F398574

General Info

Members Datasets Scaffolds Average Seq Length
306 182 612 147

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100743178|Ga0068859_1007431782
Length 172
Sequence MAGKNTAAFGIYPDRASVENAVDRLKIEGYRNTDISVLLPQNVGTKDFAHEKHTKAPEGIGALAIPGIGPFIAAGPIMAIPEYEAKRYEGRVKAGGILLSVHCDNSEWTKKAKQILEDTGAEDVSSTGESAADFSKSERPMLRANAPILDRTNAAPGTNDEDISIDPNRKVS

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300003160 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
70 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
147 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
153 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 61.76
Metatranscriptomes 38.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 1.63
Rhizosphere 92.16
Stem 0
Stem Tuber 0
Unclassified 32.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100743178 3300005617 Unclassified 1070
2 Ga0006779J45831_107371 3300003160 Bacteria 808
3 Ga0006778J45830_1066065 3300003162 Bacteria 672
4 Ga0006777J48905_1042150 3300003308 Bacteria 1454
5 Ga0006777J48905_1045382 3300003308 Unclassified 1014
6 Ga0006781J51513_1022940 3300003568 Bacteria 1022
7 Ga0032354_1026109 3300003693 Bacteria 1043
8 Ga0032354_1091680 3300003693 Bacteria 1701
9 Ga0006780_1010217 3300003735 Bacteria 1257
10 Ga0006780_1017902 3300003735 Unclassified 1024
11 Ga0006780_1027625 3300003735 Unclassified 962
12 JGI25405J52794_10008197 3300003911 Bacteria 1946
13 Ga0058863_10011706 3300004799 Unclassified 670
14 Ga0058863_10023773 3300004799 Unclassified 1261
15 Ga0058860_10028925 3300004801 Unclassified 1073
16 Ga0058860_10105715 3300004801 Bacteria 1131
17 Ga0070658_10407450 3300005327 Unclassified 1168
18 Ga0070683_100000047 3300005329 Bacteria 94142
19 Ga0070683_100894832 3300005329 Unclassified 851
20 Ga0070690_100001400 3300005330 Bacteria 12577
21 Ga0070670_100008093 3300005331 Bacteria 8942
22 Ga0070666_10001542 3300005335 Bacteria 13994
23 Ga0068868_100007796 3300005338 Bacteria 7641
24 Ga0070660_100071768 3300005339 Bacteria 2704
25 Ga0070689_100101032 3300005340 Bacteria 2282
26 Ga0070691_10024096 3300005341 Bacteria 2828
27 Ga0070661_100148057 3300005344 Bacteria 1774
28 Ga0070669_100276814 3300005353 Unclassified 1343
29 Ga0070675_100121946 3300005354 Bacteria 2215
30 Ga0070675_100134538 3300005354 Unclassified 2109
31 Ga0070671_100055628 3300005355 Bacteria 3291
32 Ga0070673_100054052 3300005364 Bacteria 3157
33 Ga0070659_100015168 3300005366 Bacteria 5764
34 Ga0070667_100061867 3300005367 Bacteria 3170
35 Ga0070714_100068357 3300005435 Unclassified 3065
36 Ga0070713_100349610 3300005436 Bacteria 1371
37 Ga0070711_100200996 3300005439 Bacteria 1538
38 Ga0070711_100319570 3300005439 Bacteria 1240
39 Ga0070711_100777233 3300005439 Unclassified 811
40 Ga0070681_10013213 3300005458 Bacteria 8204
41 Ga0070679_100072152 3300005530 Bacteria 3444
42 Ga0070684_100000017 3300005535 Bacteria 137567
43 Ga0068853_101048172 3300005539 Unclassified 786
44 Ga0070693_100041489 3300005547 Bacteria 2589
45 Ga0070665_100277577 3300005548 Bacteria 1677
46 Ga0068855_100250964 3300005563 Bacteria 1974
47 Ga0070664_100014844 3300005564 Bacteria 6357
48 Ga0068856_100009114 3300005614 Bacteria 9647
49 Ga0070702_100112134 3300005615 Bacteria 1693
50 Ga0070702_100115004 3300005615 Unclassified 1675
51 Ga0068859_100351359 3300005617 Unclassified 1569
52 Ga0068859_100400147 3300005617 Bacteria 1469
53 Ga0068864_100005170 3300005618 Bacteria 10686
54 Ga0068864_100091407 3300005618 Unclassified 2685
55 Ga0068864_100095247 3300005618 Unclassified 2632
56 Ga0068863_100137661 3300005841 Bacteria 2333
57 Ga0068863_100236839 3300005841 Bacteria 1762
58 Ga0068863_100731703 3300005841 Unclassified 984
59 Ga0068858_100065587 3300005842 Bacteria 3360
60 Ga0068858_100122819 3300005842 Bacteria 2430
61 Ga0081455_10000040 3300005937 Bacteria 134280
62 Ga0081455_10030469 3300005937 Unclassified 4898
63 Ga0070717_10066281 3300006028 Unclassified 3003
64 Ga0070717_10562336 3300006028 Unclassified 1033
65 Ga0070712_100552689 3300006175 Bacteria 970
66 Ga0097621_100003688 3300006237 Bacteria 10592
67 Ga0097621_100301096 3300006237 Bacteria 1416
68 Ga0068871_100032455 3300006358 Bacteria 4126
69 Ga0068871_100407233 3300006358 Bacteria 1212
70 Ga0068871_101504820 3300006358 Unclassified 636
71 Ga0075428_100328823 3300006844 Unclassified 1642
72 Ga0075430_100042322 3300006846 Unclassified 3852
73 Ga0075431_100218524 3300006847 Unclassified 1944
74 Ga0075429_101248476 3300006880 Unclassified 648
75 Ga0097620_100351393 3300006931 Unclassified 1569
76 Ga0097620_100400180 3300006931 Bacteria 1469
77 Ga0097620_100743134 3300006931 Unclassified 1070
78 Ga0105245_10029698 3300009098 Bacteria 4833
79 Ga0105243_10846714 3300009148 Bacteria 905
80 Ga0105237_10041207 3300009545 Bacteria 4658
81 Ga0105237_10332263 3300009545 Unclassified 1524
82 Ga0105239_10715170 3300010375 Bacteria 1145
83 Ga0157371_10093918 3300013102 Bacteria 2125
84 Ga0157370_10601744 3300013104 Bacteria 1006
85 Ga0157374_10042798 3300013296 Bacteria 4180
86 Ga0163162_10000740 3300013306 Bacteria 30360
87 Ga0157372_10240022 3300013307 Bacteria 2103
88 Ga0157372_10424329 3300013307 Bacteria 1550
89 Ga0157372_10484441 3300013307 Bacteria 1442
90 Ga0157372_10917427 3300013307 Bacteria 1016
91 Ga0157375_10004999 3300013308 Bacteria 11528
92 Ga0163163_10015216 3300014325 Bacteria 7106
93 Ga0163163_10276410 3300014325 Bacteria 1731
94 Ga0163163_10733965 3300014325 Unclassified 1051
95 Ga0157379_10006264 3300014968 Bacteria 10245
96 Ga0157376_10003429 3300014969 Bacteria 10915
97 Ga0157376_10225719 3300014969 Bacteria 1737
98 Ga0197907_10097299 3300020069 Bacteria 997
99 Ga0197907_10311905 3300020069 Bacteria 1181
100 Ga0197907_10491156 3300020069 Bacteria 1127
101 Ga0197907_10636714 3300020069 Bacteria 1236
102 Ga0197907_10913575 3300020069 Unclassified 1026
103 Ga0197907_11437830 3300020069 Bacteria 1366
104 Ga0197907_11510416 3300020069 Unclassified 1515
105 Ga0206356_10432225 3300020070 Bacteria 1008
106 Ga0206356_10675236 3300020070 Bacteria 1021
107 Ga0206356_10817275 3300020070 Bacteria 1280
108 Ga0206356_11354592 3300020070 Unclassified 1878
109 Ga0206356_11384731 3300020070 Bacteria 1006
110 Ga0206349_1256205 3300020075 Bacteria 2650
111 Ga0206355_1488412 3300020076 Bacteria 2975
112 Ga0206351_10303112 3300020077 Unclassified 1798
113 Ga0206351_10752331 3300020077 Bacteria 1246
114 Ga0206351_10772349 3300020077 Unclassified 1316
115 Ga0206352_10173530 3300020078 Bacteria 1004
116 Ga0206352_10262530 3300020078 Unclassified 1725
117 Ga0206352_10409213 3300020078 Bacteria 1089
118 Ga0206352_10454559 3300020078 Bacteria 1137
119 Ga0206352_10896046 3300020078 Bacteria 1458
120 Ga0206352_11106909 3300020078 Bacteria 1033
121 Ga0206350_10154821 3300020080 Unclassified 2003
122 Ga0206350_10200436 3300020080 Bacteria 891
123 Ga0206350_10315083 3300020080 Bacteria 1302
124 Ga0206350_11093825 3300020080 Unclassified 593
125 Ga0206350_11623498 3300020080 Bacteria 1136
126 Ga0206354_10192583 3300020081 Bacteria 643
127 Ga0206354_10545558 3300020081 Bacteria 749
128 Ga0206354_11646532 3300020081 Bacteria 779
129 Ga0206353_11185541 3300020082 Bacteria 1241
130 Ga0154015_1200738 3300020610 Unclassified 2055
131 Ga0154015_1531034 3300020610 Unclassified 907
132 Ga0154015_1670699 3300020610 Bacteria 1161
133 Ga0154015_1704860 3300020610 Bacteria 1266
134 Ga0213874_10014690 3300021377 Unclassified 2052
135 Ga0213876_10146053 3300021384 Bacteria 1258
136 Ga0213875_10009825 3300021388 Bacteria 4825
137 Ga0213875_10033870 3300021388 Bacteria 2414
138 Ga0213875_10076866 3300021388 Bacteria 1558
139 Ga0213875_10192473 3300021388 Unclassified 959
140 Ga0213871_10160640 3300021441 Bacteria 687
141 Ga0213871_10186373 3300021441 Bacteria 643
142 Ga0224712_10036109 3300022467 Unclassified 1829
143 Ga0224712_10048150 3300022467 Bacteria 1644
144 Ga0224712_10071436 3300022467 Bacteria 1410
145 Ga0224712_10077283 3300022467 Bacteria 1366
146 Ga0224712_10079572 3300022467 Unclassified 1350
147 Ga0224712_10084985 3300022467 Unclassified 1314
148 Ga0224712_10088155 3300022467 Bacteria 1295
149 Ga0224712_10160022 3300022467 Bacteria 1004
150 Ga0207680_10043384 3300025903 Bacteria 2637
151 Ga0207647_10276202 3300025904 Bacteria 959
152 Ga0207707_10014309 3300025912 Bacteria 6910
153 Ga0207707_10259377 3300025912 Unclassified 1508
154 Ga0207695_10854401 3300025913 Bacteria 790
155 Ga0207671_10198655 3300025914 Unclassified 1566
156 Ga0207663_10100432 3300025916 Bacteria 1942
157 Ga0207663_10608646 3300025916 Bacteria 859
158 Ga0207657_10259544 3300025919 Bacteria 1383
159 Ga0207649_10018735 3300025920 Bacteria 3943
160 Ga0207650_10021543 3300025925 Bacteria 4554
161 Ga0207659_10029840 3300025926 Unclassified 3720
162 Ga0207659_10615457 3300025926 Bacteria 926
163 Ga0207687_10342237 3300025927 Bacteria 1216
164 Ga0207644_10005585 3300025931 Bacteria 8188
165 Ga0207690_10099159 3300025932 Unclassified 2077
166 Ga0207706_10226873 3300025933 Unclassified 1635
167 Ga0207691_10004123 3300025940 Bacteria 14117
168 Ga0207691_10011850 3300025940 Bacteria 8370
169 Ga0207661_10000023 3300025944 Bacteria 197512
170 Ga0207661_10832369 3300025944 Unclassified 850
171 Ga0207679_10253165 3300025945 Bacteria 1498
172 Ga0207667_10536375 3300025949 Bacteria 1184
173 Ga0207651_10178251 3300025960 Bacteria 1683
174 Ga0207658_10005089 3300025986 Bacteria 9046
175 Ga0207677_10331559 3300026023 Bacteria 1268
176 Ga0207703_10090335 3300026035 Bacteria 2574
177 Ga0207703_10099463 3300026035 Bacteria 2462
178 Ga0207639_11092661 3300026041 Unclassified 748
179 Ga0207702_10192072 3300026078 Bacteria 1887
180 Ga0207702_10196012 3300026078 Bacteria 1870
181 Ga0207641_10040517 3300026088 Bacteria 3901
182 Ga0207641_10051530 3300026088 Bacteria 3486
183 Ga0207641_10165773 3300026088 Unclassified 2012
184 Ga0207676_10078742 3300026095 Bacteria 2670
185 Ga0265760_10000003 3300031090 Bacteria 152662
186 Ga0265330_10303762 3300031235 Bacteria 673
187 Ga0265314_10001939 3300031711 Bacteria 22097
188 Ga0307409_101187567 3300031995 Unclassified 786
189 Ga0373934_0012097 3300035086 Bacteria 3255
190 Ga0373923_0168145 3300035111 Bacteria 1003
191 Ga0373923_0291889 3300035111 Unclassified 770
192 Ga0373954_0001389 3300035118 Bacteria 9803
193 Ga0373956_0034960 3300035119 Unclassified 2215
194 Ga0373956_0142991 3300035119 Bacteria 1124
195 Ga0373943_0548623 3300035170 Bacteria 678
196 Ga0373946_0002780 3300035171 Bacteria 6195
197 Ga0373955_0149715 3300035172 Bacteria 1373
198 Ga0373935_0129844 3300035692 Bacteria 1692
199 Ga0373927_0292854 3300035695 Bacteria 1071
200 Ga0373947_0002311 3300035725 Bacteria 11517
201 Ga0373937_0001893 3300036401 Bacteria 17557
202 Ga0373937_0448068 3300036401 Bacteria 1226
203 Ga0373937_0457775 3300036401 Unclassified 1212
204 Ga0265778_011565 3300036457 Unclassified 1019
205 Ga0373925_0033458 3300037068 Bacteria 3788
206 Ga0373925_0107803 3300037068 Bacteria 2149
207 Ga0436364_0348472 3300037853 Bacteria 5505
208 Ga0436364_0382669 3300037853 Unclassified 667
209 Ga0436364_0461036 3300037853 Bacteria 6189
210 Ga0436364_0690969 3300037853 Bacteria 4410
211 Ga0436364_1158872 3300037853 Bacteria 16532
212 Ga0436364_1437776 3300037853 Bacteria 1877
213 Ga0436364_1560840 3300037853 Bacteria 2252
214 Ga0436365_0356067 3300039437 Bacteria 2715
215 Ga0436365_0870270 3300039437 Bacteria 641
216 Ga0436365_1199411 3300039437 Bacteria 2251
217 Ga0436360_0602861 3300039438 Unclassified 3061
218 Ga0436360_1199720 3300039438 Bacteria 1789
219 Ga0436360_1256345 3300039438 Bacteria 1285
220 Ga0436361_0968172 3300039447 Bacteria 1746
221 Ga0436362_0047181 3300039453 Bacteria 1208
222 Ga0451577_0285348 3300042876 Bacteria 1496
223 Ga0466966_0187559 3300044684 Unclassified 1254
224 Ga0451576_0049040 3300045051 Bacteria 4432
225 Ga0451576_0768816 3300045051 Bacteria 1012
226 Ga0495580_0024186 3300046472 Bacteria 4451
227 Ga0495580_0051101 3300046472 Bacteria 2923
228 Ga0495580_0118911 3300046472 Bacteria 1835
229 Ga0495594_0125058 3300046499 Bacteria 1455
230 Ga0495587_0354086 3300046536 Bacteria 818
231 Ga0495645_0036246 3300046543 Unclassified 3596
232 Ga0495599_0075158 3300046678 Unclassified 2110
233 Ga0495623_0342617 3300046679 Bacteria 816
234 Ga0495658_0036540 3300046683 Bacteria 2711
235 Ga0495613_0451423 3300046689 Bacteria 871
236 Ga0495684_0126773 3300047471 Unclassified 1920
237 Ga0496104_0260007 3300048907 Unclassified 1649
238 Ga0496108_0279635 3300048911 Unclassified 1453
239 Ga0496109_0497960 3300048912 Unclassified 1150
240 Ga0496112_0400872 3300048915 Bacteria 1312
241 Ga0496112_1032856 3300048915 Unclassified 741
242 Ga0501067_0422343 3300049583 Bacteria 744
243 Ga0501247_014736 3300049677 Bacteria 971
244 Ga0501250_005416 3300049680 Bacteria 1310
245 nmdc:mga05p37_323256_c1 3300050507 Bacteria 1825
246 nmdc:mga0qj67_98128_c1 3300050509 Unclassified 2360
247 nmdc:mga06r32_470871_c1 3300050510 Unclassified 1235
248 Ga0495601_0220014 3300053077 Bacteria 1240
249 Ga0500556_0004458 3300053104 Bacteria 3986
250 Ga0587093_009749 3300059478 Bacteria 1122
251 Ga0587066_016442 3300059490 Unclassified 1166
252 Ga0587066_016739 3300059490 Bacteria 1159
253 Ga0587070_023122 3300059491 Unclassified 1065
254 Ga0587070_080227 3300059491 Unclassified 714
255 Ga0587073_0006086 3300059492 Bacteria 1837
256 Ga0587073_0016562 3300059492 Bacteria 1347
257 Ga0587073_0025917 3300059492 Bacteria 1170
258 Ga0587073_0027497 3300059492 Unclassified 1148
259 Ga0587073_0111423 3300059492 Unclassified 726
260 Ga0587077_092869 3300059493 Bacteria 712
261 Ga0587080_010567 3300059503 Unclassified 1364
262 Ga0587080_012236 3300059503 Bacteria 1294
263 Ga0587080_021046 3300059503 Unclassified 1070
264 Ga0587080_058516 3300059503 Bacteria 745
265 Ga0587082_004407 3300059504 Unclassified 1763
266 Ga0587082_016720 3300059504 Unclassified 1149
267 Ga0587082_021329 3300059504 Bacteria 1057
268 Ga0587082_026853 3300059504 Unclassified 977
269 Ga0587083_0025230 3300059505 Bacteria 1138
270 Ga0587083_0036975 3300059505 Unclassified 1002
271 Ga0587083_0040003 3300059505 Unclassified 977
272 Ga0587085_022259 3300059506 Unclassified 975
273 Ga0587086_013476 3300059507 Unclassified 1031
274 Ga0587086_043782 3300059507 Unclassified 701
275 Ga0587089_026977 3300059509 Unclassified 827
276 Ga0587089_034271 3300059509 Bacteria 761
277 Ga0587090_003438 3300059510 Bacteria 1840
278 Ga0587090_031956 3300059510 Unclassified 885
279 Ga0587091_019425 3300059511 Bacteria 1168
280 Ga0587091_021145 3300059511 Bacteria 1137
281 Ga0587092_016148 3300059512 Bacteria 1102
282 Ga0587094_014861 3300059513 Bacteria 1068
283 Ga0587098_006098 3300059604 Bacteria 1209
284 Ga0587113_023079 3300059625 Unclassified 667
285 Ga0587128_004717 3300059630 Bacteria 1598
286 Ga0587128_014095 3300059630 Bacteria 1139
287 Ga0587128_014729 3300059630 Unclassified 1124
288 Ga0587067_031954 3300059640 Unclassified 976
289 Ga0587068_059922 3300059641 Bacteria 730
290 Ga0587069_016800 3300059642 Bacteria 1050
291 Ga0587072_014492 3300059643 Bacteria 1329
292 Ga0587072_019804 3300059643 Bacteria 1180
293 Ga0587072_022712 3300059643 Bacteria 1122
294 Ga0587075_007176 3300059644 Bacteria 1391
295 Ga0587075_011704 3300059644 Unclassified 1180
296 Ga0587075_029507 3300059644 Bacteria 865
297 Ga0587075_068655 3300059644 Unclassified 654
298 Ga0587078_013131 3300059646 Unclassified 977
299 Ga0587078_029340 3300059646 Bacteria 735
300 Ga0587079_036134 3300059647 Unclassified 975
301 Ga0587107_016465 3300059652 Unclassified 977
302 Ga0587110_017633 3300059654 Bacteria 783
303 Ga0587114_016724 3300059655 Bacteria 986
304 Ga0587071_026332 3300060344 Unclassified 1097
305 Ga0587071_035660 3300060344 Unclassified 978
306 Ga0587111_0042111 3300060346 Unclassified 977
307 Ga0068859_100743178
308 Ga0006779J45831_107371
309 Ga0006778J45830_1066065
310 Ga0006777J48905_1042150
311 Ga0006777J48905_1045382
312 Ga0006781J51513_1022940
313 Ga0032354_1026109
314 Ga0032354_1091680
315 Ga0006780_1010217
316 Ga0006780_1017902
317 Ga0006780_1027625
318 JGI25405J52794_10008197
319 Ga0058863_10011706
320 Ga0058863_10023773
321 Ga0058860_10028925
322 Ga0058860_10105715
323 Ga0070658_10407450
324 Ga0070683_100000047
325 Ga0070683_100894832
326 Ga0070690_100001400
327 Ga0070670_100008093
328 Ga0070666_10001542
329 Ga0068868_100007796
330 Ga0070660_100071768
331 Ga0070689_100101032
332 Ga0070691_10024096
333 Ga0070661_100148057
334 Ga0070669_100276814
335 Ga0070675_100121946
336 Ga0070675_100134538
337 Ga0070671_100055628
338 Ga0070673_100054052
339 Ga0070659_100015168
340 Ga0070667_100061867
341 Ga0070714_100068357
342 Ga0070713_100349610
343 Ga0070711_100200996
344 Ga0070711_100319570
345 Ga0070711_100777233
346 Ga0070681_10013213
347 Ga0070679_100072152
348 Ga0070684_100000017
349 Ga0068853_101048172
350 Ga0070693_100041489
351 Ga0070665_100277577
352 Ga0068855_100250964
353 Ga0070664_100014844
354 Ga0068856_100009114
355 Ga0070702_100112134
356 Ga0070702_100115004
357 Ga0068859_100351359
358 Ga0068859_100400147
359 Ga0068864_100005170
360 Ga0068864_100091407
361 Ga0068864_100095247
362 Ga0068863_100137661
363 Ga0068863_100236839
364 Ga0068863_100731703
365 Ga0068858_100065587
366 Ga0068858_100122819
367 Ga0081455_10000040
368 Ga0081455_10030469
369 Ga0070717_10066281
370 Ga0070717_10562336
371 Ga0070712_100552689
372 Ga0097621_100003688
373 Ga0097621_100301096
374 Ga0068871_100032455
375 Ga0068871_100407233
376 Ga0068871_101504820
377 Ga0075428_100328823
378 Ga0075430_100042322
379 Ga0075431_100218524
380 Ga0075429_101248476
381 Ga0097620_100351393
382 Ga0097620_100400180
383 Ga0097620_100743134
384 Ga0105245_10029698
385 Ga0105243_10846714
386 Ga0105237_10041207
387 Ga0105237_10332263
388 Ga0105239_10715170
389 Ga0157371_10093918
390 Ga0157370_10601744
391 Ga0157374_10042798
392 Ga0163162_10000740
393 Ga0157372_10240022
394 Ga0157372_10424329
395 Ga0157372_10484441
396 Ga0157372_10917427
397 Ga0157375_10004999
398 Ga0163163_10015216
399 Ga0163163_10276410
400 Ga0163163_10733965
401 Ga0157379_10006264
402 Ga0157376_10003429
403 Ga0157376_10225719
404 Ga0197907_10097299
405 Ga0197907_10311905
406 Ga0197907_10491156
407 Ga0197907_10636714
408 Ga0197907_10913575
409 Ga0197907_11437830
410 Ga0197907_11510416
411 Ga0206356_10432225
412 Ga0206356_10675236
413 Ga0206356_10817275
414 Ga0206356_11354592
415 Ga0206356_11384731
416 Ga0206349_1256205
417 Ga0206355_1488412
418 Ga0206351_10303112
419 Ga0206351_10752331
420 Ga0206351_10772349
421 Ga0206352_10173530
422 Ga0206352_10262530
423 Ga0206352_10409213
424 Ga0206352_10454559
425 Ga0206352_10896046
426 Ga0206352_11106909
427 Ga0206350_10154821
428 Ga0206350_10200436
429 Ga0206350_10315083
430 Ga0206350_11093825
431 Ga0206350_11623498
432 Ga0206354_10192583
433 Ga0206354_10545558
434 Ga0206354_11646532
435 Ga0206353_11185541
436 Ga0154015_1200738
437 Ga0154015_1531034
438 Ga0154015_1670699
439 Ga0154015_1704860
440 Ga0213874_10014690
441 Ga0213876_10146053
442 Ga0213875_10009825
443 Ga0213875_10033870
444 Ga0213875_10076866
445 Ga0213875_10192473
446 Ga0213871_10160640
447 Ga0213871_10186373
448 Ga0224712_10036109
449 Ga0224712_10048150
450 Ga0224712_10071436
451 Ga0224712_10077283
452 Ga0224712_10079572
453 Ga0224712_10084985
454 Ga0224712_10088155
455 Ga0224712_10160022
456 Ga0207680_10043384
457 Ga0207647_10276202
458 Ga0207707_10014309
459 Ga0207707_10259377
460 Ga0207695_10854401
461 Ga0207671_10198655
462 Ga0207663_10100432
463 Ga0207663_10608646
464 Ga0207657_10259544
465 Ga0207649_10018735
466 Ga0207650_10021543
467 Ga0207659_10029840
468 Ga0207659_10615457
469 Ga0207687_10342237
470 Ga0207644_10005585
471 Ga0207690_10099159
472 Ga0207706_10226873
473 Ga0207691_10004123
474 Ga0207691_10011850
475 Ga0207661_10000023
476 Ga0207661_10832369
477 Ga0207679_10253165
478 Ga0207667_10536375
479 Ga0207651_10178251
480 Ga0207658_10005089
481 Ga0207677_10331559
482 Ga0207703_10090335
483 Ga0207703_10099463
484 Ga0207639_11092661
485 Ga0207702_10192072
486 Ga0207702_10196012
487 Ga0207641_10040517
488 Ga0207641_10051530
489 Ga0207641_10165773
490 Ga0207676_10078742
491 Ga0265760_10000003
492 Ga0265330_10303762
493 Ga0265314_10001939
494 Ga0307409_101187567
495 Ga0373934_0012097
496 Ga0373923_0168145
497 Ga0373923_0291889
498 Ga0373954_0001389
499 Ga0373956_0034960
500 Ga0373956_0142991
501 Ga0373943_0548623
502 Ga0373946_0002780
503 Ga0373955_0149715
504 Ga0373935_0129844
505 Ga0373927_0292854
506 Ga0373947_0002311
507 Ga0373937_0001893
508 Ga0373937_0448068
509 Ga0373937_0457775
510 Ga0265778_011565
511 Ga0373925_0033458
512 Ga0373925_0107803
513 Ga0436364_0348472
514 Ga0436364_0382669
515 Ga0436364_0461036
516 Ga0436364_0690969
517 Ga0436364_1158872
518 Ga0436364_1437776
519 Ga0436364_1560840
520 Ga0436365_0356067
521 Ga0436365_0870270
522 Ga0436365_1199411
523 Ga0436360_0602861
524 Ga0436360_1199720
525 Ga0436360_1256345
526 Ga0436361_0968172
527 Ga0436362_0047181
528 Ga0451577_0285348
529 Ga0466966_0187559
530 Ga0451576_0049040
531 Ga0451576_0768816
532 Ga0495580_0024186
533 Ga0495580_0051101
534 Ga0495580_0118911
535 Ga0495594_0125058
536 Ga0495587_0354086
537 Ga0495645_0036246
538 Ga0495599_0075158
539 Ga0495623_0342617
540 Ga0495658_0036540
541 Ga0495613_0451423
542 Ga0495684_0126773
543 Ga0496104_0260007
544 Ga0496108_0279635
545 Ga0496109_0497960
546 Ga0496112_0400872
547 Ga0496112_1032856
548 Ga0501067_0422343
549 Ga0501247_014736
550 Ga0501250_005416
551 nmdc:mga05p37_323256_c1
552 nmdc:mga0qj67_98128_c1
553 nmdc:mga06r32_470871_c1
554 Ga0495601_0220014
555 Ga0500556_0004458
556 Ga0587093_009749
557 Ga0587066_016442
558 Ga0587066_016739
559 Ga0587070_023122
560 Ga0587070_080227
561 Ga0587073_0006086
562 Ga0587073_0016562
563 Ga0587073_0025917
564 Ga0587073_0027497
565 Ga0587073_0111423
566 Ga0587077_092869
567 Ga0587080_010567
568 Ga0587080_012236
569 Ga0587080_021046
570 Ga0587080_058516
571 Ga0587082_004407
572 Ga0587082_016720
573 Ga0587082_021329
574 Ga0587082_026853
575 Ga0587083_0025230
576 Ga0587083_0036975
577 Ga0587083_0040003
578 Ga0587085_022259
579 Ga0587086_013476
580 Ga0587086_043782
581 Ga0587089_026977
582 Ga0587089_034271
583 Ga0587090_003438
584 Ga0587090_031956
585 Ga0587091_019425
586 Ga0587091_021145
587 Ga0587092_016148
588 Ga0587094_014861
589 Ga0587098_006098
590 Ga0587113_023079
591 Ga0587128_004717
592 Ga0587128_014095
593 Ga0587128_014729
594 Ga0587067_031954
595 Ga0587068_059922
596 Ga0587069_016800
597 Ga0587072_014492
598 Ga0587072_019804
599 Ga0587072_022712
600 Ga0587075_007176
601 Ga0587075_011704
602 Ga0587075_029507
603 Ga0587075_068655
604 Ga0587078_013131
605 Ga0587078_029340
606 Ga0587079_036134
607 Ga0587107_016465
608 Ga0587110_017633
609 Ga0587114_016724
610 Ga0587071_026332
611 Ga0587071_035660
612 Ga0587111_0042111

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map