F398506

General Info

Members Datasets Scaffolds Average Seq Length
306 203 229 258

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100207251|Ga0070659_1002072512
Length 283
Sequence MSIVIKDAAGIAGMRTACRLASEVLDMLTPHIVPGITTRQIDQLAHDYMVNVQGTIPATLNYQPPGHPPYPASLCTSVNEVVCHGIPNDIPLKHGDIINIDVTTIKDGWHGDNSRMFLVGKTSIAASRLCSITYEAMWKGIVKVKPGARLGDIGHAIQTFAENAGYSVVREFCGHGVGQKFHEEPQVLHYGKPGTLEELVPGMIFTIEPMINIGRKDIKDDRKGNKPYDGWTIVTKDRSLSAQWEHTVLVTETGYEVLTLSAGSPPPPDFVAPQHSAPVAVAD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
3 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
4 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
5 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
6 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
7 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
8 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
9 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
10 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
11 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
12 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
13 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
14 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
15 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
16 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
17 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
18 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
19 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
20 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
21 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
22 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
23 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
24 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
25 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
26 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
27 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
28 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
29 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
30 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
31 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
32 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
33 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
34 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
35 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
36 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
37 2636415599 Klebsiella variicola DX120E Isolate Unclassified
38 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
39 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
40 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
41 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
42 2734482264 Dyella sp. AD052 Isolate Unclassified
43 2738541297 Duganella sp. GV083 Isolate Unclassified
44 2738541357 Duganella sp. GV053 Isolate Unclassified
45 2738543003 Duganella sp. GV066 Isolate Unclassified
46 2738543026 Duganella sp. GV089 Isolate Unclassified
47 2738543029 Duganella sp. GV039 Isolate Unclassified
48 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
49 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
50 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
51 2775507074 Klebsiella sp. D5A Isolate Unclassified
52 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
53 2821131069 Duganella sp. 1224 Isolate Unclassified
54 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
55 2842711865 Duganella sp. R-73148 Isolate Unclassified
56 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
57 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
58 2855730933 Achromobacter sp. HZ28 Isolate Nodule
59 2855767633 Achromobacter sp. HZ34 Isolate Nodule
60 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
61 2857564685 Duganella sp. R-74599 Isolate Unclassified
62 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
63 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
64 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
65 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
66 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
67 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
68 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
69 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
70 2941471342 Luteibacter sp. 621 Isolate Unclassified
71 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
72 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
73 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
74 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
75 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
76 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
77 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
78 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
79 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
80 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
81 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
82 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
83 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
84 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
85 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
86 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
87 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
88 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
89 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
90 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
91 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
92 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
93 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
94 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
95 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
143 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
144 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
162 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
177 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
188 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
191 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
201 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
202 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
203 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.84
Metatranscriptomes 0
Isolates 25.16

Biome Distribution

Category Percentage (%)
Aerial Root 0.98
Bulb 0
Endosphere 9.15
Nodule 1.31
Rhizoplane 13.4
Rhizosphere 44.12
Stem 0
Stem Tuber 0
Unclassified 31.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1068868 2162886007 Bacteria 2129
2 SwRhRL2b_contig_349753 2162886007 Bacteria 1000
3 JGI24736J21556_1007849 3300001904 Bacteria 1786
4 JGI25150J39212_1002684 3300002774 Bacteria 4340
5 JGI25151J46595_10000817 3300003187 Bacteria 24798
6 rootH1_10049444 3300003323 Bacteria 11193
7 Ga0055537_1000616 3300003773 Bacteria 19543
8 Ga0055524_1017269 3300003775 Bacteria 2550
9 Ga0055536_1001225 3300003781 Bacteria 15882
10 Ga0055536_1011177 3300003781 Bacteria 3479
11 Ga0055534_1000114 3300003784 Bacteria 59511
12 Ga0055528_1000220 3300003790 Bacteria 48145
13 Ga0055530_10000071 3300003791 Bacteria 86290
14 Ga0055531_10002284 3300003794 Bacteria 12963
15 Ga0055531_10007484 3300003794 Bacteria 5951
16 Ga0065704_10071394 3300005289 Bacteria 11340
17 Ga0065704_10129692 3300005289 Bacteria 1645
18 Ga0070658_10115565 3300005327 Bacteria 2226
19 Ga0070682_100033587 3300005337 Bacteria 3119
20 Ga0070661_100025030 3300005344 Bacteria 4286
21 Ga0070661_100087473 3300005344 Bacteria 2305
22 Ga0070661_100227642 3300005344 Bacteria 1432
23 Ga0070668_100262476 3300005347 Bacteria 1437
24 Ga0070659_100207251 3300005366 Bacteria 1615
25 Ga0070665_100253638 3300005548 Bacteria 1760
26 Ga0081539_10096873 3300005985 Bacteria 1511
27 Ga0105251_10000220 3300009011 Bacteria 57862
28 Ga0105251_10004043 3300009011 Bacteria 10329
29 Ga0105244_10000410 3300009036 Bacteria 40015
30 Ga0105250_10000012 3300009092 Bacteria 274899
31 Ga0105243_10000554 3300009148 Bacteria 37788
32 Ga0105237_10366326 3300009545 Bacteria 1446
33 Ga0105239_10391425 3300010375 Bacteria 1572
34 Ga0157373_10120889 3300013100 Bacteria 1841
35 Ga0157373_10130167 3300013100 Bacteria 1770
36 Ga0157371_10024418 3300013102 Bacteria 4413
37 Ga0157370_10004323 3300013104 Bacteria 16324
38 Ga0157370_10083186 3300013104 Bacteria 3010
39 Ga0157370_10296631 3300013104 Bacteria 1493
40 Ga0157370_10423167 3300013104 Bacteria 1225
41 Ga0157369_10019608 3300013105 Bacteria 7567
42 Ga0163162_10616682 3300013306 Bacteria 1210
43 Ga0182008_10001654 3300014497 Bacteria 14722
44 Ga0182008_10011942 3300014497 Bacteria 4603
45 Ga0182008_10154725 3300014497 Bacteria 1151
46 Ga0182006_1000056 3300015261 Bacteria 169631
47 Ga0182006_1010944 3300015261 Bacteria 4012
48 Ga0182007_10000004 3300015262 Bacteria 485875
49 Ga0182005_1000013 3300015265 Bacteria 396391
50 Ga0163161_10025540 3300017792 Bacteria 4181
51 Ga0209565_1000024 3300025263 Bacteria 379907
52 Ga0209673_1000087 3300025273 Bacteria 205213
53 Ga0209675_1000039 3300025291 Bacteria 247966
54 Ga0209676_1000011 3300025292 Bacteria 860463
55 Ga0209676_1000821 3300025292 Bacteria 40451
56 Ga0209025_1000018 3300025294 Bacteria 686898
57 Ga0209564_1000188 3300025295 Bacteria 144251
58 Ga0209050_1000032 3300025298 Bacteria 456335
59 Ga0209256_1037775 3300025299 Bacteria 1255
60 Ga0209051_1001523 3300025303 Bacteria 19289
61 Ga0209051_1016278 3300025303 Bacteria 3376
62 Ga0209257_1000014 3300025304 Bacteria 946850
63 Ga0209257_1000121 3300025304 Bacteria 222588
64 Ga0207696_1000040 3300025711 Bacteria 318695
65 Ga0207655_1002002 3300025728 Bacteria 17313
66 Ga0207713_1000003 3300025735 Bacteria 860698
67 Ga0207713_1000017 3300025735 Bacteria 394495
68 Ga0207647_10000056 3300025904 Bacteria 86476
69 Ga0207705_10037138 3300025909 Bacteria 3486
70 Ga0207657_10139882 3300025919 Bacteria 1978
71 Ga0207649_10415524 3300025920 Bacteria 1009
72 Ga0207650_10067604 3300025925 Bacteria 2681
73 Ga0207668_10011981 3300025972 Bacteria 5292
74 Ga0209281_1003254 3300027111 Bacteria 5522
75 Ga0268266_10193451 3300028379 Bacteria 1858
76 Ga0316176_1057983 3300030732 Bacteria 3514
77 Ga0307408_100000250 3300031548 Bacteria 55645
78 Ga0307412_10000528 3300031911 Bacteria 22761
79 Ga0373937_0087261 3300036401 Bacteria 2888
80 Ga0373925_0205883 3300037068 Bacteria 1566
81 Ga0395899_0053084 3300037312 Bacteria 3002
82 Ga0395898_0004538 3300037466 Bacteria 15158
83 Ga0237819_04384 3300038705 Bacteria 2329
84 Ga0495617_000016 3300046452 Bacteria 253600
85 Ga0495590_0000006 3300046457 Bacteria 372949
86 Ga0495638_0000044 3300046460 Bacteria 221595
87 Ga0495638_0000891 3300046460 Bacteria 30617
88 Ga0495650_0000851 3300046471 Bacteria 36692
89 Ga0495650_0001969 3300046471 Bacteria 18130
90 Ga0495584_0023501 3300046491 Bacteria 3125
91 Ga0495585_0007612 3300046492 Bacteria 6616
92 Ga0495585_0012779 3300046492 Bacteria 4939
93 Ga0495607_0000019 3300046501 Bacteria 167319
94 Ga0495607_0000030 3300046501 Bacteria 154557
95 Ga0495607_0003720 3300046501 Bacteria 11561
96 Ga0495583_0001566 3300046506 Bacteria 22601
97 Ga0495606_0000041 3300046507 Bacteria 220225
98 Ga0495606_0000260 3300046507 Bacteria 93381
99 Ga0495610_0009892 3300046512 Bacteria 5969
100 Ga0495616_0000100 3300046513 Bacteria 73588
101 Ga0495616_0001106 3300046513 Bacteria 19158
102 Ga0495620_0000078 3300046515 Bacteria 80641
103 Ga0495620_0001396 3300046515 Bacteria 14491
104 Ga0495631_0000081 3300046518 Bacteria 62510
105 Ga0495631_0000179 3300046518 Bacteria 43072
106 Ga0495643_0000307 3300046522 Bacteria 67608
107 Ga0495643_0000338 3300046522 Bacteria 63855
108 Ga0495643_0000971 3300046522 Bacteria 29402
109 Ga0495644_0085680 3300046523 Bacteria 1188
110 Ga0495648_0000061 3300046524 Bacteria 151604
111 Ga0495648_0006279 3300046524 Bacteria 9724
112 Ga0495663_0000822 3300046525 Bacteria 10619
113 Ga0495642_0002775 3300046528 Bacteria 7021
114 Ga0495642_0006772 3300046528 Bacteria 4393
115 Ga0495609_0052828 3300046538 Bacteria 1807
116 Ga0495597_0003195 3300046542 Bacteria 9766
117 Ga0495622_0000103 3300046557 Bacteria 74095
118 Ga0495633_0000098 3300046558 Bacteria 117269
119 Ga0495633_0018221 3300046558 Bacteria 3571
120 Ga0495668_0001564 3300046616 Bacteria 21690
121 Ga0495668_0003055 3300046616 Bacteria 12995
122 Ga0495611_0000001 3300046648 Bacteria 2628469
123 Ga0495611_0000043 3300046648 Bacteria 94862
124 Ga0495611_0055749 3300046648 Bacteria 1788
125 Ga0495625_0000001 3300046660 Bacteria 1641829
126 Ga0495625_0001274 3300046660 Bacteria 31651
127 Ga0495625_0009834 3300046660 Bacteria 7958
128 Ga0495661_0009758 3300046665 Bacteria 6575
129 Ga0495670_0001300 3300046691 Bacteria 12167
130 Ga0495670_0028249 3300046691 Bacteria 2781
131 Ga0495671_0000635 3300046692 Bacteria 25620
132 Ga0495671_0077516 3300046692 Bacteria 1629
133 Ga0495649_0000022 3300046694 Bacteria 179407
134 Ga0495649_0255084 3300046694 Bacteria 900
135 Ga0495589_0000804 3300046794 Bacteria 19892
136 Ga0495660_0000018 3300046810 Bacteria 317061
137 Ga0495660_0001483 3300046810 Bacteria 15939
138 Ga0495660_0042654 3300046810 Bacteria 2506
139 Ga0495672_0000006 3300047320 Bacteria 589807
140 Ga0495672_0004037 3300047320 Bacteria 12264
141 Ga0495677_0067745 3300047445 Bacteria 1328
142 Ga0495679_000001 3300047446 Bacteria 1607568
143 Ga0495673_0000129 3300047469 Bacteria 139549
144 Ga0495673_0010081 3300047469 Bacteria 5168
145 Ga0495686_0007974 3300047472 Bacteria 7854
146 Ga0495686_0045646 3300047472 Bacteria 2771
147 Ga0495615_0043024 3300048090 Bacteria 1135
148 Ga0496105_0011115 3300048908 Bacteria 7101
149 Ga0496105_0011436 3300048908 Bacteria 7013
150 Ga0496106_0010603 3300048909 Bacteria 6808
151 Ga0496111_0221438 3300048914 Bacteria 1406
152 Ga0496113_0055758 3300048916 Bacteria 2964
153 Ga0496116_0000035 3300048919 Bacteria 402424
154 Ga0496116_0000754 3300048919 Bacteria 41159
155 Ga0496116_0050335 3300048919 Bacteria 2776
156 Ga0496116_0054336 3300048919 Bacteria 2639
157 Ga0496116_0089959 3300048919 Bacteria 1870
158 Ga0496116_0230763 3300048919 Bacteria 939
159 Ga0496117_0000227 3300048920 Bacteria 106119
160 Ga0496117_0007933 3300048920 Bacteria 10201
161 Ga0496117_0012621 3300048920 Bacteria 7430
162 Ga0496117_0014081 3300048920 Bacteria 6917
163 Ga0496117_0025478 3300048920 Bacteria 4650
164 Ga0496117_0172989 3300048920 Bacteria 1251
165 Ga0496118_0000291 3300048921 Bacteria 87433
166 Ga0496118_0001432 3300048921 Bacteria 35924
167 Ga0496118_0001881 3300048921 Bacteria 29958
168 Ga0496118_0008099 3300048921 Bacteria 10954
169 Ga0496118_0009068 3300048921 Bacteria 10138
170 Ga0496118_0023051 3300048921 Bacteria 5421
171 Ga0496118_0149860 3300048921 Bacteria 1462
172 Ga0496118_0196908 3300048921 Bacteria 1198
173 Ga0496119_0000047 3300048922 Bacteria 188401
174 Ga0496119_0000145 3300048922 Bacteria 99245
175 Ga0496120_0000260 3300048923 Bacteria 88375
176 Ga0496120_0000417 3300048923 Bacteria 67929
177 Ga0496120_0020089 3300048923 Bacteria 4255
178 Ga0496120_0178278 3300048923 Bacteria 1045
179 Ga0496121_0000044 3300048924 Bacteria 337672
180 Ga0496121_0001810 3300048924 Bacteria 34532
181 Ga0496121_0003269 3300048924 Bacteria 23281
182 Ga0496121_0025483 3300048924 Bacteria 5609
183 Ga0496121_0111424 3300048924 Bacteria 2086
184 Ga0496122_0006917 3300048925 Bacteria 12811
185 Ga0496122_0007069 3300048925 Bacteria 12605
186 Ga0496122_0008155 3300048925 Bacteria 11402
187 Ga0496122_0020502 3300048925 Bacteria 5968
188 Ga0496122_0062066 3300048925 Bacteria 2738
189 Ga0496122_0064252 3300048925 Bacteria 2672
190 Ga0496123_0003813 3300048926 Bacteria 16462
191 Ga0496123_0044143 3300048926 Bacteria 3051
192 Ga0496123_0047393 3300048926 Bacteria 2904
193 Ga0496123_0051038 3300048926 Bacteria 2758
194 Ga0496123_0070970 3300048926 Bacteria 2176
195 Ga0496123_0165501 3300048926 Bacteria 1173
196 Ga0496124_0000020 3300048927 Bacteria 434107
197 Ga0496124_0025218 3300048927 Bacteria 5388
198 Ga0496124_0043510 3300048927 Bacteria 3860
199 Ga0496124_0045786 3300048927 Bacteria 3750
200 Ga0496124_0046297 3300048927 Bacteria 3726
201 Ga0496125_0008465 3300048928 Bacteria 10767
202 Ga0496125_0010728 3300048928 Bacteria 9231
203 Ga0496125_0012845 3300048928 Bacteria 8275
204 Ga0496125_0021208 3300048928 Bacteria 6068
205 Ga0496125_0030542 3300048928 Bacteria 4819
206 Ga0496125_0040233 3300048928 Bacteria 4013
207 Ga0496125_0089311 3300048928 Bacteria 2318
208 Ga0496125_0138334 3300048928 Bacteria 1698
209 Ga0496126_0000084 3300048929 Bacteria 217111
210 Ga0496126_0000238 3300048929 Bacteria 118994
211 Ga0496126_0000701 3300048929 Bacteria 61198
212 Ga0496126_0003740 3300048929 Bacteria 18952
213 Ga0496126_0024148 3300048929 Bacteria 5872
214 Ga0496126_0062725 3300048929 Bacteria 3334
215 Ga0496126_0068942 3300048929 Bacteria 3156
216 Ga0496126_0082224 3300048929 Bacteria 2846
217 Ga0496126_0273150 3300048929 Bacteria 1402
218 Ga0495678_001816 3300049459 Bacteria 15698
219 Ga0495678_009322 3300049459 Bacteria 4866
220 Ga0495678_142862 3300049459 Bacteria 781
221 Ga0495682_0014475 3300049460 Bacteria 2990
222 Ga0495682_0044863 3300049460 Bacteria 1616
223 Ga0501034_0097866 3300049571 Bacteria 2930
224 Ga0501046_0175794 3300049580 Bacteria 1604
225 Ga0501044_0000345 3300049823 Bacteria 58504
226 Ga0500643_000002 3300053087 Bacteria 1277657
227 Ga0500555_000261 3300053103 Bacteria 23059
228 Ga0500652_063756 3300053131 Bacteria 1521
229 Ga0500600_0031953 3300053149 Bacteria 3089

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046471 Ga0495650_0000851 Ga0495650_0000851_1990_2667 214
2 3300046491 Ga0495584_0023501 Ga0495584_0023501_140_817 214
3 3300046518 Ga0495631_0000081 Ga0495631_0000081_27199_27876 214
4 3300049459 Ga0495678_142862 Ga0495678_142862_36_710 214
5 3300025919 Ga0207657_10139882 Ga0207657_101398822 219
6 3300046694 Ga0495649_0255084 Ga0495649_0255084_181_867 219
7 3300048914 Ga0496111_0221438 Ga0496111_0221438_13_753 237
8 3300002774 JGI25150J39212_1002684 JGI25150J39212_10026842 238
9 3300003794 Ga0055531_10002284 Ga0055531_100022844 239
10 3300025304 Ga0209257_1000121 Ga0209257_100012157 239
11 3300046810 Ga0495660_0001483 Ga0495660_0001483_143_970 240
12 iso_pu_bacteria 2643221699 2644552245 242
13 iso_pu_bacteria 2852649853 2852650483 242
14 iso_pu_bacteria 2919527303 2919528279 242
15 iso_pu_bacteria 2939589442 2939593220 243
16 iso_pu_bacteria 2974307012 2974308613 243
17 iso_pu_bacteria 2977247770 2977249355 243
18 iso_pu_bacteria 2984514374 2984516177 243
19 3300003323 rootH1_10049444 rootH1_100494443 244
20 3300005327 Ga0070658_10115565 Ga0070658_101155652 244
21 3300005337 Ga0070682_100033587 Ga0070682_1000335872 244
22 3300025909 Ga0207705_10037138 Ga0207705_100371382 244
23 3300031548 Ga0307408_100000250 Ga0307408_1000002502 244
24 3300046507 Ga0495606_0000041 Ga0495606_0000041_175519_176280 244
25 3300046512 Ga0495610_0009892 Ga0495610_0009892_773_1540 244
26 3300046515 Ga0495620_0001396 Ga0495620_0001396_5833_6600 244
27 3300046522 Ga0495643_0000971 Ga0495643_0000971_26666_27427 244
28 3300046524 Ga0495648_0006279 Ga0495648_0006279_8479_9246 244
29 3300046648 Ga0495611_0000043 Ga0495611_0000043_59609_60376 244
30 3300046694 Ga0495649_0000022 Ga0495649_0000022_43946_44707 244
31 3300047469 Ga0495673_0010081 Ga0495673_0010081_4256_5023 244
32 3300047472 Ga0495686_0007974 Ga0495686_0007974_3656_4423 244
33 3300049571 Ga0501034_0097866 Ga0501034_0097866_1836_2606 244
34 3300049823 Ga0501044_0000345 Ga0501044_0000345_52384_53196 244
35 3300046492 Ga0495585_0007612 Ga0495585_0007612_2318_3082 245
36 3300046528 Ga0495642_0002775 Ga0495642_0002775_3458_4222 245
37 3300046665 Ga0495661_0009758 Ga0495661_0009758_5156_5920 245
38 3300046692 Ga0495671_0077516 Ga0495671_0077516_656_1420 245
39 iso_pu_bacteria 2643221581 2643913928 245
40 iso_pu_bacteria 2718218334 2721027109 245
41 iso_pu_bacteria 2734482264 2735837288 245
42 iso_pu_bacteria 2747842501 2748017577 245
43 iso_pu_bacteria 2842780639 2842784317 245
44 iso_pu_bacteria 2919130084 2919130900 245
45 iso_pu_bacteria 2923516293 2923519755 245
46 iso_pu_bacteria 2929195423 2929196131 245
47 iso_pu_bacteria 2937610967 2937611701 245
48 iso_pu_bacteria 2941471342 2941475857 245
49 3300009011 Ga0105251_10000220 Ga0105251_1000022032 246
50 3300009011 Ga0105251_10004043 Ga0105251_100040433 246
51 3300009036 Ga0105244_10000410 Ga0105244_1000041013 246
52 3300009092 Ga0105250_10000012 Ga0105250_10000012150 246
53 3300009148 Ga0105243_10000554 Ga0105243_1000055415 246
54 3300009545 Ga0105237_10366326 Ga0105237_103663262 246
55 3300010375 Ga0105239_10391425 Ga0105239_103914252 246
56 3300014497 Ga0182008_10154725 Ga0182008_101547252 246
57 3300015262 Ga0182007_10000004 Ga0182007_1000000439 246
58 3300025711 Ga0207696_1000040 Ga0207696_1000040197 246
59 3300025728 Ga0207655_1002002 Ga0207655_100200210 246
60 3300025735 Ga0207713_1000003 Ga0207713_1000003428 246
61 3300025735 Ga0207713_1000017 Ga0207713_1000017190 246
62 3300037068 Ga0373925_0205883 Ga0373925_0205883_123_914 246
63 3300046457 Ga0495590_0000006 Ga0495590_0000006_183612_184379 246
64 3300046460 Ga0495638_0000891 Ga0495638_0000891_12333_13100 246
65 3300046471 Ga0495650_0001969 Ga0495650_0001969_3917_4684 246
66 3300046506 Ga0495583_0001566 Ga0495583_0001566_17490_18257 246
67 3300046522 Ga0495643_0000338 Ga0495643_0000338_46092_46859 246
68 3300046524 Ga0495648_0000061 Ga0495648_0000061_17054_17821 246
69 3300046528 Ga0495642_0006772 Ga0495642_0006772_1762_2529 246
70 3300046538 Ga0495609_0052828 Ga0495609_0052828_106_873 246
71 3300046542 Ga0495597_0003195 Ga0495597_0003195_4520_5287 246
72 3300046557 Ga0495622_0000103 Ga0495622_0000103_69366_70133 246
73 3300046558 Ga0495633_0000098 Ga0495633_0000098_2812_3579 246
74 3300046558 Ga0495633_0018221 Ga0495633_0018221_2108_2875 246
75 3300046616 Ga0495668_0001564 Ga0495668_0001564_16833_17600 246
76 3300046660 Ga0495625_0001274 Ga0495625_0001274_17458_18225 246
77 3300046810 Ga0495660_0042654 Ga0495660_0042654_1577_2344 246
78 3300047320 Ga0495672_0004037 Ga0495672_0004037_271_1038 246
79 3300047445 Ga0495677_0067745 Ga0495677_0067745_440_1264 246
80 3300048090 Ga0495615_0043024 Ga0495615_0043024_37_804 246
81 3300048908 Ga0496105_0011115 Ga0496105_0011115_828_1595 246
82 3300048908 Ga0496105_0011436 Ga0496105_0011436_1060_1839 246
83 3300048919 Ga0496116_0000754 Ga0496116_0000754_38138_38905 246
84 3300048920 Ga0496117_0007933 Ga0496117_0007933_5023_5802 246
85 3300048920 Ga0496117_0172989 Ga0496117_0172989_15_794 246
86 3300048921 Ga0496118_0009068 Ga0496118_0009068_8614_9393 246
87 3300048921 Ga0496118_0196908 Ga0496118_0196908_153_932 246
88 3300048922 Ga0496119_0000047 Ga0496119_0000047_70181_70948 246
89 3300048922 Ga0496119_0000145 Ga0496119_0000145_52253_53032 246
90 3300048923 Ga0496120_0000260 Ga0496120_0000260_71089_71856 246
91 3300048923 Ga0496120_0000417 Ga0496120_0000417_39326_40105 246
92 3300048923 Ga0496120_0178278 Ga0496120_0178278_194_973 246
93 3300048924 Ga0496121_0025483 Ga0496121_0025483_4229_4996 246
94 3300048925 Ga0496122_0062066 Ga0496122_0062066_614_1393 246
95 3300048926 Ga0496123_0051038 Ga0496123_0051038_622_1401 246
96 3300048926 Ga0496123_0165501 Ga0496123_0165501_35_814 246
97 3300048927 Ga0496124_0045786 Ga0496124_0045786_1907_2686 246
98 3300048928 Ga0496125_0008465 Ga0496125_0008465_7607_8374 246
99 3300048928 Ga0496125_0030542 Ga0496125_0030542_2264_3031 246
100 3300048928 Ga0496125_0089311 Ga0496125_0089311_1020_1799 246
101 3300048929 Ga0496126_0000238 Ga0496126_0000238_2411_3178 246
102 3300048929 Ga0496126_0000701 Ga0496126_0000701_3302_4081 246
103 3300048929 Ga0496126_0003740 Ga0496126_0003740_7413_8192 246
104 3300049459 Ga0495678_009322 Ga0495678_009322_2380_3147 246
105 3300049580 Ga0501046_0175794 Ga0501046_0175794_266_1102 246
106 iso_pu_bacteria 2855730933 2855731457 246
107 iso_pu_bacteria 2855767633 2855768163 246
108 iso_pu_bacteria 2881412998 2881413667 246
109 iso_pu_bacteria 2971820967 2971823590 246
110 3300003773 Ga0055537_1000616 Ga0055537_100061619 247
111 3300003775 Ga0055524_1017269 Ga0055524_10172693 247
112 3300003781 Ga0055536_1001225 Ga0055536_100122513 247
113 3300003784 Ga0055534_1000114 Ga0055534_10001141 247
114 3300003790 Ga0055528_1000220 Ga0055528_100022018 247
115 3300003791 Ga0055530_10000071 Ga0055530_1000007171 247
116 3300003794 Ga0055531_10007484 Ga0055531_100074842 247
117 3300013104 Ga0157370_10423167 Ga0157370_104231672 247
118 3300014497 Ga0182008_10001654 Ga0182008_1000165415 247
119 3300014497 Ga0182008_10011942 Ga0182008_100119423 247
120 3300015261 Ga0182006_1010944 Ga0182006_10109442 247
121 3300017792 Ga0163161_10025540 Ga0163161_100255406 247
122 3300025263 Ga0209565_1000024 Ga0209565_1000024332 247
123 3300025273 Ga0209673_1000087 Ga0209673_100008749 247
124 3300025291 Ga0209675_1000039 Ga0209675_1000039115 247
125 3300025292 Ga0209676_1000011 Ga0209676_1000011155 247
126 3300025295 Ga0209564_1000188 Ga0209564_100018850 247
127 3300025298 Ga0209050_1000032 Ga0209050_100003234 247
128 3300025299 Ga0209256_1037775 Ga0209256_10377751 247
129 3300025303 Ga0209051_1001523 Ga0209051_10015238 247
130 3300025304 Ga0209257_1000014 Ga0209257_1000014214 247
131 3300030732 Ga0316176_1057983 Ga0316176_10579834 247
132 3300036401 Ga0373937_0087261 Ga0373937_0087261_66_860 247
133 3300046522 Ga0495643_0000307 Ga0495643_0000307_2896_3666 247
134 3300047320 Ga0495672_0000006 Ga0495672_0000006_32597_33367 247
135 3300048916 Ga0496113_0055758 Ga0496113_0055758_277_1047 247
136 3300048919 Ga0496116_0000035 Ga0496116_0000035_179556_180326 247
137 3300048919 Ga0496116_0054336 Ga0496116_0054336_1048_1818 247
138 3300048919 Ga0496116_0089959 Ga0496116_0089959_1050_1820 247
139 3300048920 Ga0496117_0000227 Ga0496117_0000227_73777_74547 247
140 3300048920 Ga0496117_0012621 Ga0496117_0012621_5024_5794 247
141 3300048920 Ga0496117_0014081 Ga0496117_0014081_3500_4270 247
142 3300048921 Ga0496118_0001432 Ga0496118_0001432_3599_4369 247
143 3300048921 Ga0496118_0001881 Ga0496118_0001881_2430_3200 247
144 3300048921 Ga0496118_0023051 Ga0496118_0023051_4328_5098 247
145 3300048924 Ga0496121_0001810 Ga0496121_0001810_3418_4188 247
146 3300048925 Ga0496122_0007069 Ga0496122_0007069_2712_3482 247
147 3300048925 Ga0496122_0020502 Ga0496122_0020502_3168_3938 247
148 3300048926 Ga0496123_0047393 Ga0496123_0047393_471_1241 247
149 3300048927 Ga0496124_0025218 Ga0496124_0025218_1988_2758 247
150 3300048927 Ga0496124_0046297 Ga0496124_0046297_712_1482 247
151 3300048928 Ga0496125_0021208 Ga0496125_0021208_4345_5115 247
152 3300048928 Ga0496125_0138334 Ga0496125_0138334_309_1079 247
153 3300048929 Ga0496126_0000084 Ga0496126_0000084_53731_54501 247
154 3300048929 Ga0496126_0062725 Ga0496126_0062725_2279_3049 247
155 iso_pu_bacteria 2599185169 2599409440 247
156 iso_pu_bacteria 2600255254 2601522068 247
157 iso_pu_bacteria 2600255255 2601527093 247
158 iso_pu_bacteria 2600255280 2601613923 247
159 iso_pu_bacteria 2600255281 2601618646 247
160 iso_pu_bacteria 2600255287 2601642728 247
161 iso_pu_bacteria 2600255288 2601647597 247
162 iso_pu_bacteria 2600255289 2601652071 247
163 iso_pu_bacteria 2600255290 2601657398 247
164 iso_pu_bacteria 2600255291 2601662549 247
165 iso_pu_bacteria 2600255298 2601695506 247
166 iso_pu_bacteria 2600255299 2601700182 247
167 iso_pu_bacteria 2600255300 2601705195 247
168 iso_pu_bacteria 2600255301 2601710224 247
169 iso_pu_bacteria 2600255302 2601715236 247
170 iso_pu_bacteria 2600255303 2601720533 247
171 iso_pu_bacteria 2600255304 2601725642 247
172 iso_pu_bacteria 2600255305 2601730184 247
173 iso_pu_bacteria 2600255306 2601735201 247
174 iso_pu_bacteria 2600255307 2601739884 247
175 iso_pu_bacteria 2600255309 2601750373 247
176 iso_pu_bacteria 2600255392 2602017626 247
177 iso_pu_bacteria 2602042052 2603659923 247
178 iso_pu_bacteria 2602042053 2603665199 247
179 iso_pu_bacteria 2602042103 2603837566 247
180 iso_pu_bacteria 2602042104 2603842642 247
181 iso_pu_bacteria 2602042105 2603847715 247
182 iso_pu_bacteria 2602042106 2603852786 247
183 iso_pu_bacteria 2602042110 2603870839 247
184 iso_pu_bacteria 2602042111 2603875776 247
185 iso_pu_bacteria 2603880178 2606048031 247
186 iso_pu_bacteria 2603880184 2606069629 247
187 iso_pu_bacteria 2603880202 2606145463 247
188 iso_pu_bacteria 2603880211 2606175434 247
189 iso_pu_bacteria 2636415599 2637225339 247
190 iso_pu_bacteria 2675903046 2676406585 247
191 iso_pu_bacteria 2738541297 2738830199 247
192 iso_pu_bacteria 2738541357 2739153995 247
193 iso_pu_bacteria 2738543003 2739195915 247
194 iso_pu_bacteria 2738543026 2739322391 247
195 iso_pu_bacteria 2738543029 2739340632 247
196 iso_pu_bacteria 2747842428 2747949870 247
197 iso_pu_bacteria 2765235840 2765578260 247
198 iso_pu_bacteria 2775507074 2777022687 247
199 iso_pu_bacteria 2816332141 2816516275 247
200 iso_pu_bacteria 2821131069 2821132109 247
201 iso_pu_bacteria 2842391507 2842393539 247
202 iso_pu_bacteria 2842711865 2842712638 247
203 iso_pu_bacteria 2857564685 2857568445 247
204 iso_pu_bacteria 2904513164 2904513803 247
205 iso_pu_bacteria 2961064222 2961066983 247
206 iso_pu_bacteria 2969079654 2969082331 247
207 iso_pu_bacteria 2984559226 2984564745 247
208 iso_pu_bacteria 2984595703 2984597473 247
209 3300003187 JGI25151J46595_10000817 JGI25151J46595_100008173 248
210 3300005344 Ga0070661_100025030 Ga0070661_1000250303 248
211 3300005344 Ga0070661_100227642 Ga0070661_1002276422 248
212 3300005366 Ga0070659_100207251 Ga0070659_1002072512 248
213 3300013104 Ga0157370_10083186 Ga0157370_100831864 248
214 3300013306 Ga0163162_10616682 Ga0163162_106166822 248
215 3300025294 Ga0209025_1000018 Ga0209025_1000018494 248
216 3300025920 Ga0207649_10415524 Ga0207649_104155241 248
217 3300046452 Ga0495617_000016 Ga0495617_000016_108794_109567 248
218 3300046507 Ga0495606_0000260 Ga0495606_0000260_30449_31222 248
219 3300046515 Ga0495620_0000078 Ga0495620_0000078_28540_29313 248
220 3300046648 Ga0495611_0055749 Ga0495611_0055749_617_1390 248
221 3300046691 Ga0495670_0001300 Ga0495670_0001300_10871_11644 248
222 3300046692 Ga0495671_0000635 Ga0495671_0000635_789_1562 248
223 3300047472 Ga0495686_0045646 Ga0495686_0045646_1292_2065 248
224 3300048909 Ga0496106_0010603 Ga0496106_0010603_877_1650 248
225 3300049459 Ga0495678_001816 Ga0495678_001816_12337_13110 248
226 3300049460 Ga0495682_0044863 Ga0495682_0044863_618_1391 248
227 3300053087 Ga0500643_000002 Ga0500643_000002_321669_322442 248
228 3300053103 Ga0500555_000261 Ga0500555_000261_8258_9031 248
229 3300053149 Ga0500600_0031953 Ga0500600_0031953_329_1165 248
230 iso_pu_bacteria 2600255292 2601669130 248
231 iso_pu_bacteria 2857547612 2857551282 248
232 2162886007 SwRhRL2b_contig_1068868 SwRhRL2b_0728.00007130 249
233 2162886007 SwRhRL2b_contig_349753 SwRhRL2b_0822.00007130 249
234 3300001904 JGI24736J21556_1007849 JGI24736J21556_10078492 249
235 3300003781 Ga0055536_1011177 Ga0055536_10111774 249
236 3300005289 Ga0065704_10071394 Ga0065704_100713949 249
237 3300005289 Ga0065704_10129692 Ga0065704_101296922 249
238 3300005344 Ga0070661_100087473 Ga0070661_1000874732 249
239 3300005347 Ga0070668_100262476 Ga0070668_1002624763 249
240 3300005548 Ga0070665_100253638 Ga0070665_1002536383 249
241 3300005985 Ga0081539_10096873 Ga0081539_100968732 249
242 3300013100 Ga0157373_10120889 Ga0157373_101208893 249
243 3300013100 Ga0157373_10130167 Ga0157373_101301673 249
244 3300013102 Ga0157371_10024418 Ga0157371_100244183 249
245 3300013104 Ga0157370_10004323 Ga0157370_100043234 249
246 3300013104 Ga0157370_10296631 Ga0157370_102966312 249
247 3300013105 Ga0157369_10019608 Ga0157369_100196089 249
248 3300015261 Ga0182006_1000056 Ga0182006_1000056121 249
249 3300015265 Ga0182005_1000013 Ga0182005_1000013174 249
250 3300025292 Ga0209676_1000821 Ga0209676_100082127 249
251 3300025303 Ga0209051_1016278 Ga0209051_10162783 249
252 3300025904 Ga0207647_10000056 Ga0207647_1000005663 249
253 3300025925 Ga0207650_10067604 Ga0207650_100676042 249
254 3300025972 Ga0207668_10011981 Ga0207668_100119815 249
255 3300027111 Ga0209281_1003254 Ga0209281_10032545 249
256 3300028379 Ga0268266_10193451 Ga0268266_101934512 249
257 3300031911 Ga0307412_10000528 Ga0307412_100005286 249
258 3300037312 Ga0395899_0053084 Ga0395899_0053084_843_1619 249
259 3300037466 Ga0395898_0004538 Ga0395898_0004538_11789_12565 249
260 3300038705 Ga0237819_04384 Ga0237819_04384_1064_1858 249
261 3300046460 Ga0495638_0000044 Ga0495638_0000044_123050_123841 249
262 3300046492 Ga0495585_0012779 Ga0495585_0012779_3102_3881 249
263 3300046501 Ga0495607_0000019 Ga0495607_0000019_50436_51215 249
264 3300046501 Ga0495607_0000030 Ga0495607_0000030_66622_67413 249
265 3300046501 Ga0495607_0003720 Ga0495607_0003720_4389_5171 249
266 3300046513 Ga0495616_0000100 Ga0495616_0000100_36393_37172 249
267 3300046513 Ga0495616_0001106 Ga0495616_0001106_5984_6775 249
268 3300046518 Ga0495631_0000179 Ga0495631_0000179_27542_28345 249
269 3300046523 Ga0495644_0085680 Ga0495644_0085680_101_877 249
270 3300046525 Ga0495663_0000822 Ga0495663_0000822_3146_3943 249
271 3300046616 Ga0495668_0003055 Ga0495668_0003055_8621_9409 249
272 3300046648 Ga0495611_0000001 Ga0495611_0000001_1498314_1499105 249
273 3300046660 Ga0495625_0000001 Ga0495625_0000001_416932_417723 249
274 3300046660 Ga0495625_0009834 Ga0495625_0009834_4068_4847 249
275 3300046691 Ga0495670_0028249 Ga0495670_0028249_1594_2373 249
276 3300046794 Ga0495589_0000804 Ga0495589_0000804_8762_9553 249
277 3300046810 Ga0495660_0000018 Ga0495660_0000018_185187_185978 249
278 3300047446 Ga0495679_000001 Ga0495679_000001_87850_88641 249
279 3300047469 Ga0495673_0000129 Ga0495673_0000129_54268_55059 249
280 3300048919 Ga0496116_0050335 Ga0496116_0050335_512_1300 249
281 3300048919 Ga0496116_0230763 Ga0496116_0230763_133_921 249
282 3300048920 Ga0496117_0025478 Ga0496117_0025478_3080_3856 249
283 3300048921 Ga0496118_0000291 Ga0496118_0000291_65110_65886 249
284 3300048921 Ga0496118_0008099 Ga0496118_0008099_9816_10622 249
285 3300048921 Ga0496118_0149860 Ga0496118_0149860_436_1218 249
286 3300048923 Ga0496120_0020089 Ga0496120_0020089_1389_2177 249
287 3300048924 Ga0496121_0000044 Ga0496121_0000044_308472_309278 249
288 3300048924 Ga0496121_0003269 Ga0496121_0003269_3314_4111 249
289 3300048924 Ga0496121_0111424 Ga0496121_0111424_397_1185 249
290 3300048925 Ga0496122_0006917 Ga0496122_0006917_1339_2268 249
291 3300048925 Ga0496122_0008155 Ga0496122_0008155_9322_10098 249
292 3300048925 Ga0496122_0064252 Ga0496122_0064252_951_1757 249
293 3300048926 Ga0496123_0003813 Ga0496123_0003813_14410_15186 249
294 3300048926 Ga0496123_0044143 Ga0496123_0044143_785_1591 249
295 3300048926 Ga0496123_0070970 Ga0496123_0070970_1279_2085 249
296 3300048927 Ga0496124_0000020 Ga0496124_0000020_220582_221358 249
297 3300048927 Ga0496124_0043510 Ga0496124_0043510_868_1668 249
298 3300048928 Ga0496125_0010728 Ga0496125_0010728_7069_7875 249
299 3300048928 Ga0496125_0012845 Ga0496125_0012845_6112_6900 249
300 3300048928 Ga0496125_0040233 Ga0496125_0040233_1747_2535 249
301 3300048929 Ga0496126_0024148 Ga0496126_0024148_4697_5494 249
302 3300048929 Ga0496126_0068942 Ga0496126_0068942_455_1231 249
303 3300048929 Ga0496126_0082224 Ga0496126_0082224_1829_2605 249
304 3300048929 Ga0496126_0273150 Ga0496126_0273150_281_1087 249
305 3300049460 Ga0495682_0014475 Ga0495682_0014475_1537_2328 249
306 3300053131 Ga0500652_063756 Ga0500652_063756_127_918 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

12

252

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9637 1 246
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9601 1 238
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9595 1 242
4fuk-assembly1.cif.gz_B aminopeptidase from trypanosoma brucei 0.9558 7 244
4a6v-assembly1.cif.gz_A x-ray structures of oxazole hydroxamate ecmetap-mn complexes 0.9551 1 248
ID Description Score Start End Superfamily
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9692 13 124 3.90.230.10
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.963 1 246 3.90.230.10
af_Q54VU7_119_404_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.957 1 238 3.90.230.10
4fukB01 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9558 7 244 3.90.230.10
af_Q9VKV9_33_317_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9546 1 238 3.90.230.10
ID Description Score Start End GO Terms
AF-K1TLT8-F1-model_v4 Methionine aminopeptidase, type I 0.9855 54 178 GO:0005829
GO:0070006
AF-A0A099DCQ0-F1-model_v4 deleted 0.9853 30 171
AF-A0A383E9L4-F1-model_v4 Peptidase M24 domain-containing protein 0.983 2 158 GO:0070006
AF-A0A367M1J2-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9825 1 178 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-K0VC14-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9824 4 178 GO:0004239
GO:0006508
GO:0046872
GO:0070006

Feature Viewer

pLDDT pTM Quality
93.93 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map