F398158

General Info

Members Datasets Scaffolds Average Seq Length
305 170 610 100

Family's Representative Sequence

Representative Sequence 3300025945|Ga0207679_10095590|Ga0207679_100955903
Length 112
Sequence MTGYLISGDIGGTKTLLQAAELKDGGMQVRCERRYASREYGSFSDVLKNSIDEVSRLQQDASQAVEDLMTKKTENVTGVMTAMEKSDLAFKTLLAIRSKLMDAYEEIKNISV

Samples

Sample ID Description Type Environment
1 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
138 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.66
Rhizosphere 99.02
Stem 0
Stem Tuber 0
Unclassified 49.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207679_10095590 3300025945 Bacteria 2310
2 JGI25406J46586_10048511 3300003203 Bacteria 1439
3 Ga0070658_10165247 3300005327 Unclassified 1858
4 Ga0070676_10116069 3300005328 Unclassified 1674
5 Ga0070676_10768360 3300005328 Unclassified 709
6 Ga0070683_100516302 3300005329 Unclassified 1142
7 Ga0070683_102234459 3300005329 Unclassified 525
8 Ga0070670_100588554 3300005331 Unclassified 995
9 Ga0070670_101020165 3300005331 Unclassified 753
10 Ga0070670_101368458 3300005331 Unclassified 649
11 Ga0070666_10085860 3300005335 Bacteria 2156
12 Ga0070666_10416549 3300005335 Unclassified 967
13 Ga0068868_100871894 3300005338 Bacteria 816
14 Ga0068868_101496504 3300005338 Unclassified 632
15 Ga0068868_102309349 3300005338 Unclassified 513
16 Ga0070660_100703921 3300005339 Unclassified 847
17 Ga0070692_10544472 3300005345 Bacteria 759
18 Ga0070668_100182471 3300005347 Unclassified 1715
19 Ga0070669_100105359 3300005353 Bacteria 2133
20 Ga0070669_100728513 3300005353 Unclassified 839
21 Ga0070669_101791626 3300005353 Bacteria 536
22 Ga0070675_100089085 3300005354 Bacteria 2583
23 Ga0070675_100169561 3300005354 Unclassified 1881
24 Ga0070675_100597115 3300005354 Unclassified 1001
25 Ga0070675_101606696 3300005354 Unclassified 600
26 Ga0070671_100145176 3300005355 Unclassified 2003
27 Ga0070671_100174016 3300005355 Bacteria 1821
28 Ga0070674_100096805 3300005356 Unclassified 2142
29 Ga0070673_100174560 3300005364 Bacteria 1836
30 Ga0070673_100668316 3300005364 Unclassified 952
31 Ga0070714_100033186 3300005435 Bacteria 4315
32 Ga0070714_100092467 3300005435 Unclassified 2651
33 Ga0070714_101967799 3300005435 Unclassified 570
34 Ga0070713_100260637 3300005436 Bacteria 1584
35 Ga0070700_101730461 3300005441 Bacteria 537
36 Ga0070678_100810437 3300005456 Unclassified 851
37 Ga0070678_101148406 3300005456 Unclassified 719
38 Ga0070681_10144080 3300005458 Unclassified 2312
39 Ga0068867_100129001 3300005459 Unclassified 1963
40 Ga0070679_101072466 3300005530 Bacteria 750
41 Ga0070684_100489269 3300005535 Unclassified 1139
42 Ga0070684_101601694 3300005535 Bacteria 614
43 Ga0068853_101986456 3300005539 Unclassified 564
44 Ga0070672_100049835 3300005543 Bacteria 3260
45 Ga0070672_101165875 3300005543 Unclassified 686
46 Ga0070665_100001964 3300005548 Bacteria 23135
47 Ga0070665_100155885 3300005548 Bacteria 2286
48 Ga0070665_100233640 3300005548 Bacteria 1839
49 Ga0070665_102440635 3300005548 Unclassified 525
50 Ga0068855_100323887 3300005563 Unclassified 1703
51 Ga0068855_102475704 3300005563 Bacteria 517
52 Ga0070664_100505894 3300005564 Bacteria 1114
53 Ga0070664_101108023 3300005564 Unclassified 746
54 Ga0070664_101199926 3300005564 Unclassified 716
55 Ga0068854_100240721 3300005578 Unclassified 1441
56 Ga0068854_102065508 3300005578 Archaea 526
57 Ga0068856_100654601 3300005614 Bacteria 1071
58 Ga0070702_101701626 3300005615 Unclassified 524
59 Ga0068852_100636685 3300005616 Bacteria 1073
60 Ga0068864_100323298 3300005618 Unclassified 1449
61 Ga0068864_100928767 3300005618 Unclassified 860
62 Ga0068864_101354213 3300005618 Unclassified 713
63 Ga0068866_10136901 3300005718 Bacteria 1401
64 Ga0068863_100109388 3300005841 Bacteria 2631
65 Ga0068863_100482864 3300005841 Unclassified 1219
66 Ga0068858_101249445 3300005842 Unclassified 730
67 Ga0068860_100260285 3300005843 Unclassified 1691
68 Ga0068860_101164240 3300005843 Bacteria 791
69 Ga0081539_10029015 3300005985 Bacteria 3467
70 Ga0070717_10210707 3300006028 Bacteria 1705
71 Ga0070717_10842376 3300006028 Unclassified 834
72 Ga0097621_101408446 3300006237 Bacteria 660
73 Ga0097621_101763202 3300006237 Bacteria 590
74 Ga0068871_100343332 3300006358 Bacteria 1319
75 Ga0068871_102228221 3300006358 Bacteria 522
76 Ga0075428_101445097 3300006844 Unclassified 721
77 Ga0075430_100204706 3300006846 Bacteria 1638
78 Ga0075430_100771204 3300006846 Unclassified 792
79 Ga0075431_100173848 3300006847 Unclassified 2212
80 Ga0075431_100290165 3300006847 Bacteria 1655
81 Ga0075429_100033843 3300006880 Bacteria 4439
82 Ga0105240_10653155 3300009093 Bacteria 1152
83 Ga0105245_10079180 3300009098 Unclassified 3000
84 Ga0105245_10149445 3300009098 Bacteria 2207
85 Ga0105245_10271345 3300009098 Unclassified 1655
86 Ga0105245_10431887 3300009098 Bacteria 1322
87 Ga0105247_11244833 3300009101 Unclassified 595
88 Ga0105241_10209526 3300009174 Bacteria 1632
89 Ga0105241_11507272 3300009174 Bacteria 647
90 Ga0105242_12927889 3300009176 Unclassified 528
91 Ga0105248_10194129 3300009177 Unclassified 2287
92 Ga0105248_13391458 3300009177 Unclassified 506
93 Ga0105237_11931789 3300009545 Bacteria 598
94 Ga0105237_12171156 3300009545 Unclassified 565
95 Ga0105238_10210327 3300009551 Unclassified 1921
96 Ga0105238_11449332 3300009551 Unclassified 714
97 Ga0105238_11538362 3300009551 Unclassified 694
98 Ga0105238_11769029 3300009551 Bacteria 650
99 Ga0105249_11071521 3300009553 Bacteria 876
100 Ga0105249_11819517 3300009553 Unclassified 682
101 Ga0105239_10300917 3300010375 Bacteria 1806
102 Ga0105239_12052978 3300010375 Bacteria 664
103 Ga0157373_10078447 3300013100 Unclassified 2329
104 Ga0157373_10133332 3300013100 Unclassified 1746
105 Ga0157373_10257600 3300013100 Bacteria 1234
106 Ga0157371_10088197 3300013102 Unclassified 2196
107 Ga0157371_10249715 3300013102 Unclassified 1277
108 Ga0157371_10681846 3300013102 Unclassified 768
109 Ga0157370_10049786 3300013104 Bacteria 4008
110 Ga0157370_10072813 3300013104 Bacteria 3242
111 Ga0157369_10137454 3300013105 Bacteria 2586
112 Ga0157369_10405625 3300013105 Bacteria 1414
113 Ga0157369_10845305 3300013105 Unclassified 940
114 Ga0157369_10924386 3300013105 Unclassified 894
115 Ga0157369_10950298 3300013105 Bacteria 881
116 Ga0157369_11314232 3300013105 Unclassified 737
117 Ga0157369_11390912 3300013105 Unclassified 714
118 Ga0157374_10732837 3300013296 Unclassified 1003
119 Ga0157374_11362928 3300013296 Unclassified 732
120 Ga0157374_11520402 3300013296 Bacteria 693
121 Ga0157374_11833882 3300013296 Unclassified 632
122 Ga0157378_10393151 3300013297 Bacteria 1364
123 Ga0157378_10743511 3300013297 Bacteria 1003
124 Ga0157378_11069663 3300013297 Archaea 843
125 Ga0163162_12314824 3300013306 Unclassified 617
126 Ga0163162_12660806 3300013306 Unclassified 576
127 Ga0157372_10077821 3300013307 Bacteria 3747
128 Ga0157372_10090582 3300013307 Bacteria 3477
129 Ga0157372_10277666 3300013307 Unclassified 1948
130 Ga0157372_10571842 3300013307 Unclassified 1317
131 Ga0157372_10692691 3300013307 Bacteria 1186
132 Ga0157372_11227300 3300013307 Unclassified 866
133 Ga0157372_11272101 3300013307 Unclassified 849
134 Ga0157372_12325984 3300013307 Bacteria 615
135 Ga0157372_12767231 3300013307 Bacteria 563
136 Ga0157372_12784467 3300013307 Bacteria 561
137 Ga0157375_10389569 3300013308 Bacteria 1560
138 Ga0157375_11174139 3300013308 Bacteria 900
139 Ga0157375_12767340 3300013308 Unclassified 586
140 Ga0157375_12855652 3300013308 Bacteria 577
141 Ga0157375_13008327 3300013308 Bacteria 563
142 Ga0163163_11687543 3300014325 Bacteria 694
143 Ga0163163_11688336 3300014325 Unclassified 694
144 Ga0163163_12382443 3300014325 Bacteria 588
145 Ga0157380_10175859 3300014326 Bacteria 1875
146 Ga0157380_10419914 3300014326 Bacteria 1275
147 Ga0182008_10196462 3300014497 Bacteria 1025
148 Ga0182008_10273700 3300014497 Bacteria 877
149 Ga0157379_10230832 3300014968 Bacteria 1677
150 Ga0157376_11442387 3300014969 Bacteria 721
151 Ga0157376_11523713 3300014969 Unclassified 702
152 Ga0197907_11176922 3300020069 Unclassified 963
153 Ga0206353_10696880 3300020082 Unclassified 760
154 Ga0207656_10431299 3300025321 Unclassified 665
155 Ga0207680_10169762 3300025903 Bacteria 1468
156 Ga0207680_10488143 3300025903 Unclassified 877
157 Ga0207680_10796447 3300025903 Unclassified 678
158 Ga0207645_10049608 3300025907 Bacteria 2680
159 Ga0207645_10741871 3300025907 Unclassified 668
160 Ga0207705_10501465 3300025909 Unclassified 943
161 Ga0207705_11323262 3300025909 Unclassified 550
162 Ga0207684_10406687 3300025910 Unclassified 1170
163 Ga0207654_10428021 3300025911 Unclassified 925
164 Ga0207707_10288652 3300025912 Unclassified 1420
165 Ga0207695_10253336 3300025913 Bacteria 1659
166 Ga0207662_11346628 3300025918 Bacteria 507
167 Ga0207657_11184047 3300025919 Bacteria 581
168 Ga0207649_10366519 3300025920 Archaea 1070
169 Ga0207681_10100288 3300025923 Bacteria 2087
170 Ga0207681_11157335 3300025923 Unclassified 650
171 Ga0207694_10957364 3300025924 Unclassified 724
172 Ga0207650_10840620 3300025925 Unclassified 779
173 Ga0207659_10015035 3300025926 Bacteria 5005
174 Ga0207659_10200839 3300025926 Unclassified 1592
175 Ga0207659_10216686 3300025926 Unclassified 1537
176 Ga0207659_10542574 3300025926 Unclassified 988
177 Ga0207687_10029250 3300025927 Bacteria 3705
178 Ga0207687_10066373 3300025927 Unclassified 2564
179 Ga0207687_10428141 3300025927 Bacteria 1093
180 Ga0207700_11252052 3300025928 Unclassified 662
181 Ga0207664_10033054 3300025929 Bacteria 3971
182 Ga0207644_10110679 3300025931 Unclassified 2076
183 Ga0207644_10695684 3300025931 Bacteria 848
184 Ga0207690_11484181 3300025932 Unclassified 567
185 Ga0207706_10190822 3300025933 Bacteria 1798
186 Ga0207706_10637391 3300025933 Unclassified 913
187 Ga0207686_10715063 3300025934 Unclassified 797
188 Ga0207669_10248291 3300025937 Unclassified 1323
189 Ga0207691_10070773 3300025940 Unclassified 3149
190 Ga0207691_10584475 3300025940 Unclassified 946
191 Ga0207691_10663797 3300025940 Bacteria 880
192 Ga0207691_11456522 3300025940 Unclassified 561
193 Ga0207711_11524986 3300025941 Unclassified 611
194 Ga0207661_10064901 3300025944 Bacteria 2962
195 Ga0207661_10268898 3300025944 Bacteria 1521
196 Ga0207661_10571103 3300025944 Bacteria 1037
197 Ga0207679_10106182 3300025945 Unclassified 2207
198 Ga0207679_10422428 3300025945 Unclassified 1177
199 Ga0207667_10199048 3300025949 Unclassified 2055
200 Ga0207651_10052747 3300025960 Bacteria 2775
201 Ga0207651_10197976 3300025960 Bacteria 1608
202 Ga0207651_10271500 3300025960 Unclassified 1397
203 Ga0207712_11572263 3300025961 Bacteria 589
204 Ga0207668_10339814 3300025972 Unclassified 1252
205 Ga0207668_11578197 3300025972 Archaea 592
206 Ga0207640_11424587 3300025981 Bacteria 621
207 Ga0207658_10594534 3300025986 Bacteria 994
208 Ga0207658_11698671 3300025986 Unclassified 577
209 Ga0207677_10109498 3300026023 Unclassified 2054
210 Ga0207703_10993442 3300026035 Bacteria 805
211 Ga0207639_11218427 3300026041 Unclassified 706
212 Ga0207702_11632566 3300026078 Bacteria 638
213 Ga0207641_10431194 3300026088 Unclassified 1271
214 Ga0207641_10460954 3300026088 Unclassified 1230
215 Ga0207648_10652704 3300026089 Unclassified 972
216 Ga0207648_11189448 3300026089 Unclassified 716
217 Ga0207676_10945809 3300026095 Unclassified 847
218 Ga0207674_10595728 3300026116 Unclassified 1068
219 Ga0207683_10144378 3300026121 Bacteria 2145
220 Ga0207683_11427387 3300026121 Unclassified 640
221 Ga0207683_11428747 3300026121 Unclassified 639
222 Ga0207698_10108456 3300026142 Bacteria 2321
223 Ga0207698_12076993 3300026142 Bacteria 582
224 Ga0268266_10043281 3300028379 Bacteria 3848
225 Ga0268266_10125006 3300028379 Bacteria 2294
226 Ga0268266_10770941 3300028379 Bacteria 929
227 Ga0268265_10299201 3300028380 Bacteria 1448
228 Ga0268264_10287832 3300028381 Unclassified 1542
229 Ga0307413_10648401 3300031824 Unclassified 871
230 Ga0307410_10046155 3300031852 Bacteria 2906
231 Ga0307410_10713791 3300031852 Bacteria 846
232 Ga0307410_11347700 3300031852 Unclassified 625
233 Ga0307410_11606316 3300031852 Unclassified 575
234 Ga0307406_10458788 3300031901 Bacteria 1024
235 Ga0307406_11592351 3300031901 Bacteria 577
236 Ga0307407_10365997 3300031903 Bacteria 1025
237 Ga0307412_10934816 3300031911 Bacteria 762
238 Ga0307412_12157426 3300031911 Unclassified 518
239 Ga0307409_100126806 3300031995 Bacteria 2173
240 Ga0307409_100361479 3300031995 Bacteria 1373
241 Ga0307409_102766384 3300031995 Bacteria 518
242 Ga0307409_102769103 3300031995 Bacteria 518
243 Ga0307416_101154192 3300032002 Bacteria 880
244 Ga0307416_101258790 3300032002 Unclassified 846
245 Ga0307416_101813189 3300032002 Bacteria 714
246 Ga0307416_102941770 3300032002 Unclassified 570
247 Ga0307414_10462848 3300032004 Unclassified 1115
248 Ga0307411_10468871 3300032005 Bacteria 1058
249 Ga0307411_11288081 3300032005 Unclassified 665
250 Ga0307411_11597176 3300032005 Bacteria 602
251 Ga0307411_11779076 3300032005 Unclassified 572
252 Ga0307415_100814054 3300032126 Bacteria 854
253 Ga0373934_0386465 3300035086 Unclassified 584
254 Ga0373947_0311608 3300035725 Bacteria 1051
255 Ga0373937_0009430 3300036401 Bacteria 8486
256 Ga0373937_0020135 3300036401 Bacteria 5978
257 Ga0373937_1335721 3300036401 Unclassified 665
258 Ga0395899_0971383 3300037312 Bacteria 514
259 Ga0395900_0499730 3300037418 Bacteria 1167
260 Ga0395900_0775154 3300037418 Bacteria 888
261 Ga0395898_0245452 3300037466 Unclassified 1708
262 Ga0395905_0198715 3300037471 Bacteria 1880
263 Ga0395905_0268754 3300037471 Unclassified 1591
264 Ga0395905_1771404 3300037471 Unclassified 523
265 Ga0451791_1819687 3300041451 Bacteria 615
266 Ga0451807_2173480 3300041486 Bacteria 618
267 Ga0451847_0139508 3300041503 Unclassified 514
268 Ga0439448_0221182 3300042005 Archaea 666
269 Ga0451577_0471913 3300042876 Unclassified 1139
270 Ga0466972_0143861 3300044658 Unclassified 1122
271 Ga0453684_2021619 3300044712 Unclassified 580
272 Ga0466970_0608184 3300044765 Archaea 634
273 Ga0495582_0218731 3300046473 Bacteria 1090
274 Ga0495608_0177138 3300046511 Unclassified 1350
275 Ga0495618_0093559 3300046514 Bacteria 1922
276 Ga0495652_0104314 3300046529 Bacteria 2293
277 Ga0495645_0028773 3300046543 Bacteria 4038
278 Ga0495634_0867948 3300046642 Unclassified 512
279 Ga0495635_0447170 3300046663 Bacteria 855
280 Ga0495657_0321592 3300046675 Bacteria 919
281 Ga0495613_0007409 3300046689 Bacteria 8178
282 Ga0495613_0453852 3300046689 Unclassified 868
283 Ga0495600_0338997 3300046809 Bacteria 943
284 Ga0495636_0128873 3300047318 Unclassified 1124
285 Ga0495674_0967489 3300047319 Unclassified 654
286 Ga0495674_1011020 3300047319 Bacteria 637
287 Ga0495675_0103726 3300047444 Bacteria 1778
288 Ga0495684_0008528 3300047471 Bacteria 7936
289 Ga0495684_0041451 3300047471 Bacteria 3529
290 Ga0495686_0640856 3300047472 Unclassified 547
291 Ga0501034_0009081 3300049571 Bacteria 10441
292 Ga0501037_0014930 3300049573 Bacteria 5713
293 Ga0501043_1101052 3300049579 Unclassified 561
294 Ga0501047_0125307 3300049581 Unclassified 2449
295 Ga0501070_0075106 3300049586 Bacteria 2798
296 Ga0501242_033263 3300049674 Bacteria 706
297 Ga0501080_0010912 3300049742 Bacteria 8312
298 Ga0501035_0178496 3300049822 Unclassified 1831
299 Ga0501044_0001369 3300049823 Bacteria 28597
300 Ga0501044_1459117 3300049823 Unclassified 549
301 nmdc:mga0qj67_110385_c1 3300050509 Bacteria 2220
302 nmdc:mga0qj67_61540_c1 3300050509 Bacteria 2981
303 nmdc:mga06r32_192190_c2 3300050510 Bacteria 1695
304 nmdc:mga08y16_352926_c1 3300050511 Bacteria 1510
305 Ga0495601_0049419 3300053077 Bacteria 2652
306 Ga0207679_10095590
307 JGI25406J46586_10048511
308 Ga0070658_10165247
309 Ga0070676_10116069
310 Ga0070676_10768360
311 Ga0070683_100516302
312 Ga0070683_102234459
313 Ga0070670_100588554
314 Ga0070670_101020165
315 Ga0070670_101368458
316 Ga0070666_10085860
317 Ga0070666_10416549
318 Ga0068868_100871894
319 Ga0068868_101496504
320 Ga0068868_102309349
321 Ga0070660_100703921
322 Ga0070692_10544472
323 Ga0070668_100182471
324 Ga0070669_100105359
325 Ga0070669_100728513
326 Ga0070669_101791626
327 Ga0070675_100089085
328 Ga0070675_100169561
329 Ga0070675_100597115
330 Ga0070675_101606696
331 Ga0070671_100145176
332 Ga0070671_100174016
333 Ga0070674_100096805
334 Ga0070673_100174560
335 Ga0070673_100668316
336 Ga0070714_100033186
337 Ga0070714_100092467
338 Ga0070714_101967799
339 Ga0070713_100260637
340 Ga0070700_101730461
341 Ga0070678_100810437
342 Ga0070678_101148406
343 Ga0070681_10144080
344 Ga0068867_100129001
345 Ga0070679_101072466
346 Ga0070684_100489269
347 Ga0070684_101601694
348 Ga0068853_101986456
349 Ga0070672_100049835
350 Ga0070672_101165875
351 Ga0070665_100001964
352 Ga0070665_100155885
353 Ga0070665_100233640
354 Ga0070665_102440635
355 Ga0068855_100323887
356 Ga0068855_102475704
357 Ga0070664_100505894
358 Ga0070664_101108023
359 Ga0070664_101199926
360 Ga0068854_100240721
361 Ga0068854_102065508
362 Ga0068856_100654601
363 Ga0070702_101701626
364 Ga0068852_100636685
365 Ga0068864_100323298
366 Ga0068864_100928767
367 Ga0068864_101354213
368 Ga0068866_10136901
369 Ga0068863_100109388
370 Ga0068863_100482864
371 Ga0068858_101249445
372 Ga0068860_100260285
373 Ga0068860_101164240
374 Ga0081539_10029015
375 Ga0070717_10210707
376 Ga0070717_10842376
377 Ga0097621_101408446
378 Ga0097621_101763202
379 Ga0068871_100343332
380 Ga0068871_102228221
381 Ga0075428_101445097
382 Ga0075430_100204706
383 Ga0075430_100771204
384 Ga0075431_100173848
385 Ga0075431_100290165
386 Ga0075429_100033843
387 Ga0105240_10653155
388 Ga0105245_10079180
389 Ga0105245_10149445
390 Ga0105245_10271345
391 Ga0105245_10431887
392 Ga0105247_11244833
393 Ga0105241_10209526
394 Ga0105241_11507272
395 Ga0105242_12927889
396 Ga0105248_10194129
397 Ga0105248_13391458
398 Ga0105237_11931789
399 Ga0105237_12171156
400 Ga0105238_10210327
401 Ga0105238_11449332
402 Ga0105238_11538362
403 Ga0105238_11769029
404 Ga0105249_11071521
405 Ga0105249_11819517
406 Ga0105239_10300917
407 Ga0105239_12052978
408 Ga0157373_10078447
409 Ga0157373_10133332
410 Ga0157373_10257600
411 Ga0157371_10088197
412 Ga0157371_10249715
413 Ga0157371_10681846
414 Ga0157370_10049786
415 Ga0157370_10072813
416 Ga0157369_10137454
417 Ga0157369_10405625
418 Ga0157369_10845305
419 Ga0157369_10924386
420 Ga0157369_10950298
421 Ga0157369_11314232
422 Ga0157369_11390912
423 Ga0157374_10732837
424 Ga0157374_11362928
425 Ga0157374_11520402
426 Ga0157374_11833882
427 Ga0157378_10393151
428 Ga0157378_10743511
429 Ga0157378_11069663
430 Ga0163162_12314824
431 Ga0163162_12660806
432 Ga0157372_10077821
433 Ga0157372_10090582
434 Ga0157372_10277666
435 Ga0157372_10571842
436 Ga0157372_10692691
437 Ga0157372_11227300
438 Ga0157372_11272101
439 Ga0157372_12325984
440 Ga0157372_12767231
441 Ga0157372_12784467
442 Ga0157375_10389569
443 Ga0157375_11174139
444 Ga0157375_12767340
445 Ga0157375_12855652
446 Ga0157375_13008327
447 Ga0163163_11687543
448 Ga0163163_11688336
449 Ga0163163_12382443
450 Ga0157380_10175859
451 Ga0157380_10419914
452 Ga0182008_10196462
453 Ga0182008_10273700
454 Ga0157379_10230832
455 Ga0157376_11442387
456 Ga0157376_11523713
457 Ga0197907_11176922
458 Ga0206353_10696880
459 Ga0207656_10431299
460 Ga0207680_10169762
461 Ga0207680_10488143
462 Ga0207680_10796447
463 Ga0207645_10049608
464 Ga0207645_10741871
465 Ga0207705_10501465
466 Ga0207705_11323262
467 Ga0207684_10406687
468 Ga0207654_10428021
469 Ga0207707_10288652
470 Ga0207695_10253336
471 Ga0207662_11346628
472 Ga0207657_11184047
473 Ga0207649_10366519
474 Ga0207681_10100288
475 Ga0207681_11157335
476 Ga0207694_10957364
477 Ga0207650_10840620
478 Ga0207659_10015035
479 Ga0207659_10200839
480 Ga0207659_10216686
481 Ga0207659_10542574
482 Ga0207687_10029250
483 Ga0207687_10066373
484 Ga0207687_10428141
485 Ga0207700_11252052
486 Ga0207664_10033054
487 Ga0207644_10110679
488 Ga0207644_10695684
489 Ga0207690_11484181
490 Ga0207706_10190822
491 Ga0207706_10637391
492 Ga0207686_10715063
493 Ga0207669_10248291
494 Ga0207691_10070773
495 Ga0207691_10584475
496 Ga0207691_10663797
497 Ga0207691_11456522
498 Ga0207711_11524986
499 Ga0207661_10064901
500 Ga0207661_10268898
501 Ga0207661_10571103
502 Ga0207679_10106182
503 Ga0207679_10422428
504 Ga0207667_10199048
505 Ga0207651_10052747
506 Ga0207651_10197976
507 Ga0207651_10271500
508 Ga0207712_11572263
509 Ga0207668_10339814
510 Ga0207668_11578197
511 Ga0207640_11424587
512 Ga0207658_10594534
513 Ga0207658_11698671
514 Ga0207677_10109498
515 Ga0207703_10993442
516 Ga0207639_11218427
517 Ga0207702_11632566
518 Ga0207641_10431194
519 Ga0207641_10460954
520 Ga0207648_10652704
521 Ga0207648_11189448
522 Ga0207676_10945809
523 Ga0207674_10595728
524 Ga0207683_10144378
525 Ga0207683_11427387
526 Ga0207683_11428747
527 Ga0207698_10108456
528 Ga0207698_12076993
529 Ga0268266_10043281
530 Ga0268266_10125006
531 Ga0268266_10770941
532 Ga0268265_10299201
533 Ga0268264_10287832
534 Ga0307413_10648401
535 Ga0307410_10046155
536 Ga0307410_10713791
537 Ga0307410_11347700
538 Ga0307410_11606316
539 Ga0307406_10458788
540 Ga0307406_11592351
541 Ga0307407_10365997
542 Ga0307412_10934816
543 Ga0307412_12157426
544 Ga0307409_100126806
545 Ga0307409_100361479
546 Ga0307409_102766384
547 Ga0307409_102769103
548 Ga0307416_101154192
549 Ga0307416_101258790
550 Ga0307416_101813189
551 Ga0307416_102941770
552 Ga0307414_10462848
553 Ga0307411_10468871
554 Ga0307411_11288081
555 Ga0307411_11597176
556 Ga0307411_11779076
557 Ga0307415_100814054
558 Ga0373934_0386465
559 Ga0373947_0311608
560 Ga0373937_0009430
561 Ga0373937_0020135
562 Ga0373937_1335721
563 Ga0395899_0971383
564 Ga0395900_0499730
565 Ga0395900_0775154
566 Ga0395898_0245452
567 Ga0395905_0198715
568 Ga0395905_0268754
569 Ga0395905_1771404
570 Ga0451791_1819687
571 Ga0451807_2173480
572 Ga0451847_0139508
573 Ga0439448_0221182
574 Ga0451577_0471913
575 Ga0466972_0143861
576 Ga0453684_2021619
577 Ga0466970_0608184
578 Ga0495582_0218731
579 Ga0495608_0177138
580 Ga0495618_0093559
581 Ga0495652_0104314
582 Ga0495645_0028773
583 Ga0495634_0867948
584 Ga0495635_0447170
585 Ga0495657_0321592
586 Ga0495613_0007409
587 Ga0495613_0453852
588 Ga0495600_0338997
589 Ga0495636_0128873
590 Ga0495674_0967489
591 Ga0495674_1011020
592 Ga0495675_0103726
593 Ga0495684_0008528
594 Ga0495684_0041451
595 Ga0495686_0640856
596 Ga0501034_0009081
597 Ga0501037_0014930
598 Ga0501043_1101052
599 Ga0501047_0125307
600 Ga0501070_0075106
601 Ga0501242_033263
602 Ga0501080_0010912
603 Ga0501035_0178496
604 Ga0501044_0001369
605 Ga0501044_1459117
606 nmdc:mga0qj67_110385_c1
607 nmdc:mga0qj67_61540_c1
608 nmdc:mga06r32_192190_c2
609 nmdc:mga08y16_352926_c1
610 Ga0495601_0049419

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02049

FliE

Flagellar hook-basal body complex protein FliE

28

112

0.94

PF02685

Glucokinase

Glucokinase

6

101

0.81

Map