F398275

General Info

Members Datasets Scaffolds Average Seq Length
305 181 606 346

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0018730|Ga0495651_0018730_3542_4702
Length 386
Sequence MPRTLPDCCDSGTAQPPAGTYWAKDPVRTLGDNDAPAEGNRMEPPAPRRRVTVVDVARHAQVSTTAVSKVLRNAYGASPEMRAKVRRAIDELGYRPHAGARGLRGQTYTIGVMLPDIRNPFFPEILDGITQALEGTEYQVLLGPGCNGEKAEARVTEAMIDRSMDGLVLVAPVSSRAHLERAAIAVPTVVVGRHGSSPLYDTVVNDDIEGAALVVGHLVGLGHRRIAHVEHHETDPTRLAEMPNARRADGYRQAMRAHGLERWIDVVSTSYTQEGGYRGAMELLDRPYPPTAVFAGADVVAMGVLEAVAEAGLSVPDDISVAGYDNTTFAAFGPVSLTSVDQAGNEIGRTAARLLRKRIADRHRPSVQVRLAPMLVARRTTARPPE

Samples

Sample ID Description Type Environment
1 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
101 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
102 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
103 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
104 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
105 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
109 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
110 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
166 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
167 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
168 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
169 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
172 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
173 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
174 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
175 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
176 2862574272 Streptomyces sp. AcE210 Isolate Nodule
177 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
178 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
179 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
180 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
181 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.72
Metatranscriptomes 0
Isolates 3.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.62
Nodule 0.98
Rhizoplane 3.28
Rhizosphere 83.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495651_0018730 3300046462 Bacteria 5363
2 JGI25406J46586_10000708 3300003203 Bacteria 15585
3 JGI25406J46586_10001752 3300003203 Bacteria 10203
4 Ga0070676_10030472 3300005328 Bacteria 3077
5 Ga0070683_100002546 3300005329 Bacteria 14556
6 Ga0070683_100008116 3300005329 Bacteria 8916
7 Ga0070683_100010841 3300005329 Bacteria 7847
8 Ga0070670_100047377 3300005331 Bacteria 3699
9 Ga0068869_100010894 3300005334 Bacteria 5948
10 Ga0068869_100041125 3300005334 Bacteria 3309
11 Ga0070680_100088689 3300005336 Bacteria 2559
12 Ga0070682_100018630 3300005337 Bacteria 4063
13 Ga0068868_100005263 3300005338 Bacteria 9081
14 Ga0070660_100040119 3300005339 Bacteria 3561
15 Ga0070661_100010386 3300005344 Bacteria 6472
16 Ga0070661_100055925 3300005344 Bacteria 2889
17 Ga0070661_100057800 3300005344 Bacteria 2842
18 Ga0070692_10040307 3300005345 Bacteria 2388
19 Ga0070668_100009856 3300005347 Bacteria 7077
20 Ga0070668_100262710 3300005347 Bacteria 1436
21 Ga0070669_100061660 3300005353 Bacteria 2756
22 Ga0070675_100001647 3300005354 Bacteria 16506
23 Ga0070675_100002073 3300005354 Bacteria 14856
24 Ga0070659_100015069 3300005366 Bacteria 5783
25 Ga0070659_100025244 3300005366 Bacteria 4562
26 Ga0070659_100144210 3300005366 Bacteria 1940
27 Ga0070714_100000844 3300005435 Bacteria 21724
28 Ga0070663_100283299 3300005455 Bacteria 1321
29 Ga0070678_100163310 3300005456 Bacteria 1807
30 Ga0070662_100093618 3300005457 Bacteria 2261
31 Ga0070681_10002707 3300005458 Bacteria 16307
32 Ga0070679_100003734 3300005530 Bacteria 13958
33 Ga0070684_100009764 3300005535 Bacteria 7576
34 Ga0070684_100088356 3300005535 Bacteria 2753
35 Ga0070665_100178326 3300005548 Bacteria 2126
36 Ga0070664_100002289 3300005564 Bacteria 15390
37 Ga0070664_100012022 3300005564 Bacteria 7032
38 Ga0068857_100032348 3300005577 Bacteria 4624
39 Ga0070702_100024151 3300005615 Bacteria 3239
40 Ga0070702_100040292 3300005615 Bacteria 2612
41 Ga0068859_100106645 3300005617 Bacteria 2861
42 Ga0068859_100357664 3300005617 Bacteria 1555
43 Ga0068864_100039993 3300005618 Bacteria 4010
44 Ga0068864_100082961 3300005618 Bacteria 2814
45 Ga0068861_100077490 3300005719 Bacteria 2593
46 Ga0068861_100342955 3300005719 Bacteria 1308
47 Ga0068851_10094042 3300005834 Bacteria 1582
48 Ga0068870_10101443 3300005840 Bacteria 1627
49 Ga0068863_100288461 3300005841 Bacteria 1591
50 Ga0068860_100060216 3300005843 Bacteria 3609
51 Ga0068862_100022291 3300005844 Bacteria 5297
52 Ga0068862_100025385 3300005844 Bacteria 4974
53 Ga0068862_100173550 3300005844 Bacteria 1931
54 Ga0081455_10038604 3300005937 Bacteria 4227
55 Ga0081540_1011267 3300005983 Bacteria 5988
56 Ga0081539_10000137 3300005985 Bacteria 171821
57 Ga0081539_10001632 3300005985 Bacteria 36555
58 Ga0081539_10003863 3300005985 Bacteria 17558
59 Ga0081539_10005615 3300005985 Bacteria 12628
60 Ga0070717_10369965 3300006028 Bacteria 1284
61 Ga0075428_100000132 3300006844 Bacteria 65638
62 Ga0075428_100050481 3300006844 Bacteria 4562
63 Ga0075430_100004422 3300006846 Bacteria 11859
64 Ga0075430_100022740 3300006846 Bacteria 5332
65 Ga0075431_100020951 3300006847 Bacteria 6680
66 Ga0075431_100079532 3300006847 Bacteria 3384
67 Ga0075431_100139716 3300006847 Bacteria 2497
68 Ga0075431_100328833 3300006847 Bacteria 1540
69 Ga0075434_100018230 3300006871 Bacteria 6780
70 Ga0075429_100023874 3300006880 Bacteria 5307
71 Ga0097620_100106645 3300006931 Bacteria 2861
72 Ga0097620_100357622 3300006931 Bacteria 1555
73 Ga0099826_10073124 3300006948 Bacteria 2168
74 Ga0111539_10000786 3300009094 Bacteria 41312
75 Ga0111539_10002698 3300009094 Bacteria 23522
76 Ga0105245_10000580 3300009098 Bacteria 33235
77 Ga0105245_10038271 3300009098 Bacteria 4268
78 Ga0105247_10119444 3300009101 Bacteria 1706
79 Ga0114129_10001151 3300009147 Bacteria 34998
80 Ga0114129_10004535 3300009147 Bacteria 19609
81 Ga0114129_10050161 3300009147 Bacteria 5863
82 Ga0105248_10157114 3300009177 Bacteria 2566
83 Ga0105239_10208186 3300010375 Bacteria 2192
84 Ga0157369_10013732 3300013105 Bacteria 9154
85 Ga0157375_10196897 3300013308 Bacteria 2170
86 Ga0163163_10038805 3300014325 Bacteria 4643
87 Ga0163163_10247171 3300014325 Bacteria 1834
88 Ga0157377_10000889 3300014745 Bacteria 12469
89 Ga0157377_10002662 3300014745 Bacteria 7927
90 Ga0157379_10118472 3300014968 Bacteria 2381
91 Ga0207707_10019888 3300025912 Bacteria 5860
92 Ga0207660_10075827 3300025917 Bacteria 2458
93 Ga0207657_10212210 3300025919 Bacteria 1553
94 Ga0207649_10010455 3300025920 Bacteria 5099
95 Ga0207649_10014101 3300025920 Bacteria 4473
96 Ga0207649_10017899 3300025920 Bacteria 4018
97 Ga0207652_10011176 3300025921 Bacteria 7236
98 Ga0207681_10067526 3300025923 Bacteria 2480
99 Ga0207659_10005858 3300025926 Bacteria 7495
100 Ga0207687_10003053 3300025927 Bacteria 11353
101 Ga0207687_10014850 3300025927 Bacteria 5100
102 Ga0207687_10217266 3300025927 Bacteria 1503
103 Ga0207690_10018396 3300025932 Bacteria 4285
104 Ga0207706_10181184 3300025933 Bacteria 1850
105 Ga0207711_10245359 3300025941 Bacteria 1643
106 Ga0207689_10006303 3300025942 Bacteria 10506
107 Ga0207689_10007044 3300025942 Bacteria 9886
108 Ga0207661_10001129 3300025944 Bacteria 17821
109 Ga0207661_10018145 3300025944 Bacteria 5227
110 Ga0207661_10018903 3300025944 Bacteria 5128
111 Ga0207661_10292323 3300025944 Bacteria 1459
112 Ga0207679_10004486 3300025945 Bacteria 8698
113 Ga0207679_10026430 3300025945 Bacteria 4002
114 Ga0207679_10027759 3300025945 Bacteria 3919
115 Ga0207668_10009339 3300025972 Bacteria 5871
116 Ga0207668_10171480 3300025972 Bacteria 1702
117 Ga0207668_10211612 3300025972 Bacteria 1551
118 Ga0207668_10238077 3300025972 Bacteria 1471
119 Ga0207658_10234827 3300025986 Bacteria 1550
120 Ga0207677_10003158 3300026023 Bacteria 8698
121 Ga0207677_10143382 3300026023 Bacteria 1832
122 Ga0207703_10065971 3300026035 Bacteria 2976
123 Ga0207678_10002272 3300026067 Bacteria 17394
124 Ga0207678_10015382 3300026067 Bacteria 6728
125 Ga0207708_10073408 3300026075 Bacteria 2622
126 Ga0207641_10560149 3300026088 Bacteria 1115
127 Ga0207676_10017496 3300026095 Bacteria 5196
128 Ga0207676_10129266 3300026095 Bacteria 2145
129 Ga0207674_10014186 3300026116 Bacteria 8807
130 Ga0207674_10154121 3300026116 Bacteria 2253
131 Ga0207674_10172934 3300026116 Bacteria 2113
132 Ga0207674_10230370 3300026116 Bacteria 1800
133 Ga0207674_10244248 3300026116 Bacteria 1742
134 Ga0207675_100047120 3300026118 Bacteria 4025
135 Ga0207683_10196153 3300026121 Bacteria 1835
136 Ga0207698_10016022 3300026142 Bacteria 5042
137 Ga0268265_10019209 3300028380 Bacteria 4746
138 Ga0268265_10021308 3300028380 Bacteria 4538
139 Ga0268265_10024972 3300028380 Bacteria 4236
140 Ga0268264_10081119 3300028381 Bacteria 2772
141 Ga0268264_10255427 3300028381 Bacteria 1630
142 Ga0307517_10079916 3300028786 Bacteria 2807
143 Ga0307515_10000027 3300028794 Bacteria 371624
144 Ga0307515_10002059 3300028794 Bacteria 44330
145 Ga0307515_10153253 3300028794 Bacteria 2396
146 Ga0307515_10162528 3300028794 Bacteria 2269
147 Ga0307512_10001052 3300030522 Bacteria 40344
148 Ga0307512_10050171 3300030522 Bacteria 3354
149 Ga0307513_10000508 3300031456 Bacteria 56049
150 Ga0307513_10001099 3300031456 Bacteria 39148
151 Ga0307513_10011155 3300031456 Bacteria 11192
152 Ga0307513_10023363 3300031456 Bacteria 7223
153 Ga0307408_100070489 3300031548 Bacteria 2581
154 Ga0307508_10006681 3300031616 Bacteria 10820
155 Ga0307508_10013543 3300031616 Bacteria 7454
156 Ga0307508_10181720 3300031616 Bacteria 1705
157 Ga0307516_10002495 3300031730 Bacteria 24542
158 Ga0307516_10028407 3300031730 Bacteria 5660
159 Ga0307405_10004923 3300031731 Bacteria 6377
160 Ga0307405_10072675 3300031731 Bacteria 2218
161 Ga0307518_10178543 3300031838 Bacteria 1438
162 Ga0307410_10260413 3300031852 Bacteria 1352
163 Ga0307406_10058607 3300031901 Bacteria 2475
164 Ga0307406_10276951 3300031901 Bacteria 1278
165 Ga0307406_10291258 3300031901 Bacteria 1250
166 Ga0307409_100027569 3300031995 Bacteria 4028
167 Ga0307409_100161125 3300031995 Bacteria 1962
168 Ga0307416_100071328 3300032002 Bacteria 2885
169 Ga0307416_100131433 3300032002 Bacteria 2254
170 Ga0307416_100231410 3300032002 Bacteria 1782
171 Ga0307415_100003030 3300032126 Bacteria 8465
172 Ga0307415_100069201 3300032126 Bacteria 2474
173 Ga0307415_100368551 3300032126 Bacteria 1215
174 Ga0307507_10000821 3300033179 Bacteria 68944
175 Ga0307507_10009293 3300033179 Bacteria 13163
176 Ga0307507_10018332 3300033179 Bacteria 7968
177 Ga0307507_10081357 3300033179 Bacteria 2849
178 Ga0373938_0004431 3300034957 Bacteria 2347
179 Ga0373928_0011409 3300035084 Bacteria 1759
180 Ga0373951_0002397 3300035091 Bacteria 4735
181 Ga0373942_0005176 3300035207 Bacteria 3021
182 Ga0373962_0016890 3300035242 Bacteria 1886
183 Ga0373935_0003221 3300035692 Bacteria 9426
184 Ga0373925_0095885 3300037068 Bacteria 2273
185 Ga0451795_0947044 3300041456 Bacteria 2218
186 Ga0451798_0950389 3300041458 Bacteria 1797
187 Ga0451843_0111265 3300041509 Bacteria 4701
188 Ga0451853_0845224 3300041512 Bacteria 1972
189 Ga0451853_1587659 3300041512 Bacteria 3053
190 Ga0495592_0000011 3300046454 Bacteria 156647
191 Ga0495592_0008305 3300046454 Bacteria 7791
192 Ga0495629_0000827 3300046459 Bacteria 25099
193 Ga0495629_0006409 3300046459 Bacteria 8723
194 Ga0495638_0025919 3300046460 Bacteria 3806
195 Ga0495638_0083571 3300046460 Bacteria 1934
196 Ga0495651_0003289 3300046462 Bacteria 12406
197 Ga0495651_0003786 3300046462 Bacteria 11572
198 Ga0495651_0004365 3300046462 Bacteria 10821
199 Ga0495653_0000345 3300046463 Bacteria 37856
200 Ga0495662_0000141 3300046476 Bacteria 27833
201 Ga0495662_0009221 3300046476 Bacteria 4840
202 Ga0495664_0000520 3300046477 Bacteria 19243
203 Ga0495664_0001631 3300046477 Bacteria 11919
204 Ga0495608_0175104 3300046511 Bacteria 1359
205 Ga0495618_0016401 3300046514 Bacteria 4531
206 Ga0495618_0019935 3300046514 Bacteria 4128
207 Ga0495628_0000064 3300046516 Bacteria 85991
208 Ga0495628_0049710 3300046516 Bacteria 3319
209 Ga0495630_0000035 3300046517 Bacteria 118545
210 Ga0495666_0000539 3300046526 Bacteria 16851
211 Ga0495652_0000169 3300046529 Bacteria 74610
212 Ga0495652_0188771 3300046529 Bacteria 1575
213 Ga0495652_0241955 3300046529 Bacteria 1342
214 Ga0495640_0002459 3300046533 Bacteria 14887
215 Ga0495587_0000064 3300046536 Bacteria 90007
216 Ga0495587_0001922 3300046536 Bacteria 13843
217 Ga0495645_0000042 3300046543 Bacteria 91093
218 Ga0495622_0036223 3300046557 Bacteria 2301
219 Ga0495667_0002691 3300046559 Bacteria 11886
220 Ga0495667_0016144 3300046559 Bacteria 5045
221 Ga0495634_0000148 3300046642 Bacteria 62329
222 Ga0495634_0004398 3300046642 Bacteria 11082
223 Ga0495635_0000032 3300046663 Bacteria 109069
224 Ga0495635_0002578 3300046663 Bacteria 12401
225 Ga0495635_0025113 3300046663 Bacteria 4151
226 Ga0495635_0053505 3300046663 Bacteria 2781
227 Ga0495657_0000075 3300046675 Bacteria 89389
228 Ga0495657_0000862 3300046675 Bacteria 26723
229 Ga0495657_0002582 3300046675 Bacteria 15165
230 Ga0495657_0005794 3300046675 Bacteria 9733
231 Ga0495599_0000044 3300046678 Bacteria 89350
232 Ga0495623_0001203 3300046679 Bacteria 17541
233 Ga0495646_0000028 3300046680 Bacteria 92735
234 Ga0495646_0003174 3300046680 Bacteria 10204
235 Ga0495658_0024470 3300046683 Bacteria 3217
236 Ga0495613_0000586 3300046689 Bacteria 29455
237 Ga0495613_0001051 3300046689 Bacteria 21064
238 Ga0495613_0002107 3300046689 Bacteria 15108
239 Ga0495613_0003748 3300046689 Bacteria 11396
240 Ga0495613_0012599 3300046689 Bacteria 6288
241 Ga0495589_0062679 3300046794 Bacteria 1824
242 Ga0495600_0000044 3300046809 Bacteria 71943
243 Ga0495600_0000312 3300046809 Bacteria 25755
244 Ga0495600_0010284 3300046809 Bacteria 5802
245 Ga0495581_0002865 3300047315 Bacteria 9852
246 Ga0495581_0151976 3300047315 Bacteria 1352
247 Ga0495604_0000162 3300047317 Bacteria 59086
248 Ga0495604_0000545 3300047317 Bacteria 33154
249 Ga0495674_0000036 3300047319 Bacteria 103830
250 Ga0495674_0070108 3300047319 Bacteria 3030
251 Ga0495674_0301112 3300047319 Bacteria 1309
252 Ga0495676_0005295 3300047321 Bacteria 11809
253 Ga0495676_0005498 3300047321 Bacteria 11624
254 Ga0495680_0004036 3300047322 Bacteria 14162
255 Ga0495675_0000126 3300047444 Bacteria 54783
256 Ga0495675_0064898 3300047444 Bacteria 2309
257 Ga0495684_0000474 3300047471 Bacteria 32805
258 Ga0495686_0170292 3300047472 Bacteria 1267
259 Ga0495593_0002178 3300047673 Bacteria 11724
260 Ga0495593_0028196 3300047673 Bacteria 3085
261 Ga0495602_0000078 3300048088 Bacteria 94384
262 Ga0495614_0000643 3300048089 Bacteria 14601
263 Ga0496105_0027162 3300048908 Bacteria 4673
264 Ga0496108_0000066 3300048911 Bacteria 116839
265 Ga0496108_0058106 3300048911 Bacteria 3250
266 Ga0496111_0110700 3300048914 Bacteria 2022
267 Ga0496112_0035049 3300048915 Bacteria 4885
268 Ga0496112_0075063 3300048915 Bacteria 3343
269 Ga0496113_0007938 3300048916 Bacteria 6872
270 Ga0501046_0100317 3300049580 Bacteria 2222
271 nmdc:mga05p37_1609_c1 3300050507 Bacteria 26157
272 nmdc:mga05p37_4990_c1 3300050507 Bacteria 15553
273 nmdc:mga09592_45555_c1 3300050508 Bacteria 3695
274 nmdc:mga0qj67_14451_c1 3300050509 Bacteria 5969
275 nmdc:mga06r32_127511_c1 3300050510 Bacteria 2514
276 nmdc:mga06r32_145929_c1 3300050510 Bacteria 2343
277 nmdc:mga06r32_318992_c1 3300050510 Bacteria 1539
278 nmdc:mga06r32_66647_c1 3300050510 Bacteria 3474
279 nmdc:mga08y16_1077_c1 3300050511 Bacteria 26883
280 nmdc:mga08y16_27843_c1 3300050511 Bacteria 5957
281 nmdc:mga0n895_5241_c1 3300050512 Bacteria 10802
282 Ga0495601_0001449 3300053077 Bacteria 13074
283 Ga0495601_0041487 3300053077 Bacteria 2885
284 Ga0495612_0016790 3300053078 Bacteria 2932
285 Ga0495619_0050279 3300053085 Bacteria 2751
286 Ga0500644_0011109 3300053088 Bacteria 2454
287 Ga0500640_051133 3300053095 Bacteria 1807
288 Ga0500652_044347 3300053131 Bacteria 1800
289 Ga0500600_0095365 3300053149 Bacteria 1580
290 Ga0500604_0015240 3300053151 Bacteria 2103
291 Ga0500616_0001346 3300053153 Bacteria 24012
292 Ga0500616_0004455 3300053153 Bacteria 9972
293 Ga0500624_001909 3300053157 Bacteria 3000
294 2585306511 2582581313 Bacteria 10042643
295 2616701074 2616644814 Bacteria 11555299
296 2676486617 2675903059 Bacteria 8644972
297 2857293103 2857288857 Bacteria 7189066
298 2862575781 2862574272 Bacteria 10567477
299 2867305949 2867302475 Bacteria 7087181
300 2895427570 2895427314 Bacteria 13147766
301 2929222633 2929219909 Bacteria 6984360
302 8008565136 8008558824 Bacteria 10610750
303 8045833772 8045830549 Bacteria 4444727
304 Ga0495651_0018730
305 JGI25406J46586_10000708
306 JGI25406J46586_10001752
307 Ga0070676_10030472
308 Ga0070683_100002546
309 Ga0070683_100008116
310 Ga0070683_100010841
311 Ga0070670_100047377
312 Ga0068869_100010894
313 Ga0068869_100041125
314 Ga0070680_100088689
315 Ga0070682_100018630
316 Ga0068868_100005263
317 Ga0070660_100040119
318 Ga0070661_100010386
319 Ga0070661_100055925
320 Ga0070661_100057800
321 Ga0070692_10040307
322 Ga0070668_100009856
323 Ga0070668_100262710
324 Ga0070669_100061660
325 Ga0070675_100001647
326 Ga0070675_100002073
327 Ga0070659_100015069
328 Ga0070659_100025244
329 Ga0070659_100144210
330 Ga0070714_100000844
331 Ga0070663_100283299
332 Ga0070678_100163310
333 Ga0070662_100093618
334 Ga0070681_10002707
335 Ga0070679_100003734
336 Ga0070684_100009764
337 Ga0070684_100088356
338 Ga0070665_100178326
339 Ga0070664_100002289
340 Ga0070664_100012022
341 Ga0068857_100032348
342 Ga0070702_100024151
343 Ga0070702_100040292
344 Ga0068859_100106645
345 Ga0068859_100357664
346 Ga0068864_100039993
347 Ga0068864_100082961
348 Ga0068861_100077490
349 Ga0068861_100342955
350 Ga0068851_10094042
351 Ga0068870_10101443
352 Ga0068863_100288461
353 Ga0068860_100060216
354 Ga0068862_100022291
355 Ga0068862_100025385
356 Ga0068862_100173550
357 Ga0081455_10038604
358 Ga0081540_1011267
359 Ga0081539_10000137
360 Ga0081539_10001632
361 Ga0081539_10003863
362 Ga0081539_10005615
363 Ga0070717_10369965
364 Ga0075428_100000132
365 Ga0075428_100050481
366 Ga0075430_100004422
367 Ga0075430_100022740
368 Ga0075431_100020951
369 Ga0075431_100079532
370 Ga0075431_100139716
371 Ga0075431_100328833
372 Ga0075434_100018230
373 Ga0075429_100023874
374 Ga0097620_100106645
375 Ga0097620_100357622
376 Ga0099826_10073124
377 Ga0111539_10000786
378 Ga0111539_10002698
379 Ga0105245_10000580
380 Ga0105245_10038271
381 Ga0105247_10119444
382 Ga0114129_10001151
383 Ga0114129_10004535
384 Ga0114129_10050161
385 Ga0105248_10157114
386 Ga0105239_10208186
387 Ga0157369_10013732
388 Ga0157375_10196897
389 Ga0163163_10038805
390 Ga0163163_10247171
391 Ga0157377_10000889
392 Ga0157377_10002662
393 Ga0157379_10118472
394 Ga0207707_10019888
395 Ga0207660_10075827
396 Ga0207657_10212210
397 Ga0207649_10010455
398 Ga0207649_10014101
399 Ga0207649_10017899
400 Ga0207652_10011176
401 Ga0207681_10067526
402 Ga0207659_10005858
403 Ga0207687_10003053
404 Ga0207687_10014850
405 Ga0207687_10217266
406 Ga0207690_10018396
407 Ga0207706_10181184
408 Ga0207711_10245359
409 Ga0207689_10006303
410 Ga0207689_10007044
411 Ga0207661_10001129
412 Ga0207661_10018145
413 Ga0207661_10018903
414 Ga0207661_10292323
415 Ga0207679_10004486
416 Ga0207679_10026430
417 Ga0207679_10027759
418 Ga0207668_10009339
419 Ga0207668_10171480
420 Ga0207668_10211612
421 Ga0207668_10238077
422 Ga0207658_10234827
423 Ga0207677_10003158
424 Ga0207677_10143382
425 Ga0207703_10065971
426 Ga0207678_10002272
427 Ga0207678_10015382
428 Ga0207708_10073408
429 Ga0207641_10560149
430 Ga0207676_10017496
431 Ga0207676_10129266
432 Ga0207674_10014186
433 Ga0207674_10154121
434 Ga0207674_10172934
435 Ga0207674_10230370
436 Ga0207674_10244248
437 Ga0207675_100047120
438 Ga0207683_10196153
439 Ga0207698_10016022
440 Ga0268265_10019209
441 Ga0268265_10021308
442 Ga0268265_10024972
443 Ga0268264_10081119
444 Ga0268264_10255427
445 Ga0307517_10079916
446 Ga0307515_10000027
447 Ga0307515_10002059
448 Ga0307515_10153253
449 Ga0307515_10162528
450 Ga0307512_10001052
451 Ga0307512_10050171
452 Ga0307513_10000508
453 Ga0307513_10001099
454 Ga0307513_10011155
455 Ga0307513_10023363
456 Ga0307408_100070489
457 Ga0307508_10006681
458 Ga0307508_10013543
459 Ga0307508_10181720
460 Ga0307516_10002495
461 Ga0307516_10028407
462 Ga0307405_10004923
463 Ga0307405_10072675
464 Ga0307518_10178543
465 Ga0307410_10260413
466 Ga0307406_10058607
467 Ga0307406_10276951
468 Ga0307406_10291258
469 Ga0307409_100027569
470 Ga0307409_100161125
471 Ga0307416_100071328
472 Ga0307416_100131433
473 Ga0307416_100231410
474 Ga0307415_100003030
475 Ga0307415_100069201
476 Ga0307415_100368551
477 Ga0307507_10000821
478 Ga0307507_10009293
479 Ga0307507_10018332
480 Ga0307507_10081357
481 Ga0373938_0004431
482 Ga0373928_0011409
483 Ga0373951_0002397
484 Ga0373942_0005176
485 Ga0373962_0016890
486 Ga0373935_0003221
487 Ga0373925_0095885
488 Ga0451795_0947044
489 Ga0451798_0950389
490 Ga0451843_0111265
491 Ga0451853_0845224
492 Ga0451853_1587659
493 Ga0495592_0000011
494 Ga0495592_0008305
495 Ga0495629_0000827
496 Ga0495629_0006409
497 Ga0495638_0025919
498 Ga0495638_0083571
499 Ga0495651_0003289
500 Ga0495651_0003786
501 Ga0495651_0004365
502 Ga0495653_0000345
503 Ga0495662_0000141
504 Ga0495662_0009221
505 Ga0495664_0000520
506 Ga0495664_0001631
507 Ga0495608_0175104
508 Ga0495618_0016401
509 Ga0495618_0019935
510 Ga0495628_0000064
511 Ga0495628_0049710
512 Ga0495630_0000035
513 Ga0495666_0000539
514 Ga0495652_0000169
515 Ga0495652_0188771
516 Ga0495652_0241955
517 Ga0495640_0002459
518 Ga0495587_0000064
519 Ga0495587_0001922
520 Ga0495645_0000042
521 Ga0495622_0036223
522 Ga0495667_0002691
523 Ga0495667_0016144
524 Ga0495634_0000148
525 Ga0495634_0004398
526 Ga0495635_0000032
527 Ga0495635_0002578
528 Ga0495635_0025113
529 Ga0495635_0053505
530 Ga0495657_0000075
531 Ga0495657_0000862
532 Ga0495657_0002582
533 Ga0495657_0005794
534 Ga0495599_0000044
535 Ga0495623_0001203
536 Ga0495646_0000028
537 Ga0495646_0003174
538 Ga0495658_0024470
539 Ga0495613_0000586
540 Ga0495613_0001051
541 Ga0495613_0002107
542 Ga0495613_0003748
543 Ga0495613_0012599
544 Ga0495589_0062679
545 Ga0495600_0000044
546 Ga0495600_0000312
547 Ga0495600_0010284
548 Ga0495581_0002865
549 Ga0495581_0151976
550 Ga0495604_0000162
551 Ga0495604_0000545
552 Ga0495674_0000036
553 Ga0495674_0070108
554 Ga0495674_0301112
555 Ga0495676_0005295
556 Ga0495676_0005498
557 Ga0495680_0004036
558 Ga0495675_0000126
559 Ga0495675_0064898
560 Ga0495684_0000474
561 Ga0495686_0170292
562 Ga0495593_0002178
563 Ga0495593_0028196
564 Ga0495602_0000078
565 Ga0495614_0000643
566 Ga0496105_0027162
567 Ga0496108_0000066
568 Ga0496108_0058106
569 Ga0496111_0110700
570 Ga0496112_0035049
571 Ga0496112_0075063
572 Ga0496113_0007938
573 Ga0501046_0100317
574 nmdc:mga05p37_1609_c1
575 nmdc:mga05p37_4990_c1
576 nmdc:mga09592_45555_c1
577 nmdc:mga0qj67_14451_c1
578 nmdc:mga06r32_127511_c1
579 nmdc:mga06r32_145929_c1
580 nmdc:mga06r32_318992_c1
581 nmdc:mga06r32_66647_c1
582 nmdc:mga08y16_1077_c1
583 nmdc:mga08y16_27843_c1
584 nmdc:mga0n895_5241_c1
585 Ga0495601_0001449
586 Ga0495601_0041487
587 Ga0495612_0016790
588 Ga0495619_0050279
589 Ga0500644_0011109
590 Ga0500640_051133
591 Ga0500652_044347
592 Ga0500600_0095365
593 Ga0500604_0015240
594 Ga0500616_0001346
595 Ga0500616_0004455
596 Ga0500624_001909
597 2585306511
598 2616701074
599 2676486617
600 2857293103
601 2862575781
602 2867305949
603 2895427570
604 2929222633
605 8008565136
606 8045833772

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00356

LacI

Bacterial regulatory proteins, lacI family

52

97

0.96

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

107

376

0.91

PF13377

Peripla_BP_3

Periplasmic binding protein-like domain

215

381

0.88

PF13407

Peripla_BP_4

Periplasmic binding protein domain

110

362

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k9c-assembly1.cif.gz_A crystal structure of laci transcriptional regulator from rhodococcus species. 0.9468 68 342
3k9c-assembly1.cif.gz_A crystal structure of laci transcriptional regulator from rhodococcus species. 0.9298 68 342
2kei-assembly1.cif.gz_A refined solution structure of a dimer of lac repressor dna-binding domain complexed to its natural operator o1 0.9289 8 60
3bil-assembly1.cif.gz_B crystal structure of a probable laci family transcriptional regulator from corynebacterium glutamicum 0.9208 69 342
3c3k-assembly1.cif.gz_A crystal structure of an uncharacterized protein from actinobacillus succinogenes 0.9183 65 340
ID Description Score Start End Superfamily
2jcgA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9535 10 57 1.10.260.40
1jh9A01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9301 11 60 1.10.260.40
1qpzA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9274 11 60 1.10.260.40
1jfsA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9252 11 60 1.10.260.40
1qqbA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.925 11 60 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A2T0JNI9-F1-model_v4 Substrate-binding family protein 0.9964 149 341 GO:0000976
GO:0003700
AF-A0A2T0JNI9-F1-model_v4 Substrate-binding family protein 0.9762 149 341 GO:0000976
GO:0003700
AF-A0A3N5T0C2-F1-model_v4 Transcriptional regulator LacI/GalR-like sensor domain-containing protein 0.9632 231 339 GO:0000976
GO:0003700
AF-A0A7G8PHN5-F1-model_v4 Substrate-binding domain-containing protein 0.9512 73 341 GO:0000976
GO:0003700
AF-A0A4V0ZJI8-F1-model_v4 Lactose operon repressor 0.9408 162 345 GO:0000976
GO:0003700

Map