 587
300 Ga0590075_209076 3300059424 Unclassified 517
301 Ga0501082_0033801 3300060353 Bacteria 4410
302 Ga0501082_0059943 3300060353 Bacteria 3279
303 Ga0530510_0010870 3300061734 Bacteria 6386
304 Ga0530510_0315915 3300061734 Bacteria 1170
305 Ga0530510_0881230 3300061734 Unclassified 684
306 2688067626 2687453257 Bacteria 6784659
307 Ga0307416_101356210
308 MBSR1b_contig_3325057
309 Ga0065707_10472318
310 Ga0065707_11069021
311 Ga0070670_100129959
312 Ga0070670_100441771
313 Ga0070670_100606332
314 Ga0070666_10212539
315 Ga0070689_100642858
316 Ga0070691_10001764
317 Ga0070687_100142294
318 Ga0070668_100984747
319 Ga0070669_100998199
320 Ga0070669_101223678
321 Ga0070669_101238654
322 Ga0070669_101310349
323 Ga0070669_101799429
324 Ga0070675_100139050
325 Ga0070675_100372718
326 Ga0070675_100965272
327 Ga0070675_101341865
328 Ga0070671_100529420
329 Ga0070671_100539166
330 Ga0070671_101337324
331 Ga0070674_101046733
332 Ga0070673_100368892
333 Ga0070688_100935807
334 Ga0070659_101251398
335 Ga0070667_100173051
336 Ga0070667_101038588
337 Ga0070714_100005531
338 Ga0070714_100209508
339 Ga0070714_100491788
340 Ga0070701_10239213
341 Ga0070701_10566648
342 Ga0070701_11012567
343 Ga0070705_100055886
344 Ga0070705_101623359
345 Ga0070700_100008636
346 Ga0070700_100558813
347 Ga0070700_100597232
348 Ga0070694_100408844
349 Ga0068867_100254628
350 Ga0070698_101026811
351 Ga0070699_101375692
352 Ga0070672_100192159
353 Ga0070672_100674370
354 Ga0070672_102158379
355 Ga0070686_101724375
356 Ga0070695_100904479
357 Ga0070696_100057800
358 Ga0070665_101426277
359 Ga0070665_101579418
360 Ga0070704_100341386
361 Ga0070704_100896981
362 Ga0068855_100479867
363 Ga0068855_102164125
364 Ga0070664_100103849
365 Ga0068854_100677433
366 Ga0068856_100336965
367 Ga0070702_100516319
368 Ga0068859_102422268
369 Ga0068864_102162775
370 Ga0068861_100010652
371 Ga0068861_100443976
372 Ga0068861_101143122
373 Ga0068861_101360128
374 Ga0068861_101492025
375 Ga0068861_102554995
376 Ga0068863_100064197
377 Ga0068860_100307052
378 Ga0068860_101967982
379 Ga0068862_100281322
380 Ga0068862_100876189
381 Ga0068862_102668238
382 Ga0068871_102085427
383 Ga0075431_100627133
384 Ga0075429_101200676
385 Ga0068865_100867058
386 Ga0075436_101486196
387 Ga0097620_102421199
388 Ga0105240_10219420
389 Ga0105240_10349270
390 Ga0111539_10134807
391 Ga0111539_12214467
392 Ga0105245_10000186
393 Ga0105247_10231357
394 Ga0105241_12464326
395 Ga0105248_10199076
396 Ga0105248_10341786
397 Ga0105248_13241137
398 Ga0105249_11043992
399 Ga0105246_10617049
400 Ga0157373_10296044
401 Ga0157370_10088419
402 Ga0157369_10300130
403 Ga0157369_10349668
404 Ga0157369_10775295
405 Ga0157369_12238662
406 Ga0157374_10117311
407 Ga0157378_11468063
408 Ga0163162_10012824
409 Ga0163162_12462268
410 Ga0163162_13280079
411 Ga0157372_10070680
412 Ga0157372_10569695
413 Ga0157372_10728313
414 Ga0157372_10833415
415 Ga0157375_10549189
416 Ga0163163_12330557
417 Ga0157380_10188365
418 Ga0157380_11801825
419 Ga0157377_10749684
420 Ga0207688_10924301
421 Ga0207680_10365805
422 Ga0207645_10012483
423 Ga0207707_10301103
424 Ga0207695_10002596
425 Ga0207695_10078005
426 Ga0207660_10064674
427 Ga0207662_10171225
428 Ga0207662_10195724
429 Ga0207662_11029190
430 Ga0207652_10064367
431 Ga0207646_11753734
432 Ga0207681_10533289
433 Ga0207681_10569063
434 Ga0207681_11230765
435 Ga0207681_11378608
436 Ga0207650_10085863
437 Ga0207650_10351112
438 Ga0207659_10000080
439 Ga0207659_10086616
440 Ga0207659_10184500
441 Ga0207659_10307353
442 Ga0207659_10535023
443 Ga0207687_10000725
444 Ga0207664_10139265
445 Ga0207644_11722984
446 Ga0207690_11565081
447 Ga0207706_10474311
448 Ga0207670_10539391
449 Ga0207670_10560061
450 Ga0207704_10934884
451 Ga0207691_10325922
452 Ga0207711_11100516
453 Ga0207679_10599699
454 Ga0207667_10775555
455 Ga0207651_10364404
456 Ga0207712_10858512
457 Ga0207712_10969983
458 Ga0207668_10955583
459 Ga0207640_12096271
460 Ga0207658_10328008
461 Ga0207703_11584927
462 Ga0207708_10014645
463 Ga0207708_11403761
464 Ga0207708_11649925
465 Ga0207641_10206350
466 Ga0207648_10009113
467 Ga0207676_10902261
468 Ga0207675_100057364
469 Ga0207675_102231504
470 Ga0207675_102246058
471 Ga0207675_102420875
472 Ga0207683_11582622
473 Ga0207428_10051568
474 Ga0268266_11180580
475 Ga0268266_11399026
476 Ga0268265_10299642
477 Ga0268264_12042413
478 Ga0307405_10112084
479 Ga0307413_10219256
480 Ga0307410_10800768
481 Ga0307410_11555096
482 Ga0307406_11286758
483 Ga0307407_10733626
484 Ga0307412_10430358
485 Ga0307412_10451284
486 Ga0307409_100097276
487 Ga0307409_100438292
488 Ga0307409_100911798
489 Ga0307416_100078495
490 Ga0307416_100147117
491 Ga0307416_101503610
492 Ga0307414_10167724
493 Ga0307411_10080593
494 Ga0307411_11551235
495 Ga0307415_100393894
496 Ga0307415_100992870
497 Ga0373948_0006201
498 Ga0373923_0254368
499 Ga0373956_0112575
500 Ga0373937_0062585
501 Ga0373937_0613493
502 Ga0373925_1692137
503 Ga0451853_1202376
504 Ga0439435_0006464
505 Ga0495592_0682072
506 Ga0495603_0403333
507 Ga0495629_0507920
508 Ga0495653_0513360
509 Ga0495639_0057532
510 Ga0495618_0258664
511 Ga0495618_0465544
512 Ga0495628_0727762
513 Ga0495640_0105522
514 Ga0495640_0448909
515 Ga0495587_0630982
516 Ga0495667_0169060
517 Ga0495667_1001454
518 Ga0495634_0209552
519 Ga0495635_0103169
520 Ga0495635_0186516
521 Ga0495599_0599005
522 Ga0495658_0257363
523 Ga0495613_0134204
524 Ga0495600_0749315
525 Ga0495581_0431691
526 Ga0495604_0046764
527 Ga0495604_0101903
528 Ga0495674_0861523
529 Ga0495674_1187984
530 Ga0495675_0206808
531 Ga0495675_0791135
532 Ga0495684_0014303
533 Ga0495684_0400449
534 Ga0495602_0274789
535 Ga0501298_092819
536 Ga0501299_044676
537 Ga0501033_0121637
538 Ga0501034_0014249
539 Ga0501034_0303171
540 Ga0501034_1559036
541 Ga0501036_0016068
542 Ga0501037_0008278
543 Ga0501037_0534297
544 Ga0501038_0098335
545 Ga0501039_0268375
546 Ga0501040_0001996
547 Ga0501040_0183808
548 Ga0501041_0005352
549 Ga0501041_0248591
550 Ga0501042_0129906
551 Ga0501043_0021200
552 Ga0501046_0122994
553 Ga0501047_0012159
554 Ga0501047_0056381
555 Ga0501047_0170649
556 Ga0501048_0643017
557 Ga0501048_1281586
558 Ga0501068_0074502
559 Ga0501070_0073955
560 Ga0501070_0074219
561 Ga0501070_0109436
562 Ga0501070_0821567
563 Ga0501070_1029036
564 Ga0501072_0113786
565 Ga0501074_0059480
566 Ga0501074_0060969
567 Ga0501074_0075855
568 Ga0501074_0918817
569 Ga0501075_0003616
570 Ga0501075_0071624
571 Ga0501075_1517497
572 Ga0501076_0000714
573 Ga0501076_0005455
574 Ga0501077_0349552
575 Ga0501077_0680747
576 Ga0501207_070610
577 Ga0501235_151274
578 Ga0501079_0011475
579 Ga0501080_0060052
580 Ga0501080_0071633
581 Ga0501080_0226803
582 Ga0501081_0008125
583 Ga0501081_0016525
584 Ga0501081_0937335
585 Ga0501083_0076218
586 Ga0501035_0084836
587 Ga0501035_0455860
588 Ga0501044_0000230
589 Ga0501044_0005183
590 Ga0501044_0009239
591 Ga0501045_0037192
592 Ga0501045_0056715
593 nmdc:mga03683_389467_c1
594 nmdc:mga0yw44_1217540_c1
595 nmdc:mga0qj67_350395_c1
596 nmdc:mga06r32_375132_c1
597 Ga0495601_0413770
598 Ga0495619_0061619
599 Ga0495619_0117599
600 Ga0495619_0562063
601 Ga0501084_0021649
602 Ga0501084_0128502
603 Ga0501084_0627401
604 Ga0501084_1107097
605 Ga0590071_159303
606 Ga0590075_209076
607 Ga0501082_0033801
608 Ga0501082_0059943
609 Ga0530510_0010870
610 Ga0530510_0315915
611 Ga0530510_0881230
612 2688067626

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20540

DUF6755

Family of unknown function (DUF6755)

11

85

0.97

Map