F398520

General Info

Members Datasets Scaffolds Average Seq Length
306 191 612 112

Family's Representative Sequence

Representative Sequence 3300005438|Ga0070701_10057270|Ga0070701_100572703
Length 126
Sequence MIFWSSLASVPKKGVTALEADLLQGTLDLLVLKALAPGPAHGHAIAHLIEKRSDEVLQVEHGSLYPALHRLEDRGWLASFWGTSENNRKARYYRLTPRGRRQLASQAGRWAEIVAAVNRVLRPASD

Samples

Sample ID Description Type Environment
1 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
112 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
113 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
114 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
115 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
116 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
186 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
188 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.9
Nodule 0
Rhizoplane 1.96
Rhizosphere 92.81
Stem 0
Stem Tuber 0
Unclassified 29.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070701_10057270 3300005438 Bacteria 2042
2 rootH2_10039239 3300003320 Bacteria 5609
3 Ga0070690_100057505 3300005330 Bacteria 2496
4 Ga0070670_100381869 3300005331 Bacteria 1241
5 Ga0070677_10226266 3300005333 Unclassified 916
6 Ga0068869_101545102 3300005334 Unclassified 590
7 Ga0070666_10008337 3300005335 Bacteria 6428
8 Ga0070675_101032398 3300005354 Unclassified 755
9 Ga0070675_101330732 3300005354 Unclassified 662
10 Ga0070673_101541217 3300005364 Bacteria 627
11 Ga0070709_10158771 3300005434 Bacteria 1570
12 Ga0070713_100223761 3300005436 Bacteria 1708
13 Ga0070701_10357259 3300005438 Bacteria 914
14 Ga0070711_100005590 3300005439 Bacteria 7524
15 Ga0070705_100657254 3300005440 Bacteria 818
16 Ga0070705_100824729 3300005440 Unclassified 740
17 Ga0070662_100722811 3300005457 Bacteria 843
18 Ga0070681_10170499 3300005458 Unclassified 2098
19 Ga0070706_100179625 3300005467 Unclassified 1976
20 Ga0070706_100810040 3300005467 Bacteria 867
21 Ga0070707_100104566 3300005468 Bacteria 2745
22 Ga0070707_100543661 3300005468 Unclassified 1124
23 Ga0070698_101154103 3300005471 Unclassified 724
24 Ga0070699_100142134 3300005518 Bacteria 2120
25 Ga0070686_100000983 3300005544 Bacteria 16449
26 Ga0070695_101419508 3300005545 Bacteria 576
27 Ga0070696_100332629 3300005546 Unclassified 1172
28 Ga0070696_101072257 3300005546 Bacteria 676
29 Ga0070693_101215232 3300005547 Unclassified 579
30 Ga0070704_100196996 3300005549 Unclassified 1623
31 Ga0068854_100005556 3300005578 Bacteria 7966
32 Ga0068854_100233468 3300005578 Bacteria 1461
33 Ga0068859_100275468 3300005617 Unclassified 1775
34 Ga0068861_100206492 3300005719 Bacteria 1652
35 Ga0068863_100746752 3300005841 Bacteria 974
36 Ga0068863_101620941 3300005841 Unclassified 656
37 Ga0068858_100728223 3300005842 Unclassified 966
38 Ga0068858_102074166 3300005842 Unclassified 562
39 Ga0068860_100012939 3300005843 Bacteria 8197
40 Ga0068860_100101207 3300005843 Bacteria 2749
41 Ga0068860_100315679 3300005843 Bacteria 1533
42 Ga0081539_10042536 3300005985 Bacteria 2644
43 Ga0070717_10361238 3300006028 Bacteria 1300
44 Ga0070717_11227401 3300006028 Bacteria 682
45 Ga0075368_10073744 3300006042 Bacteria 1382
46 Ga0075364_10448156 3300006051 Bacteria 882
47 Ga0070715_10063320 3300006163 Unclassified 1630
48 Ga0070716_101071599 3300006173 Bacteria 641
49 Ga0070712_100781475 3300006175 Bacteria 818
50 Ga0075367_10013819 3300006178 Bacteria 4354
51 Ga0075367_10525240 3300006178 Bacteria 751
52 Ga0075366_10281050 3300006195 Bacteria 1017
53 Ga0097621_100952676 3300006237 Bacteria 801
54 Ga0068871_100502532 3300006358 Bacteria 1093
55 Ga0075428_100006094 3300006844 Bacteria 13410
56 Ga0075428_100032073 3300006844 Bacteria 5804
57 Ga0075428_100161787 3300006844 Bacteria 2430
58 Ga0075428_100376672 3300006844 Bacteria 1522
59 Ga0075428_100566387 3300006844 Bacteria 1214
60 Ga0075428_101370898 3300006844 Unclassified 743
61 Ga0075430_100191422 3300006846 Bacteria 1700
62 Ga0075430_100878435 3300006846 Bacteria 739
63 Ga0075431_100001196 3300006847 Bacteria 23407
64 Ga0075431_100007466 3300006847 Bacteria 10886
65 Ga0075431_100393805 3300006847 Bacteria 1387
66 Ga0075431_100633406 3300006847 Bacteria 1051
67 Ga0075431_100945430 3300006847 Bacteria 830
68 Ga0075431_101341020 3300006847 Bacteria 676
69 Ga0075433_10004203 3300006852 Bacteria 11174
70 Ga0075434_100000291 3300006871 Bacteria 35535
71 Ga0075434_100076463 3300006871 Bacteria 3343
72 Ga0075434_100361199 3300006871 Bacteria 1473
73 Ga0075434_101774185 3300006871 Unclassified 624
74 Ga0075429_100002437 3300006880 Bacteria 15659
75 Ga0075429_100203882 3300006880 Bacteria 1733
76 Ga0075429_100263267 3300006880 Unclassified 1510
77 Ga0075429_100543623 3300006880 Unclassified 1018
78 Ga0075429_100792297 3300006880 Unclassified 830
79 Ga0075429_101700036 3300006880 Bacteria 548
80 Ga0068865_100375607 3300006881 Bacteria 1158
81 Ga0075436_100000967 3300006914 Bacteria 19280
82 Ga0075436_100018497 3300006914 Bacteria 4769
83 Ga0075436_100973359 3300006914 Bacteria 636
84 Ga0097620_100275480 3300006931 Unclassified 1775
85 Ga0075435_100000323 3300007076 Bacteria 29402
86 Ga0075435_100054509 3300007076 Bacteria 3227
87 Ga0075435_100512136 3300007076 Unclassified 1038
88 Ga0075435_100615231 3300007076 Bacteria 942
89 Ga0075435_100967220 3300007076 Unclassified 743
90 Ga0111539_10005807 3300009094 Bacteria 15953
91 Ga0111539_10315995 3300009094 Bacteria 1818
92 Ga0111539_12414648 3300009094 Bacteria 610
93 Ga0105245_10126971 3300009098 Bacteria 2388
94 Ga0105245_12535141 3300009098 Unclassified 566
95 Ga0114129_10022329 3300009147 Bacteria 8982
96 Ga0114129_10034029 3300009147 Bacteria 7197
97 Ga0114129_11252539 3300009147 Unclassified 921
98 Ga0114129_12787729 3300009147 Unclassified 581
99 Ga0114129_12851678 3300009147 Bacteria 573
100 Ga0105243_10664861 3300009148 Unclassified 1011
101 Ga0105241_10471175 3300009174 Bacteria 1114
102 Ga0105248_10009350 3300009177 Bacteria 10789
103 Ga0105248_10095717 3300009177 Bacteria 3343
104 Ga0105248_10369978 3300009177 Unclassified 1614
105 Ga0105248_10838349 3300009177 Bacteria 1038
106 Ga0105248_12183446 3300009177 Unclassified 630
107 Ga0105249_10957350 3300009553 Unclassified 924
108 Ga0105239_10077745 3300010375 Bacteria 3652
109 Ga0105239_10705972 3300010375 Unclassified 1153
110 Ga0105246_11637387 3300011119 Unclassified 609
111 Ga0157378_10000114 3300013297 Bacteria 77298
112 Ga0157378_10138842 3300013297 Bacteria 2255
113 Ga0157378_10563354 3300013297 Unclassified 1146
114 Ga0163162_10108617 3300013306 Unclassified 2871
115 Ga0163162_10704242 3300013306 Bacteria 1131
116 Ga0157375_11588305 3300013308 Bacteria 773
117 Ga0157375_11855779 3300013308 Unclassified 715
118 Ga0163163_10000221 3300014325 Bacteria 58503
119 Ga0157380_10046729 3300014326 Bacteria 3402
120 Ga0157380_11525671 3300014326 Unclassified 722
121 Ga0157379_10221353 3300014968 Bacteria 1715
122 Ga0157379_10663262 3300014968 Unclassified 977
123 Ga0209233_1003724 3300025261 Bacteria 5326
124 Ga0207682_10134675 3300025893 Bacteria 1105
125 Ga0207680_10051762 3300025903 Bacteria 2457
126 Ga0207699_10138661 3300025906 Bacteria 1596
127 Ga0207699_10184403 3300025906 Bacteria 1404
128 Ga0207684_10049899 3300025910 Unclassified 3550
129 Ga0207707_10229422 3300025912 Unclassified 1616
130 Ga0207695_11549362 3300025913 Bacteria 543
131 Ga0207693_10725487 3300025915 Bacteria 769
132 Ga0207663_10064774 3300025916 Bacteria 2333
133 Ga0207660_10241546 3300025917 Bacteria 1423
134 Ga0207657_10571951 3300025919 Bacteria 883
135 Ga0207646_10529401 3300025922 Unclassified 1061
136 Ga0207646_10609422 3300025922 Bacteria 980
137 Ga0207681_10670579 3300025923 Bacteria 861
138 Ga0207659_11574907 3300025926 Bacteria 561
139 Ga0207687_10081656 3300025927 Bacteria 2336
140 Ga0207700_10342292 3300025928 Bacteria 1300
141 Ga0207706_10751730 3300025933 Bacteria 831
142 Ga0207704_10325499 3300025938 Bacteria 1187
143 Ga0207711_10007580 3300025941 Bacteria 9080
144 Ga0207711_10046461 3300025941 Bacteria 3710
145 Ga0207711_11277964 3300025941 Unclassified 676
146 Ga0207667_10336066 3300025949 Bacteria 1542
147 Ga0207651_11578298 3300025960 Bacteria 591
148 Ga0207640_11841365 3300025981 Bacteria 547
149 Ga0207703_10563702 3300026035 Unclassified 1075
150 Ga0207703_10647045 3300026035 Unclassified 1003
151 Ga0207703_11741204 3300026035 Bacteria 599
152 Ga0207639_11408882 3300026041 Bacteria 654
153 Ga0207641_10060749 3300026088 Bacteria 3222
154 Ga0207641_10669781 3300026088 Bacteria 1020
155 Ga0207641_11006962 3300026088 Unclassified 830
156 Ga0207675_100111300 3300026118 Bacteria 2584
157 Ga0207675_100886370 3300026118 Bacteria 908
158 Ga0209813_10071076 3300027866 Bacteria 1132
159 Ga0207428_10026186 3300027907 Bacteria 4870
160 Ga0268264_10015391 3300028381 Bacteria 6272
161 Ga0268264_10499798 3300028381 Bacteria 1186
162 Ga0265325_10030417 3300031241 Bacteria 2895
163 Ga0316579_10143183 3300031691 Bacteria 1153
164 Ga0316576_10524509 3300031727 Bacteria 870
165 Ga0316577_10116341 3300031733 Bacteria 1501
166 Ga0307407_10578064 3300031903 Unclassified 834
167 Ga0307412_11670018 3300031911 Unclassified 583
168 Ga0307409_100321056 3300031995 Unclassified 1449
169 Ga0307416_100254094 3300032002 Unclassified 1713
170 Ga0307414_11594772 3300032004 Unclassified 608
171 Ga0307415_101153256 3300032126 Unclassified 728
172 Ga0373936_0521458 3300035113 Bacteria 554
173 Ga0373943_0588592 3300035170 Bacteria 655
174 Ga0316574_0373583 3300035398 Bacteria 900
175 Ga0373947_0152772 3300035725 Bacteria 1488
176 Ga0373937_1450312 3300036401 Bacteria 634
177 Ga0316582_0061991 3300036647 Bacteria 2400
178 Ga0316584_0186323 3300036712 Bacteria 1535
179 Ga0439450_015864 3300042008 Bacteria 1550
180 Ga0439446_0055029 3300042156 Bacteria 1194
181 Ga0439435_0067511 3300042436 Unclassified 1053
182 Ga0439444_0032711 3300042437 Unclassified 985
183 Ga0466963_0184604 3300044694 Bacteria 1456
184 Ga0451576_0054148 3300045051 Bacteria 4201
185 Ga0466958_0201815 3300045836 Bacteria 1266
186 Ga0495592_0000437 3300046454 Bacteria 31326
187 Ga0495653_0336941 3300046463 Unclassified 973
188 Ga0495580_0681532 3300046472 Unclassified 674
189 Ga0495662_0133581 3300046476 Bacteria 1220
190 Ga0495664_0008346 3300046477 Bacteria 5776
191 Ga0495664_0366091 3300046477 Unclassified 867
192 Ga0495618_0011907 3300046514 Bacteria 5278
193 Ga0495628_0000054 3300046516 Bacteria 90760
194 Ga0495628_0599113 3300046516 Bacteria 787
195 Ga0495628_0611767 3300046516 Bacteria 777
196 Ga0495630_0015596 3300046517 Bacteria 5552
197 Ga0495666_0092153 3300046526 Bacteria 1430
198 Ga0495652_0975177 3300046529 Bacteria 556
199 Ga0495640_0029838 3300046533 Bacteria 3909
200 Ga0495640_0895327 3300046533 Bacteria 526
201 Ga0495586_0002028 3300046535 Bacteria 10998
202 Ga0495587_0041369 3300046536 Unclassified 2750
203 Ga0495645_0001578 3300046543 Bacteria 15432
204 Ga0495645_0102663 3300046543 Bacteria 2032
205 Ga0495645_0112650 3300046543 Unclassified 1923
206 Ga0495667_0744015 3300046559 Bacteria 606
207 Ga0495634_0072331 3300046642 Bacteria 2268
208 Ga0495625_0586711 3300046660 Unclassified 671
209 Ga0495635_0622650 3300046663 Bacteria 704
210 Ga0495599_0004008 3300046678 Bacteria 8676
211 Ga0495599_0048254 3300046678 Bacteria 2669
212 Ga0495599_0273650 3300046678 Bacteria 1024
213 Ga0495623_0114512 3300046679 Unclassified 1630
214 Ga0495674_0011009 3300047319 Bacteria 8542
215 Ga0495674_0656542 3300047319 Unclassified 826
216 Ga0495672_0092214 3300047320 Unclassified 1661
217 Ga0495680_0095359 3300047322 Bacteria 2224
218 Ga0495675_0163475 3300047444 Bacteria 1370
219 Ga0495602_0219759 3300048088 Bacteria 1435
220 Ga0496100_0916689 3300048903 Bacteria 688
221 Ga0496102_0012320 3300048905 Bacteria 7396
222 Ga0496102_0420614 3300048905 Bacteria 1255
223 Ga0496106_0070167 3300048909 Unclassified 2676
224 Ga0496106_0427173 3300048909 Unclassified 1065
225 Ga0496112_0312647 3300048915 Unclassified 1516
226 Ga0501031_0155540 3300049568 Unclassified 1494
227 Ga0501036_0129770 3300049572 Bacteria 2128
228 Ga0501039_0070900 3300049575 Unclassified 2707
229 Ga0501039_1361953 3300049575 Unclassified 547
230 Ga0501040_0001914 3300049576 Bacteria 13378
231 Ga0501040_0414410 3300049576 Bacteria 968
232 Ga0501040_0639881 3300049576 Unclassified 769
233 Ga0501042_0125188 3300049578 Bacteria 1850
234 Ga0501042_0640452 3300049578 Bacteria 773
235 Ga0501043_0188309 3300049579 Unclassified 1606
236 Ga0501046_0475895 3300049580 Unclassified 896
237 Ga0501048_0928372 3300049582 Unclassified 626
238 Ga0501068_0899423 3300049584 Unclassified 582
239 Ga0501068_1108949 3300049584 Unclassified 523
240 Ga0501071_0001203 3300049587 Bacteria 14627
241 Ga0501071_0695849 3300049587 Bacteria 783
242 Ga0501072_0424080 3300049588 Bacteria 1054
243 Ga0501072_0720090 3300049588 Unclassified 784
244 Ga0501075_0653568 3300049591 Unclassified 801
245 Ga0501075_0678511 3300049591 Bacteria 785
246 Ga0501076_0000859 3300049592 Bacteria 19720
247 Ga0501076_0146915 3300049592 Unclassified 1917
248 Ga0501076_0420841 3300049592 Bacteria 1099
249 Ga0501076_0491680 3300049592 Bacteria 1011
250 Ga0501076_0553860 3300049592 Bacteria 948
251 Ga0501076_1561523 3300049592 Bacteria 542
252 Ga0501077_0114833 3300049593 Bacteria 1707
253 Ga0501243_064740 3300049675 Unclassified 684
254 Ga0501079_0006423 3300049741 Bacteria 8826
255 Ga0501079_1293170 3300049741 Bacteria 574
256 Ga0501081_1014433 3300049743 Bacteria 627
257 Ga0501083_0064053 3300049744 Bacteria 2451
258 Ga0501035_0608059 3300049822 Bacteria 890
259 Ga0501045_0003485 3300049824 Bacteria 10764
260 nmdc:mga00v17_276549_c1 3300050491 Bacteria 1090
261 nmdc:mga0k408_129265_c1 3300050493 Bacteria 1499
262 nmdc:mga06z11_298317_c1 3300050494 Bacteria 958
263 nmdc:mga04h51_84963_c1 3300050495 Bacteria 1130
264 nmdc:mga05p37_299592_c1 3300050507 Unclassified 1911
265 nmdc:mga05p37_63602_c1 3300050507 Bacteria 4541
266 nmdc:mga05p37_691196_c1 3300050507 Bacteria 1135
267 nmdc:mga09592_535090_c1 3300050508 Unclassified 1007
268 nmdc:mga09592_689010_c1 3300050508 Unclassified 870
269 nmdc:mga09592_9902_c1 3300050508 Bacteria 7752
270 nmdc:mga0qj67_180735_c1 3300050509 Bacteria 1713
271 nmdc:mga06r32_1211092_c1 3300050510 Unclassified 701
272 nmdc:mga06r32_13989_c1 3300050510 Bacteria 7278
273 nmdc:mga06r32_2032253_c1 3300050510 Bacteria 508
274 nmdc:mga06r32_4037_c1 3300050510 Bacteria 13162
275 nmdc:mga06r32_716757_c1 3300050510 Unclassified 965
276 nmdc:mga06r32_863251_c1 3300050510 Bacteria 863
277 nmdc:mga08y16_22278_c1 3300050511 Bacteria 6685
278 nmdc:mga0n895_1563254_c1 3300050512 Unclassified 625
279 nmdc:mga0n895_180_c1 3300050512 Bacteria 38903
280 nmdc:mga0n895_3532_c1 3300050512 Bacteria 12641
281 nmdc:mga0n895_442258_c1 3300050512 Bacteria 1313
282 nmdc:mga0rr50_10151_c1 3300050513 Bacteria 5961
283 nmdc:mga0rr50_1253730_c1 3300050513 Unclassified 629
284 nmdc:mga0rr50_16_c1 3300050513 Bacteria 175739
285 nmdc:mga0rr50_283795_c1 3300050513 Bacteria 1382
286 nmdc:mga0rr50_878701_c1 3300050513 Unclassified 764
287 nmdc:mga08x19_233114_c1 3300050514 Bacteria 1267
288 nmdc:mga08x19_298_c1 3300050514 Bacteria 36542
289 nmdc:mga0a205_1308_c1 3300050515 Bacteria 20935
290 nmdc:mga0a205_269911_c1 3300050515 Bacteria 1578
291 Ga0495601_0056001 3300053077 Unclassified 2497
292 Ga0495601_0485018 3300053077 Bacteria 798
293 Ga0495612_0087223 3300053078 Bacteria 1317
294 Ga0495619_0049153 3300053085 Bacteria 2781
295 Ga0500555_001279 3300053103 Bacteria 8026
296 Ga0500568_0035950 3300053139 Bacteria 2018
297 Ga0500645_000085 3300053730 Bacteria 75142
298 Ga0500552_084545 3300053733 Bacteria 586
299 Ga0501084_0099932 3300054114 Bacteria 2436
300 Ga0501084_0146506 3300054114 Bacteria 1989
301 Ga0501084_1847270 3300054114 Bacteria 504
302 Ga0501082_0037892 3300060353 Bacteria 4158
303 Ga0501082_0228903 3300060353 Bacteria 1618
304 Ga0501082_0989641 3300060353 Unclassified 735
305 Ga0530510_0003094 3300061734 Bacteria 11425
306 Ga0530510_0007763 3300061734 Bacteria 7476
307 Ga0070701_10057270
308 rootH2_10039239
309 Ga0070690_100057505
310 Ga0070670_100381869
311 Ga0070677_10226266
312 Ga0068869_101545102
313 Ga0070666_10008337
314 Ga0070675_101032398
315 Ga0070675_101330732
316 Ga0070673_101541217
317 Ga0070709_10158771
318 Ga0070713_100223761
319 Ga0070701_10357259
320 Ga0070711_100005590
321 Ga0070705_100657254
322 Ga0070705_100824729
323 Ga0070662_100722811
324 Ga0070681_10170499
325 Ga0070706_100179625
326 Ga0070706_100810040
327 Ga0070707_100104566
328 Ga0070707_100543661
329 Ga0070698_101154103
330 Ga0070699_100142134
331 Ga0070686_100000983
332 Ga0070695_101419508
333 Ga0070696_100332629
334 Ga0070696_101072257
335 Ga0070693_101215232
336 Ga0070704_100196996
337 Ga0068854_100005556
338 Ga0068854_100233468
339 Ga0068859_100275468
340 Ga0068861_100206492
341 Ga0068863_100746752
342 Ga0068863_101620941
343 Ga0068858_100728223
344 Ga0068858_102074166
345 Ga0068860_100012939
346 Ga0068860_100101207
347 Ga0068860_100315679
348 Ga0081539_10042536
349 Ga0070717_10361238
350 Ga0070717_11227401
351 Ga0075368_10073744
352 Ga0075364_10448156
353 Ga0070715_10063320
354 Ga0070716_101071599
355 Ga0070712_100781475
356 Ga0075367_10013819
357 Ga0075367_10525240
358 Ga0075366_10281050
359 Ga0097621_100952676
360 Ga0068871_100502532
361 Ga0075428_100006094
362 Ga0075428_100032073
363 Ga0075428_100161787
364 Ga0075428_100376672
365 Ga0075428_100566387
366 Ga0075428_101370898
367 Ga0075430_100191422
368 Ga0075430_100878435
369 Ga0075431_100001196
370 Ga0075431_100007466
371 Ga0075431_100393805
372 Ga0075431_100633406
373 Ga0075431_100945430
374 Ga0075431_101341020
375 Ga0075433_10004203
376 Ga0075434_100000291
377 Ga0075434_100076463
378 Ga0075434_100361199
379 Ga0075434_101774185
380 Ga0075429_100002437
381 Ga0075429_100203882
382 Ga0075429_100263267
383 Ga0075429_100543623
384 Ga0075429_100792297
385 Ga0075429_101700036
386 Ga0068865_100375607
387 Ga0075436_100000967
388 Ga0075436_100018497
389 Ga0075436_100973359
390 Ga0097620_100275480
391 Ga0075435_100000323
392 Ga0075435_100054509
393 Ga0075435_100512136
394 Ga0075435_100615231
395 Ga0075435_100967220
396 Ga0111539_10005807
397 Ga0111539_10315995
398 Ga0111539_12414648
399 Ga0105245_10126971
400 Ga0105245_12535141
401 Ga0114129_10022329
402 Ga0114129_10034029
403 Ga0114129_11252539
404 Ga0114129_12787729
405 Ga0114129_12851678
406 Ga0105243_10664861
407 Ga0105241_10471175
408 Ga0105248_10009350
409 Ga0105248_10095717
410 Ga0105248_10369978
411 Ga0105248_10838349
412 Ga0105248_12183446
413 Ga0105249_10957350
414 Ga0105239_10077745
415 Ga0105239_10705972
416 Ga0105246_11637387
417 Ga0157378_10000114
418 Ga0157378_10138842
419 Ga0157378_10563354
420 Ga0163162_10108617
421 Ga0163162_10704242
422 Ga0157375_11588305
423 Ga0157375_11855779
424 Ga0163163_10000221
425 Ga0157380_10046729
426 Ga0157380_11525671
427 Ga0157379_10221353
428 Ga0157379_10663262
429 Ga0209233_1003724
430 Ga0207682_10134675
431 Ga0207680_10051762
432 Ga0207699_10138661
433 Ga0207699_10184403
434 Ga0207684_10049899
435 Ga0207707_10229422
436 Ga0207695_11549362
437 Ga0207693_10725487
438 Ga0207663_10064774
439 Ga0207660_10241546
440 Ga0207657_10571951
441 Ga0207646_10529401
442 Ga0207646_10609422
443 Ga0207681_10670579
444 Ga0207659_11574907
445 Ga0207687_10081656
446 Ga0207700_10342292
447 Ga0207706_10751730
448 Ga0207704_10325499
449 Ga0207711_10007580
450 Ga0207711_10046461
451 Ga0207711_11277964
452 Ga0207667_10336066
453 Ga0207651_11578298
454 Ga0207640_11841365
455 Ga0207703_10563702
456 Ga0207703_10647045
457 Ga0207703_11741204
458 Ga0207639_11408882
459 Ga0207641_10060749
460 Ga0207641_10669781
461 Ga0207641_11006962
462 Ga0207675_100111300
463 Ga0207675_100886370
464 Ga0209813_10071076
465 Ga0207428_10026186
466 Ga0268264_10015391
467 Ga0268264_10499798
468 Ga0265325_10030417
469 Ga0316579_10143183
470 Ga0316576_10524509
471 Ga0316577_10116341
472 Ga0307407_10578064
473 Ga0307412_11670018
474 Ga0307409_100321056
475 Ga0307416_100254094
476 Ga0307414_11594772
477 Ga0307415_101153256
478 Ga0373936_0521458
479 Ga0373943_0588592
480 Ga0316574_0373583
481 Ga0373947_0152772
482 Ga0373937_1450312
483 Ga0316582_0061991
484 Ga0316584_0186323
485 Ga0439450_015864
486 Ga0439446_0055029
487 Ga0439435_0067511
488 Ga0439444_0032711
489 Ga0466963_0184604
490 Ga0451576_0054148
491 Ga0466958_0201815
492 Ga0495592_0000437
493 Ga0495653_0336941
494 Ga0495580_0681532
495 Ga0495662_0133581
496 Ga0495664_0008346
497 Ga0495664_0366091
498 Ga0495618_0011907
499 Ga0495628_0000054
500 Ga0495628_0599113
501 Ga0495628_0611767
502 Ga0495630_0015596
503 Ga0495666_0092153
504 Ga0495652_0975177
505 Ga0495640_0029838
506 Ga0495640_0895327
507 Ga0495586_0002028
508 Ga0495587_0041369
509 Ga0495645_0001578
510 Ga0495645_0102663
511 Ga0495645_0112650
512 Ga0495667_0744015
513 Ga0495634_0072331
514 Ga0495625_0586711
515 Ga0495635_0622650
516 Ga0495599_0004008
517 Ga0495599_0048254
518 Ga0495599_0273650
519 Ga0495623_0114512
520 Ga0495674_0011009
521 Ga0495674_0656542
522 Ga0495672_0092214
523 Ga0495680_0095359
524 Ga0495675_0163475
525 Ga0495602_0219759
526 Ga0496100_0916689
527 Ga0496102_0012320
528 Ga0496102_0420614
529 Ga0496106_0070167
530 Ga0496106_0427173
531 Ga0496112_0312647
532 Ga0501031_0155540
533 Ga0501036_0129770
534 Ga0501039_0070900
535 Ga0501039_1361953
536 Ga0501040_0001914
537 Ga0501040_0414410
538 Ga0501040_0639881
539 Ga0501042_0125188
540 Ga0501042_0640452
541 Ga0501043_0188309
542 Ga0501046_0475895
543 Ga0501048_0928372
544 Ga0501068_0899423
545 Ga0501068_1108949
546 Ga0501071_0001203
547 Ga0501071_0695849
548 Ga0501072_0424080
549 Ga0501072_0720090
550 Ga0501075_0653568
551 Ga0501075_0678511
552 Ga0501076_0000859
553 Ga0501076_0146915
554 Ga0501076_0420841
555 Ga0501076_0491680
556 Ga0501076_0553860
557 Ga0501076_1561523
558 Ga0501077_0114833
559 Ga0501243_064740
560 Ga0501079_0006423
561 Ga0501079_1293170
562 Ga0501081_1014433
563 Ga0501083_0064053
564 Ga0501035_0608059
565 Ga0501045_0003485
566 nmdc:mga00v17_276549_c1
567 nmdc:mga0k408_129265_c1
568 nmdc:mga06z11_298317_c1
569 nmdc:mga04h51_84963_c1
570 nmdc:mga05p37_299592_c1
571 nmdc:mga05p37_63602_c1
572 nmdc:mga05p37_691196_c1
573 nmdc:mga09592_535090_c1
574 nmdc:mga09592_689010_c1
575 nmdc:mga09592_9902_c1
576 nmdc:mga0qj67_180735_c1
577 nmdc:mga06r32_1211092_c1
578 nmdc:mga06r32_13989_c1
579 nmdc:mga06r32_2032253_c1
580 nmdc:mga06r32_4037_c1
581 nmdc:mga06r32_716757_c1
582 nmdc:mga06r32_863251_c1
583 nmdc:mga08y16_22278_c1
584 nmdc:mga0n895_1563254_c1
585 nmdc:mga0n895_180_c1
586 nmdc:mga0n895_3532_c1
587 nmdc:mga0n895_442258_c1
588 nmdc:mga0rr50_10151_c1
589 nmdc:mga0rr50_1253730_c1
590 nmdc:mga0rr50_16_c1
591 nmdc:mga0rr50_283795_c1
592 nmdc:mga0rr50_878701_c1
593 nmdc:mga08x19_233114_c1
594 nmdc:mga08x19_298_c1
595 nmdc:mga0a205_1308_c1
596 nmdc:mga0a205_269911_c1
597 Ga0495601_0056001
598 Ga0495601_0485018
599 Ga0495612_0087223
600 Ga0495619_0049153
601 Ga0500555_001279
602 Ga0500568_0035950
603 Ga0500645_000085
604 Ga0500552_084545
605 Ga0501084_0099932
606 Ga0501084_0146506
607 Ga0501084_1847270
608 Ga0501082_0037892
609 Ga0501082_0228903
610 Ga0501082_0989641
611 Ga0530510_0003094
612 Ga0530510_0007763

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

31

105

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9428 6 99
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9401 6 99
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9352 6 101
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9002 1 104
7wjp-assembly1.cif.gz_A-2 structure of padr-like protein from listeria monocytogenes 0.9002 5 102
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9401 6 99 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9096 5 104 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8953 5 107 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8912 1 104 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8899 8 86 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6J4LS10-F1-model_v4 Transcriptional regulator, PadR family 1 5 102
AF-W0RR40-F1-model_v4 Transcriptional regulator, PadR-family 1 5 103
AF-A0A6L4ZKY0-F1-model_v4 Transcriptional regulator PadR-family 0.9995 1 102
AF-A0A6A7KXK4-F1-model_v4 PadR family transcriptional regulator 0.9981 1 102
AF-A0A3N5LHC2-F1-model_v4 PadR family transcriptional regulator 0.9978 7 102

Map