F398521

General Info

Members Datasets Scaffolds Average Seq Length
306 163 306 316

Family's Representative Sequence

Representative Sequence 3300005438|Ga0070701_10066651|Ga0070701_100666513
Length 351
Sequence MTPSMAKRAPSSAVSIAVPRIAVLVPCFNEEAAVATVVADFRQALPAAEIYVYDNNSSDRTSAVALEAGAEVRSERRQGKGHVVRRMFADIEADIYVLVDGDDTYDASASPQMITRMIADGADLLTGRRIHTEPGAYRPGHVMGNRMLTGLTAILFNVHLSDMLSGYRVFSRRFVKSFPFTAEGFAIETELTIHAVRLMMPMSEMDCRYKERPAGSVSKLNTWRDGFRILGTIGYLVREERPLLFFAIISLLFAAVAVLIGAPVVSEYFRTGLVPRLPTAVLATGLMVIAFLSLTCGMILDTVTRGRWEAKRMAYLAIPGAVHLRNGLAKLVADAPDDWPSRMAQRSQHAP

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
158 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
159 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
160 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
161 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.59
Nodule 0
Rhizoplane 0
Rhizosphere 92.48
Stem 0
Stem Tuber 0
Unclassified 3.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000008 3300003214 Bacteria 478603
2 JGI25153J46596_10000320 3300003215 Bacteria 35306
3 Ga0070658_10302602 3300005327 Bacteria 1363
4 Ga0070683_100147446 3300005329 Bacteria 2230
5 Ga0068869_100017540 3300005334 Bacteria 4854
6 Ga0068869_100093646 3300005334 Bacteria 2264
7 Ga0070666_10002989 3300005335 Bacteria 10252
8 Ga0070666_10008352 3300005335 Bacteria 6424
9 Ga0070680_100000131 3300005336 Bacteria 44894
10 Ga0070660_100004785 3300005339 Bacteria 9361
11 Ga0070691_10127782 3300005341 Bacteria 1285
12 Ga0070661_100000372 3300005344 Bacteria 35215
13 Ga0070675_100319529 3300005354 Bacteria 1371
14 Ga0070674_100188674 3300005356 Bacteria 1584
15 Ga0070659_100007210 3300005366 Bacteria 8069
16 Ga0070659_100211594 3300005366 Bacteria 1598
17 Ga0070667_100089951 3300005367 Bacteria 2637
18 Ga0070714_100068613 3300005435 Bacteria 3060
19 Ga0070701_10066651 3300005438 Bacteria 1914
20 Ga0070663_100081958 3300005455 Bacteria 2373
21 Ga0070678_100068239 3300005456 Bacteria 2650
22 Ga0070678_100075527 3300005456 Bacteria 2535
23 Ga0070662_100057318 3300005457 Bacteria 2831
24 Ga0070681_10000068 3300005458 Bacteria 75693
25 Ga0068867_100034500 3300005459 Bacteria 3667
26 Ga0070685_10327248 3300005466 Bacteria 1041
27 Ga0070679_100028841 3300005530 Bacteria 5474
28 Ga0070679_100037979 3300005530 Bacteria 4785
29 Ga0070679_100062136 3300005530 Bacteria 3723
30 Ga0070679_100597766 3300005530 Bacteria 1047
31 Ga0068853_100047575 3300005539 Bacteria 3681
32 Ga0070672_100450087 3300005543 Bacteria 1109
33 Ga0070665_100011790 3300005548 Bacteria 8829
34 Ga0070665_100030487 3300005548 Bacteria 5425
35 Ga0070665_100038977 3300005548 Bacteria 4777
36 Ga0070665_100041879 3300005548 Bacteria 4604
37 Ga0068855_100000024 3300005563 Bacteria 184241
38 Ga0068855_100008964 3300005563 Bacteria 12091
39 Ga0068855_100015050 3300005563 Bacteria 9315
40 Ga0068855_100144912 3300005563 Bacteria 2705
41 Ga0068855_100152793 3300005563 Bacteria 2624
42 Ga0068856_100043417 3300005614 Bacteria 4424
43 Ga0068856_100162788 3300005614 Bacteria 2242
44 Ga0068856_100352268 3300005614 Bacteria 1491
45 Ga0068859_100154592 3300005617 Bacteria 2371
46 Ga0068863_100056746 3300005841 Bacteria 3707
47 Ga0068858_100010394 3300005842 Bacteria 8819
48 Ga0068858_100024346 3300005842 Bacteria 5641
49 Ga0068860_100351748 3300005843 Bacteria 1450
50 Ga0097621_100000991 3300006237 Bacteria 19959
51 Ga0097621_100008509 3300006237 Bacteria 7388
52 Ga0097621_100281247 3300006237 Bacteria 1464
53 Ga0097621_100425973 3300006237 Bacteria 1192
54 Ga0097621_100434518 3300006237 Bacteria 1180
55 Ga0068871_100001977 3300006358 Bacteria 13888
56 Ga0097620_100154591 3300006931 Bacteria 2371
57 Ga0105240_10007556 3300009093 Bacteria 15753
58 Ga0105240_10027843 3300009093 Bacteria 7395
59 Ga0105240_10077756 3300009093 Bacteria 4087
60 Ga0105240_10182807 3300009093 Bacteria 2473
61 Ga0105240_10389863 3300009093 Bacteria 1571
62 Ga0105245_10182418 3300009098 Bacteria 2006
63 Ga0105247_10033563 3300009101 Bacteria 3122
64 Ga0105243_10013154 3300009148 Bacteria 6255
65 Ga0105241_10020611 3300009174 Bacteria 4872
66 Ga0105242_10049051 3300009176 Bacteria 3434
67 Ga0105248_10000009 3300009177 Bacteria 403549
68 Ga0105248_10042176 3300009177 Bacteria 5117
69 Ga0105248_10147087 3300009177 Bacteria 2659
70 Ga0105237_10274059 3300009545 Bacteria 1690
71 Ga0105238_10021211 3300009551 Bacteria 6621
72 Ga0105238_10206222 3300009551 Bacteria 1942
73 Ga0105238_10585343 3300009551 Bacteria 1123
74 Ga0105249_10102329 3300009553 Bacteria 2696
75 Ga0105239_10012846 3300010375 Bacteria 9316
76 Ga0105239_10023452 3300010375 Bacteria 6796
77 Ga0105239_10046475 3300010375 Bacteria 4757
78 Ga0105239_10116753 3300010375 Bacteria 2961
79 Ga0157370_10001401 3300013104 Bacteria 29907
80 Ga0157369_10014650 3300013105 Bacteria 8846
81 Ga0157369_10042339 3300013105 Bacteria 4968
82 Ga0157378_10014467 3300013297 Bacteria 6907
83 Ga0163162_10415479 3300013306 Bacteria 1477
84 Ga0157372_10526560 3300013307 Bacteria 1378
85 Ga0163163_10000093 3300014325 Bacteria 95764
86 Ga0157379_10003649 3300014968 Bacteria 13068
87 Ga0157379_10332186 3300014968 Bacteria 1389
88 Ga0213874_10000506 3300021377 Bacteria 7874
89 Ga0213874_10003883 3300021377 Bacteria 3360
90 Ga0213876_10000985 3300021384 Bacteria 18708
91 Ga0213876_10009288 3300021384 Bacteria 5297
92 Ga0209233_1000006 3300025261 Bacteria 1473685
93 Ga0209233_1003150 3300025261 Bacteria 5851
94 Ga0209758_1000032 3300025297 Bacteria 481623
95 Ga0207710_10026473 3300025900 Bacteria 2507
96 Ga0207680_10001747 3300025903 Bacteria 10252
97 Ga0207680_10020057 3300025903 Bacteria 3588
98 Ga0207705_10015011 3300025909 Bacteria 5569
99 Ga0207705_10222441 3300025909 Bacteria 1434
100 Ga0207707_10000002 3300025912 Bacteria 1142054
101 Ga0207695_10000003 3300025913 Bacteria 1368691
102 Ga0207695_10004655 3300025913 Bacteria 18589
103 Ga0207695_10026484 3300025913 Bacteria 6472
104 Ga0207695_10061543 3300025913 Bacteria 3879
105 Ga0207671_10123579 3300025914 Bacteria 1980
106 Ga0207660_10000230 3300025917 Bacteria 36015
107 Ga0207649_10000632 3300025920 Bacteria 23589
108 Ga0207652_10000464 3300025921 Bacteria 41551
109 Ga0207652_10091789 3300025921 Bacteria 2671
110 Ga0207652_10379543 3300025921 Bacteria 1276
111 Ga0207694_10000016 3300025924 Bacteria 349087
112 Ga0207650_10158197 3300025925 Bacteria 1793
113 Ga0207664_10048862 3300025929 Bacteria 3329
114 Ga0207690_10192083 3300025932 Bacteria 1545
115 Ga0207706_10078488 3300025933 Bacteria 2904
116 Ga0207686_10026185 3300025934 Bacteria 3401
117 Ga0207709_10018640 3300025935 Bacteria 3890
118 Ga0207670_10157468 3300025936 Bacteria 1692
119 Ga0207711_10000003 3300025941 Bacteria 1042791
120 Ga0207711_10000005 3300025941 Bacteria 822972
121 Ga0207711_10000015 3300025941 Bacteria 494097
122 Ga0207711_10039693 3300025941 Bacteria 4004
123 Ga0207689_10018498 3300025942 Bacteria 5879
124 Ga0207679_10267566 3300025945 Bacteria 1460
125 Ga0207667_10000021 3300025949 Bacteria 370524
126 Ga0207667_10010181 3300025949 Bacteria 11013
127 Ga0207640_10300298 3300025981 Bacteria 1270
128 Ga0207703_10006959 3300026035 Bacteria 9001
129 Ga0207703_10049158 3300026035 Bacteria 3408
130 Ga0207703_10147938 3300026035 Bacteria 2045
131 Ga0207678_10094846 3300026067 Bacteria 2550
132 Ga0207702_10033676 3300026078 Bacteria 4281
133 Ga0207702_10674493 3300026078 Bacteria 1018
134 Ga0207641_10011965 3300026088 Bacteria 7117
135 Ga0207648_10005061 3300026089 Bacteria 13367
136 Ga0207683_10061656 3300026121 Bacteria 3301
137 Ga0207698_10057447 3300026142 Bacteria 3011
138 Ga0207698_10095014 3300026142 Bacteria 2453
139 Ga0268266_10007100 3300028379 Bacteria 10163
140 Ga0268266_10011865 3300028379 Bacteria 7548
141 Ga0268266_10281274 3300028379 Bacteria 1547
142 Ga0268264_10146030 3300028381 Bacteria 2115
143 Ga0265318_10000021 3300028577 Bacteria 166748
144 Ga0265318_10003325 3300028577 Bacteria 8140
145 Ga0265338_10000007 3300028800 Bacteria 498229
146 Ga0265338_10001910 3300028800 Bacteria 32560
147 Ga0265338_10027507 3300028800 Bacteria 5703
148 Ga0265320_10065523 3300031240 Bacteria 1724
149 Ga0265325_10000001 3300031241 Bacteria 726814
150 Ga0265325_10001555 3300031241 Bacteria 16000
151 Ga0265325_10002618 3300031241 Bacteria 12053
152 Ga0265339_10000689 3300031249 Bacteria 26094
153 Ga0265339_10002542 3300031249 Bacteria 13002
154 Ga0265339_10034365 3300031249 Bacteria 2850
155 Ga0265339_10065321 3300031249 Bacteria 1951
156 Ga0265331_10000002 3300031250 Bacteria 511481
157 Ga0265331_10000355 3300031250 Bacteria 48482
158 Ga0265331_10003245 3300031250 Bacteria 10600
159 Ga0265331_10057336 3300031250 Bacteria 1848
160 Ga0265331_10095410 3300031250 Bacteria 1372
161 Ga0265327_10000033 3300031251 Bacteria 317182
162 Ga0265316_10005099 3300031344 Bacteria 12871
163 Ga0265316_10305852 3300031344 Bacteria 1157
164 Ga0265313_10002332 3300031595 Bacteria 16625
165 Ga0265313_10003291 3300031595 Bacteria 13262
166 Ga0265313_10005319 3300031595 Bacteria 9516
167 Ga0265313_10007522 3300031595 Bacteria 7415
168 Ga0265313_10010805 3300031595 Bacteria 5734
169 Ga0265314_10006025 3300031711 Bacteria 10798
170 Ga0265314_10032495 3300031711 Bacteria 3838
171 Ga0265314_10044608 3300031711 Bacteria 3142
172 Ga0265342_10019393 3300031712 Bacteria 4384
173 Ga0265342_10033826 3300031712 Bacteria 3139
174 Ga0307516_10026049 3300031730 Bacteria 5945
175 Ga0307516_10077270 3300031730 Bacteria 3178
176 Ga0373934_0049393 3300035086 Bacteria 1666
177 Ga0373923_0063323 3300035111 Bacteria 1575
178 Ga0373936_0060528 3300035113 Bacteria 1545
179 Ga0373957_0059121 3300035120 Bacteria 1482
180 Ga0373943_0005335 3300035170 Bacteria 5778
181 Ga0373955_0106248 3300035172 Bacteria 1618
182 Ga0373955_0247074 3300035172 Unclassified 1069
183 Ga0373931_0067493 3300035691 Bacteria 1944
184 Ga0373935_0026912 3300035692 Unclassified 3554
185 Ga0373933_0072553 3300035724 Unclassified 2097
186 Ga0373937_0011557 3300036401 Bacteria 7748
187 Ga0373937_0117634 3300036401 Bacteria 2476
188 Ga0373925_0003185 3300037068 Bacteria 12828
189 Ga0436365_1158121 3300039437 Bacteria 31439
190 Ga0436365_1935268 3300039437 Bacteria 135877
191 Ga0436363_0118447 3300039450 Bacteria 4444
192 Ga0436363_1490868 3300039450 Bacteria 11187
193 Ga0495651_0266596 3300046462 Bacteria 1163
194 Ga0495580_0041028 3300046472 Bacteria 3302
195 Ga0495582_0043873 3300046473 Bacteria 2462
196 Ga0495664_0058834 3300046477 Bacteria 2287
197 Ga0495652_0195545 3300046529 Bacteria 1540
198 Ga0495586_0094737 3300046535 Bacteria 1652
199 Ga0495609_0012669 3300046538 Bacteria 3998
200 Ga0495645_0291851 3300046543 Bacteria 1069
201 Ga0495622_0012147 3300046557 Bacteria 3984
202 Ga0495656_0064577 3300046615 Bacteria 1608
203 Ga0495657_0085415 3300046675 Bacteria 2034
204 Ga0495599_0089519 3300046678 Bacteria 1921
205 Ga0495658_0000415 3300046683 Bacteria 23946
206 Ga0495675_0056953 3300047444 Bacteria 2478
207 Ga0495602_0193500 3300048088 Bacteria 1557
208 Ga0496121_0000465 3300048924 Bacteria 78967
209 Ga0496126_0001966 3300048929 Bacteria 29123
210 Ga0495682_0006333 3300049460 Bacteria 4797
211 Ga0501031_0011092 3300049568 Bacteria 5874
212 Ga0501031_0056833 3300049568 Bacteria 2550
213 Ga0501032_0008815 3300049569 Bacteria 7337
214 Ga0501032_0032998 3300049569 Bacteria 3548
215 Ga0501032_0051267 3300049569 Bacteria 2783
216 Ga0501033_0006278 3300049570 Bacteria 9319
217 Ga0501033_0009798 3300049570 Bacteria 7356
218 Ga0501033_0015791 3300049570 Bacteria 5723
219 Ga0501033_0022511 3300049570 Bacteria 4755
220 Ga0501033_0027688 3300049570 Bacteria 4261
221 Ga0501033_0197347 3300049570 Bacteria 1438
222 Ga0501034_0007184 3300049571 Bacteria 11887
223 Ga0501034_0008502 3300049571 Bacteria 10839
224 Ga0501034_0117257 3300049571 Bacteria 2650
225 Ga0501034_0237970 3300049571 Bacteria 1768
226 Ga0501036_0009629 3300049572 Bacteria 7948
227 Ga0501036_0053935 3300049572 Bacteria 3404
228 Ga0501037_0003022 3300049573 Bacteria 12212
229 Ga0501037_0013844 3300049573 Bacteria 5944
230 Ga0501037_0077861 3300049573 Bacteria 2406
231 Ga0501038_0013629 3300049574 Bacteria 7408
232 Ga0501038_0025517 3300049574 Bacteria 5267
233 Ga0501039_0002592 3300049575 Bacteria 13512
234 Ga0501042_0020140 3300049578 Bacteria 4640
235 Ga0501043_0007594 3300049579 Bacteria 8597
236 Ga0501043_0024738 3300049579 Bacteria 4709
237 Ga0501043_0027271 3300049579 Bacteria 4485
238 Ga0501046_0001103 3300049580 Bacteria 26437
239 Ga0501046_0016969 3300049580 Bacteria 6090
240 Ga0501046_0036004 3300049580 Bacteria 3985
241 Ga0501047_0002316 3300049581 Bacteria 18217
242 Ga0501047_0012663 3300049581 Bacteria 7990
243 Ga0501047_0016425 3300049581 Bacteria 7066
244 Ga0501047_0016454 3300049581 Bacteria 7060
245 Ga0501047_0019182 3300049581 Bacteria 6560
246 Ga0501047_0021125 3300049581 Bacteria 6251
247 Ga0501047_0040350 3300049581 Bacteria 4514
248 Ga0501047_0075544 3300049581 Bacteria 3242
249 Ga0501047_0109485 3300049581 Bacteria 2645
250 Ga0501047_0136251 3300049581 Bacteria 2335
251 Ga0501047_0485193 3300049581 Bacteria 1063
252 Ga0501048_0005299 3300049582 Bacteria 9818
253 Ga0501067_0001062 3300049583 Bacteria 14793
254 Ga0501067_0002155 3300049583 Bacteria 10846
255 Ga0501067_0002711 3300049583 Bacteria 9758
256 Ga0501068_0016148 3300049584 Bacteria 4301
257 Ga0501069_0003041 3300049585 Bacteria 8614
258 Ga0501069_0063464 3300049585 Bacteria 2063
259 Ga0501069_0065691 3300049585 Bacteria 2029
260 Ga0501070_0004951 3300049586 Bacteria 11365
261 Ga0501070_0034929 3300049586 Bacteria 4201
262 Ga0501073_0003745 3300049589 Bacteria 11423
263 Ga0501073_0009928 3300049589 Bacteria 7003
264 Ga0501073_0016988 3300049589 Bacteria 5270
265 Ga0501073_0035479 3300049589 Bacteria 3544
266 Ga0501074_0005025 3300049590 Bacteria 9493
267 Ga0501074_0053745 3300049590 Bacteria 2905
268 Ga0501079_0003337 3300049741 Bacteria 11775
269 Ga0501080_0037775 3300049742 Bacteria 4509
270 Ga0501080_0103553 3300049742 Bacteria 2639
271 Ga0501080_0133852 3300049742 Bacteria 2294
272 Ga0501080_0181314 3300049742 Bacteria 1937
273 Ga0501080_0218607 3300049742 Bacteria 1744
274 Ga0501080_0400091 3300049742 Bacteria 1235
275 Ga0501083_0001440 3300049744 Bacteria 16247
276 Ga0501083_0013520 3300049744 Bacteria 5706
277 Ga0501083_0013788 3300049744 Bacteria 5650
278 Ga0501035_0002920 3300049822 Bacteria 16452
279 Ga0501035_0007854 3300049822 Bacteria 9973
280 Ga0501035_0021394 3300049822 Bacteria 5947
281 Ga0501035_0029262 3300049822 Bacteria 5023
282 Ga0501035_0054770 3300049822 Bacteria 3562
283 Ga0501035_0070971 3300049822 Bacteria 3084
284 Ga0501035_0100181 3300049822 Bacteria 2543
285 Ga0501035_0158372 3300049822 Bacteria 1961
286 Ga0501035_0256549 3300049822 Bacteria 1483
287 Ga0501044_0007758 3300049823 Bacteria 11798
288 Ga0501044_0016886 3300049823 Bacteria 7831
289 Ga0501044_0017267 3300049823 Bacteria 7740
290 Ga0501044_0048449 3300049823 Bacteria 4389
291 Ga0501044_0055576 3300049823 Bacteria 4066
292 Ga0501044_0071736 3300049823 Bacteria 3521
293 Ga0501044_0081119 3300049823 Bacteria 3284
294 Ga0501044_0266326 3300049823 Bacteria 1651
295 Ga0501045_0102259 3300049824 Bacteria 2122
296 Ga0500595_000081 3300053119 Bacteria 66983
297 Ga0500595_020791 3300053119 Bacteria 2353
298 Ga0500642_0029967 3300053130 Bacteria 2260
299 Ga0500559_0006724 3300053136 Bacteria 5166
300 Ga0500573_0000743 3300053140 Bacteria 14559
301 Ga0500619_002794 3300053154 Bacteria 3442
302 Ga0501084_0006811 3300054114 Bacteria 9401
303 Ga0501084_0010206 3300054114 Bacteria 7768
304 Ga0501084_0016992 3300054114 Bacteria 6045
305 Ga0501084_0128491 3300054114 Bacteria 2133
306 Ga0501082_0027077 3300060353 Bacteria 4940

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100041879 Ga0070665_1000418791 288
2 3300028379 Ga0268266_10281274 Ga0268266_102812741 288
3 3300026142 Ga0207698_10057447 Ga0207698_100574474 290
4 3300005563 Ga0068855_100144912 Ga0068855_1001449123 293
5 3300009093 Ga0105240_10007556 Ga0105240_100075563 293
6 3300025913 Ga0207695_10004655 Ga0207695_1000465517 293
7 3300006237 Ga0097621_100008509 Ga0097621_1000085096 296
8 3300046557 Ga0495622_0012147 Ga0495622_0012147_2552_3499 296
9 3300049581 Ga0501047_0019182 Ga0501047_0019182_2372_3310 296
10 3300049822 Ga0501035_0158372 Ga0501035_0158372_618_1556 296
11 3300049823 Ga0501044_0055576 Ga0501044_0055576_683_1621 296
12 3300005548 Ga0070665_100011790 Ga0070665_1000117909 301
13 3300028379 Ga0268266_10007100 Ga0268266_100071003 301
14 3300035113 Ga0373936_0060528 Ga0373936_0060528_290_1207 303
15 3300035170 Ga0373943_0005335 Ga0373943_0005335_4313_5230 303
16 3300035692 Ga0373935_0026912 Ga0373935_0026912_1342_2259 303
17 3300037068 Ga0373925_0003185 Ga0373925_0003185_5102_6019 303
18 3300005335 Ga0070666_10002989 Ga0070666_100029894 305
19 3300005367 Ga0070667_100089951 Ga0070667_1000899512 305
20 3300025903 Ga0207680_10001747 Ga0207680_100017474 305
21 3300028800 Ga0265338_10027507 Ga0265338_100275074 305
22 3300031241 Ga0265325_10001555 Ga0265325_1000155511 305
23 3300031249 Ga0265339_10002542 Ga0265339_100025429 305
24 3300031344 Ga0265316_10005099 Ga0265316_100050999 305
25 3300031595 Ga0265313_10003291 Ga0265313_1000329113 305
26 3300035086 Ga0373934_0049393 Ga0373934_0049393_256_1188 305
27 3300035111 Ga0373923_0063323 Ga0373923_0063323_57_989 305
28 3300035120 Ga0373957_0059121 Ga0373957_0059121_521_1453 305
29 3300035172 Ga0373955_0106248 Ga0373955_0106248_436_1368 305
30 3300035172 Ga0373955_0247074 Ga0373955_0247074_57_989 305
31 3300035691 Ga0373931_0067493 Ga0373931_0067493_807_1739 305
32 3300035724 Ga0373933_0072553 Ga0373933_0072553_337_1269 305
33 3300036401 Ga0373937_0011557 Ga0373937_0011557_4170_5102 305
34 3300046675 Ga0495657_0085415 Ga0495657_0085415_1076_2008 305
35 3300048088 Ga0495602_0193500 Ga0495602_0193500_543_1475 305
36 3300049822 Ga0501035_0021394 Ga0501035_0021394_1052_1987 306
37 3300003214 JGI25165J46597_1000008 JGI25165J46597_100000840 307
38 3300003215 JGI25153J46596_10000320 JGI25153J46596_1000032011 307
39 3300005327 Ga0070658_10302602 Ga0070658_103026022 307
40 3300005329 Ga0070683_100147446 Ga0070683_1001474462 307
41 3300005334 Ga0068869_100017540 Ga0068869_1000175402 307
42 3300005334 Ga0068869_100093646 Ga0068869_1000936462 307
43 3300005335 Ga0070666_10008352 Ga0070666_100083523 307
44 3300005336 Ga0070680_100000131 Ga0070680_10000013127 307
45 3300005339 Ga0070660_100004785 Ga0070660_1000047859 307
46 3300005341 Ga0070691_10127782 Ga0070691_101277822 307
47 3300005344 Ga0070661_100000372 Ga0070661_10000037228 307
48 3300005354 Ga0070675_100319529 Ga0070675_1003195291 307
49 3300005356 Ga0070674_100188674 Ga0070674_1001886742 307
50 3300005366 Ga0070659_100007210 Ga0070659_1000072102 307
51 3300005366 Ga0070659_100211594 Ga0070659_1002115942 307
52 3300005435 Ga0070714_100068613 Ga0070714_1000686133 307
53 3300005438 Ga0070701_10066651 Ga0070701_100666513 307
54 3300005455 Ga0070663_100081958 Ga0070663_1000819582 307
55 3300005456 Ga0070678_100068239 Ga0070678_1000682391 307
56 3300005456 Ga0070678_100075527 Ga0070678_1000755272 307
57 3300005457 Ga0070662_100057318 Ga0070662_1000573182 307
58 3300005458 Ga0070681_10000068 Ga0070681_100000685 307
59 3300005459 Ga0068867_100034500 Ga0068867_1000345003 307
60 3300005466 Ga0070685_10327248 Ga0070685_103272481 307
61 3300005530 Ga0070679_100028841 Ga0070679_1000288412 307
62 3300005530 Ga0070679_100037979 Ga0070679_1000379792 307
63 3300005530 Ga0070679_100062136 Ga0070679_1000621362 307
64 3300005530 Ga0070679_100597766 Ga0070679_1005977661 307
65 3300005539 Ga0068853_100047575 Ga0068853_1000475754 307
66 3300005543 Ga0070672_100450087 Ga0070672_1004500872 307
67 3300005548 Ga0070665_100030487 Ga0070665_1000304875 307
68 3300005548 Ga0070665_100038977 Ga0070665_1000389773 307
69 3300005563 Ga0068855_100000024 Ga0068855_100000024197 307
70 3300005563 Ga0068855_100008964 Ga0068855_1000089642 307
71 3300005563 Ga0068855_100015050 Ga0068855_1000150505 307
72 3300005563 Ga0068855_100152793 Ga0068855_1001527933 307
73 3300005614 Ga0068856_100043417 Ga0068856_1000434173 307
74 3300005614 Ga0068856_100162788 Ga0068856_1001627882 307
75 3300005614 Ga0068856_100352268 Ga0068856_1003522682 307
76 3300005617 Ga0068859_100154592 Ga0068859_1001545922 307
77 3300005841 Ga0068863_100056746 Ga0068863_1000567462 307
78 3300005842 Ga0068858_100010394 Ga0068858_1000103942 307
79 3300005842 Ga0068858_100024346 Ga0068858_1000243467 307
80 3300005843 Ga0068860_100351748 Ga0068860_1003517482 307
81 3300006237 Ga0097621_100000991 Ga0097621_1000009919 307
82 3300006237 Ga0097621_100281247 Ga0097621_1002812472 307
83 3300006237 Ga0097621_100425973 Ga0097621_1004259732 307
84 3300006237 Ga0097621_100434518 Ga0097621_1004345182 307
85 3300006358 Ga0068871_100001977 Ga0068871_10000197713 307
86 3300006931 Ga0097620_100154591 Ga0097620_1001545912 307
87 3300009093 Ga0105240_10027843 Ga0105240_100278433 307
88 3300009093 Ga0105240_10077756 Ga0105240_100777562 307
89 3300009093 Ga0105240_10182807 Ga0105240_101828074 307
90 3300009093 Ga0105240_10389863 Ga0105240_103898631 307
91 3300009098 Ga0105245_10182418 Ga0105245_101824184 307
92 3300009101 Ga0105247_10033563 Ga0105247_100335632 307
93 3300009148 Ga0105243_10013154 Ga0105243_100131545 307
94 3300009174 Ga0105241_10020611 Ga0105241_100206115 307
95 3300009176 Ga0105242_10049051 Ga0105242_100490513 307
96 3300009177 Ga0105248_10000009 Ga0105248_10000009122 307
97 3300009177 Ga0105248_10042176 Ga0105248_100421764 307
98 3300009177 Ga0105248_10147087 Ga0105248_101470872 307
99 3300009545 Ga0105237_10274059 Ga0105237_102740592 307
100 3300009551 Ga0105238_10021211 Ga0105238_100212114 307
101 3300009551 Ga0105238_10206222 Ga0105238_102062222 307
102 3300009551 Ga0105238_10585343 Ga0105238_105853431 307
103 3300009553 Ga0105249_10102329 Ga0105249_101023292 307
104 3300010375 Ga0105239_10012846 Ga0105239_1001284611 307
105 3300010375 Ga0105239_10023452 Ga0105239_100234529 307
106 3300010375 Ga0105239_10046475 Ga0105239_100464752 307
107 3300010375 Ga0105239_10116753 Ga0105239_101167532 307
108 3300013104 Ga0157370_10001401 Ga0157370_1000140115 307
109 3300013105 Ga0157369_10014650 Ga0157369_100146502 307
110 3300013105 Ga0157369_10042339 Ga0157369_100423396 307
111 3300013297 Ga0157378_10014467 Ga0157378_100144678 307
112 3300013306 Ga0163162_10415479 Ga0163162_104154792 307
113 3300013307 Ga0157372_10526560 Ga0157372_105265602 307
114 3300014325 Ga0163163_10000093 Ga0163163_1000009337 307
115 3300014968 Ga0157379_10003649 Ga0157379_1000364914 307
116 3300014968 Ga0157379_10332186 Ga0157379_103321862 307
117 3300021377 Ga0213874_10000506 Ga0213874_100005064 307
118 3300021377 Ga0213874_10003883 Ga0213874_100038832 307
119 3300021384 Ga0213876_10000985 Ga0213876_100009855 307
120 3300021384 Ga0213876_10009288 Ga0213876_100092884 307
121 3300025261 Ga0209233_1000006 Ga0209233_1000006988 307
122 3300025261 Ga0209233_1003150 Ga0209233_10031505 307
123 3300025297 Ga0209758_1000032 Ga0209758_1000032412 307
124 3300025900 Ga0207710_10026473 Ga0207710_100264733 307
125 3300025903 Ga0207680_10020057 Ga0207680_100200573 307
126 3300025909 Ga0207705_10015011 Ga0207705_100150113 307
127 3300025909 Ga0207705_10222441 Ga0207705_102224412 307
128 3300025912 Ga0207707_10000002 Ga0207707_100000021149 307
129 3300025913 Ga0207695_10000003 Ga0207695_10000003319 307
130 3300025913 Ga0207695_10026484 Ga0207695_100264842 307
131 3300025913 Ga0207695_10061543 Ga0207695_100615432 307
132 3300025914 Ga0207671_10123579 Ga0207671_101235793 307
133 3300025917 Ga0207660_10000230 Ga0207660_1000023015 307
134 3300025920 Ga0207649_10000632 Ga0207649_1000063218 307
135 3300025921 Ga0207652_10000464 Ga0207652_1000046414 307
136 3300025921 Ga0207652_10091789 Ga0207652_100917892 307
137 3300025921 Ga0207652_10379543 Ga0207652_103795432 307
138 3300025924 Ga0207694_10000016 Ga0207694_10000016289 307
139 3300025925 Ga0207650_10158197 Ga0207650_101581972 307
140 3300025929 Ga0207664_10048862 Ga0207664_100488622 307
141 3300025932 Ga0207690_10192083 Ga0207690_101920832 307
142 3300025933 Ga0207706_10078488 Ga0207706_100784882 307
143 3300025934 Ga0207686_10026185 Ga0207686_100261853 307
144 3300025935 Ga0207709_10018640 Ga0207709_100186402 307
145 3300025936 Ga0207670_10157468 Ga0207670_101574681 307
146 3300025941 Ga0207711_10000003 Ga0207711_10000003449 307
147 3300025941 Ga0207711_10000005 Ga0207711_10000005686 307
148 3300025941 Ga0207711_10000015 Ga0207711_10000015202 307
149 3300025941 Ga0207711_10039693 Ga0207711_100396935 307
150 3300025942 Ga0207689_10018498 Ga0207689_100184986 307
151 3300025945 Ga0207679_10267566 Ga0207679_102675662 307
152 3300025949 Ga0207667_10000021 Ga0207667_1000002158 307
153 3300025949 Ga0207667_10010181 Ga0207667_100101812 307
154 3300025981 Ga0207640_10300298 Ga0207640_103002982 307
155 3300026035 Ga0207703_10006959 Ga0207703_100069592 307
156 3300026035 Ga0207703_10049158 Ga0207703_100491583 307
157 3300026035 Ga0207703_10147938 Ga0207703_101479382 307
158 3300026067 Ga0207678_10094846 Ga0207678_100948462 307
159 3300026078 Ga0207702_10033676 Ga0207702_100336763 307
160 3300026078 Ga0207702_10674493 Ga0207702_106744931 307
161 3300026088 Ga0207641_10011965 Ga0207641_100119657 307
162 3300026089 Ga0207648_10005061 Ga0207648_100050615 307
163 3300026121 Ga0207683_10061656 Ga0207683_100616562 307
164 3300026142 Ga0207698_10095014 Ga0207698_100950142 307
165 3300028379 Ga0268266_10011865 Ga0268266_100118652 307
166 3300028381 Ga0268264_10146030 Ga0268264_101460302 307
167 3300028577 Ga0265318_10000021 Ga0265318_1000002191 307
168 3300028577 Ga0265318_10003325 Ga0265318_100033255 307
169 3300028800 Ga0265338_10000007 Ga0265338_10000007467 307
170 3300028800 Ga0265338_10001910 Ga0265338_1000191033 307
171 3300031240 Ga0265320_10065523 Ga0265320_100655232 307
172 3300031241 Ga0265325_10000001 Ga0265325_10000001319 307
173 3300031241 Ga0265325_10002618 Ga0265325_100026187 307
174 3300031249 Ga0265339_10000689 Ga0265339_1000068914 307
175 3300031249 Ga0265339_10034365 Ga0265339_100343653 307
176 3300031249 Ga0265339_10065321 Ga0265339_100653212 307
177 3300031250 Ga0265331_10000002 Ga0265331_1000000266 307
178 3300031250 Ga0265331_10000355 Ga0265331_1000035513 307
179 3300031250 Ga0265331_10003245 Ga0265331_100032455 307
180 3300031250 Ga0265331_10057336 Ga0265331_100573362 307
181 3300031250 Ga0265331_10095410 Ga0265331_100954102 307
182 3300031251 Ga0265327_10000033 Ga0265327_1000003365 307
183 3300031344 Ga0265316_10305852 Ga0265316_103058522 307
184 3300031595 Ga0265313_10002332 Ga0265313_1000233210 307
185 3300031595 Ga0265313_10005319 Ga0265313_1000531912 307
186 3300031595 Ga0265313_10007522 Ga0265313_100075222 307
187 3300031595 Ga0265313_10010805 Ga0265313_100108055 307
188 3300031711 Ga0265314_10006025 Ga0265314_100060256 307
189 3300031711 Ga0265314_10032495 Ga0265314_100324952 307
190 3300031711 Ga0265314_10044608 Ga0265314_100446081 307
191 3300031712 Ga0265342_10019393 Ga0265342_100193933 307
192 3300031712 Ga0265342_10033826 Ga0265342_100338262 307
193 3300031730 Ga0307516_10026049 Ga0307516_100260494 307
194 3300031730 Ga0307516_10077270 Ga0307516_100772703 307
195 3300036401 Ga0373937_0117634 Ga0373937_0117634_797_1735 307
196 3300039437 Ga0436365_1158121 Ga0436365_1158121_10734_11669 307
197 3300039437 Ga0436365_1935268 Ga0436365_1935268_9946_10890 307
198 3300039450 Ga0436363_0118447 Ga0436363_0118447_2109_3053 307
199 3300039450 Ga0436363_1490868 Ga0436363_1490868_5436_6383 307
200 3300046462 Ga0495651_0266596 Ga0495651_0266596_133_1134 307
201 3300046472 Ga0495580_0041028 Ga0495580_0041028_2053_2997 307
202 3300046473 Ga0495582_0043873 Ga0495582_0043873_655_1599 307
203 3300046477 Ga0495664_0058834 Ga0495664_0058834_265_1203 307
204 3300046529 Ga0495652_0195545 Ga0495652_0195545_337_1275 307
205 3300046535 Ga0495586_0094737 Ga0495586_0094737_209_1153 307
206 3300046538 Ga0495609_0012669 Ga0495609_0012669_617_1618 307
207 3300046543 Ga0495645_0291851 Ga0495645_0291851_99_1037 307
208 3300046615 Ga0495656_0064577 Ga0495656_0064577_282_1283 307
209 3300046678 Ga0495599_0089519 Ga0495599_0089519_196_1197 307
210 3300046683 Ga0495658_0000415 Ga0495658_0000415_14469_15413 307
211 3300047444 Ga0495675_0056953 Ga0495675_0056953_460_1398 307
212 3300048924 Ga0496121_0000465 Ga0496121_0000465_30858_31787 307
213 3300048929 Ga0496126_0001966 Ga0496126_0001966_4372_5319 307
214 3300049460 Ga0495682_0006333 Ga0495682_0006333_369_1313 307
215 3300049568 Ga0501031_0011092 Ga0501031_0011092_1257_2195 307
216 3300049568 Ga0501031_0056833 Ga0501031_0056833_235_1194 307
217 3300049569 Ga0501032_0008815 Ga0501032_0008815_5477_6415 307
218 3300049569 Ga0501032_0032998 Ga0501032_0032998_883_1821 307
219 3300049569 Ga0501032_0051267 Ga0501032_0051267_1641_2600 307
220 3300049570 Ga0501033_0006278 Ga0501033_0006278_6274_7197 307
221 3300049570 Ga0501033_0009798 Ga0501033_0009798_938_1876 307
222 3300049570 Ga0501033_0015791 Ga0501033_0015791_1138_2100 307
223 3300049570 Ga0501033_0022511 Ga0501033_0022511_1027_1959 307
224 3300049570 Ga0501033_0027688 Ga0501033_0027688_1263_2189 307
225 3300049570 Ga0501033_0197347 Ga0501033_0197347_149_1108 307
226 3300049571 Ga0501034_0007184 Ga0501034_0007184_2405_3343 307
227 3300049571 Ga0501034_0008502 Ga0501034_0008502_1439_2398 307
228 3300049571 Ga0501034_0117257 Ga0501034_0117257_810_1784 307
229 3300049571 Ga0501034_0237970 Ga0501034_0237970_722_1660 307
230 3300049572 Ga0501036_0009629 Ga0501036_0009629_6014_6952 307
231 3300049572 Ga0501036_0053935 Ga0501036_0053935_2324_3283 307
232 3300049573 Ga0501037_0003022 Ga0501037_0003022_5124_6062 307
233 3300049573 Ga0501037_0013844 Ga0501037_0013844_4833_5759 307
234 3300049573 Ga0501037_0077861 Ga0501037_0077861_181_1125 307
235 3300049574 Ga0501038_0013629 Ga0501038_0013629_5474_6412 307
236 3300049574 Ga0501038_0025517 Ga0501038_0025517_370_1323 307
237 3300049575 Ga0501039_0002592 Ga0501039_0002592_9623_10561 307
238 3300049578 Ga0501042_0020140 Ga0501042_0020140_99_1037 307
239 3300049579 Ga0501043_0007594 Ga0501043_0007594_1158_2096 307
240 3300049579 Ga0501043_0024738 Ga0501043_0024738_1106_2044 307
241 3300049579 Ga0501043_0027271 Ga0501043_0027271_876_1835 307
242 3300049580 Ga0501046_0001103 Ga0501046_0001103_1158_2096 307
243 3300049580 Ga0501046_0016969 Ga0501046_0016969_4323_5258 307
244 3300049580 Ga0501046_0036004 Ga0501046_0036004_911_1855 307
245 3300049581 Ga0501047_0002316 Ga0501047_0002316_5631_6569 307
246 3300049581 Ga0501047_0012663 Ga0501047_0012663_4189_5112 307
247 3300049581 Ga0501047_0016425 Ga0501047_0016425_6011_6970 307
248 3300049581 Ga0501047_0016454 Ga0501047_0016454_4965_5903 307
249 3300049581 Ga0501047_0021125 Ga0501047_0021125_1439_2362 307
250 3300049581 Ga0501047_0040350 Ga0501047_0040350_1466_2404 307
251 3300049581 Ga0501047_0075544 Ga0501047_0075544_2107_3042 307
252 3300049581 Ga0501047_0109485 Ga0501047_0109485_1419_2372 307
253 3300049581 Ga0501047_0136251 Ga0501047_0136251_587_1525 307
254 3300049581 Ga0501047_0485193 Ga0501047_0485193_73_999 307
255 3300049582 Ga0501048_0005299 Ga0501048_0005299_1220_2158 307
256 3300049583 Ga0501067_0001062 Ga0501067_0001062_3306_4244 307
257 3300049583 Ga0501067_0002155 Ga0501067_0002155_1201_2139 307
258 3300049583 Ga0501067_0002711 Ga0501067_0002711_7550_8488 307
259 3300049584 Ga0501068_0016148 Ga0501068_0016148_1896_2834 307
260 3300049585 Ga0501069_0003041 Ga0501069_0003041_4989_5927 307
261 3300049585 Ga0501069_0063464 Ga0501069_0063464_838_1776 307
262 3300049585 Ga0501069_0065691 Ga0501069_0065691_574_1533 307
263 3300049586 Ga0501070_0004951 Ga0501070_0004951_5750_6688 307
264 3300049586 Ga0501070_0034929 Ga0501070_0034929_2266_3204 307
265 3300049589 Ga0501073_0003745 Ga0501073_0003745_9328_10266 307
266 3300049589 Ga0501073_0009928 Ga0501073_0009928_3569_4528 307
267 3300049589 Ga0501073_0016988 Ga0501073_0016988_344_1282 307
268 3300049589 Ga0501073_0035479 Ga0501073_0035479_2084_3022 307
269 3300049590 Ga0501074_0005025 Ga0501074_0005025_2405_3343 307
270 3300049590 Ga0501074_0053745 Ga0501074_0053745_782_1720 307
271 3300049741 Ga0501079_0003337 Ga0501079_0003337_5043_5981 307
272 3300049742 Ga0501080_0037775 Ga0501080_0037775_3080_4039 307
273 3300049742 Ga0501080_0103553 Ga0501080_0103553_1352_2290 307
274 3300049742 Ga0501080_0133852 Ga0501080_0133852_683_1621 307
275 3300049742 Ga0501080_0181314 Ga0501080_0181314_222_1181 307
276 3300049742 Ga0501080_0218607 Ga0501080_0218607_393_1346 307
277 3300049742 Ga0501080_0400091 Ga0501080_0400091_25_963 307
278 3300049744 Ga0501083_0001440 Ga0501083_0001440_12531_13469 307
279 3300049744 Ga0501083_0013520 Ga0501083_0013520_259_1215 307
280 3300049744 Ga0501083_0013788 Ga0501083_0013788_1000_1926 307
281 3300049822 Ga0501035_0002920 Ga0501035_0002920_7421_8359 307
282 3300049822 Ga0501035_0007854 Ga0501035_0007854_5704_6630 307
283 3300049822 Ga0501035_0029262 Ga0501035_0029262_1099_2022 307
284 3300049822 Ga0501035_0054770 Ga0501035_0054770_1467_2405 307
285 3300049822 Ga0501035_0070971 Ga0501035_0070971_146_1084 307
286 3300049822 Ga0501035_0100181 Ga0501035_0100181_1164_2123 307
287 3300049822 Ga0501035_0256549 Ga0501035_0256549_288_1250 307
288 3300049823 Ga0501044_0007758 Ga0501044_0007758_7047_7973 307
289 3300049823 Ga0501044_0016886 Ga0501044_0016886_3569_4528 307
290 3300049823 Ga0501044_0017267 Ga0501044_0017267_5556_6500 307
291 3300049823 Ga0501044_0048449 Ga0501044_0048449_2627_3565 307
292 3300049823 Ga0501044_0071736 Ga0501044_0071736_1642_2577 307
293 3300049823 Ga0501044_0081119 Ga0501044_0081119_1069_2040 307
294 3300049823 Ga0501044_0266326 Ga0501044_0266326_673_1596 307
295 3300049824 Ga0501045_0102259 Ga0501045_0102259_879_1817 307
296 3300053119 Ga0500595_000081 Ga0500595_000081_10870_11895 307
297 3300053119 Ga0500595_020791 Ga0500595_020791_1351_2274 307
298 3300053130 Ga0500642_0029967 Ga0500642_0029967_795_1718 307
299 3300053136 Ga0500559_0006724 Ga0500559_0006724_3386_4339 307
300 3300053140 Ga0500573_0000743 Ga0500573_0000743_4191_5186 307
301 3300053154 Ga0500619_002794 Ga0500619_002794_559_1503 307
302 3300054114 Ga0501084_0006811 Ga0501084_0006811_3468_4406 307
303 3300054114 Ga0501084_0010206 Ga0501084_0010206_4035_4973 307
304 3300054114 Ga0501084_0016992 Ga0501084_0016992_4767_5711 307
305 3300054114 Ga0501084_0128491 Ga0501084_0128491_460_1395 307
306 3300060353 Ga0501082_0027077 Ga0501082_0027077_3607_4545 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

22

178

0.93

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

19

203

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pe4-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp-glucose 0.8328 2 212
7pdo-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp 0.8285 2 212
7p8g-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 - apo form 0.8257 2 212
7pvl-assembly1.cif.gz_B crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 8.5 - apo form 0.8226 2 212
7pd5-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with 4-aminobenzoic acid 0.8206 2 212
ID Description Score Start End Superfamily
af_K7MVE2_46_307_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8286 2 203 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8276 3 212 3.90.550.10
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8238 2 212 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8231 5 219 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8114 3 214 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A1H4D4V8-F1-model_v4 Glycosyl transferase family 2 0.9942 1 82 GO:0016757
AF-K0JF78-F1-model_v4 Family 2 glycosyltransferase 0.9875 1 76 GO:0016757
AF-P37786-F1-model_v4 Protein RfbJ 0.9807 2 123 GO:0009103
GO:0016757
AF-A0A3D1Q3F0-F1-model_v4 deleted 0.9693 2 102
AF-K0JF78-F1-model_v4 Family 2 glycosyltransferase 0.9625 1 76 GO:0016757

Feature Viewer

pLDDT pTM Quality
80.65 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map