F398096

General Info

Members Datasets Scaffolds Average Seq Length
305 154 606 352

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10162366|Ga0114129_101623662
Length 382
Sequence VRGLCERQPWSRYDAARDVVHPEQSVEGGFAMKKWSIAIVVLFVMAMEVGLATAQKPSDKPIVRLDPALDALVSPDAKLELVKGGFGFTEGALWVHKGKSGYLLFSDMPANVIYKWTPDGKTSVYLDHSGYTGQDIWRVGFMQTNGKDRSDPLFEEFPMIGSNGLALDRQDRLIIATWAGRSIDRIEKNGKRTVLADRYEGKRFGGTNDVVVKKDGSIYFTDGFGGLRLREKDPRKELDHGGVYMLRDGKVSLVISDIPNTNGLAFSPDEKYLYANGSRDKFVKRYEVQPNGTLTNSMMFIDISKDPTPGITDGLRVDSKGNLYETAAGGVWIISPEGKHLGTIPTPELAANVEFGDADRKTLYIAARTSIYKIRVNTAGIR

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
50 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
71 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
72 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
73 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
74 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
75 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
76 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
77 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
78 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
79 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
150 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
153 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
154 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 4.92
Rhizosphere 92.79
Stem 0
Stem Tuber 0
Unclassified 15.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10162366 3300009147 Bacteria 3051
2 JGI25151J46595_10001021 3300003187 Bacteria 21020
3 Ga0065707_10017752 3300005295 Bacteria 1752
4 Ga0070680_100114937 3300005336 Bacteria 2242
5 Ga0070691_10118958 3300005341 Bacteria 1328
6 Ga0070671_100011053 3300005355 Bacteria 7247
7 Ga0070673_100111358 3300005364 Unclassified 2271
8 Ga0070709_10066177 3300005434 Bacteria 2317
9 Ga0070709_10067104 3300005434 Bacteria 2303
10 Ga0070713_100052430 3300005436 Bacteria 3377
11 Ga0070694_100016889 3300005444 Unclassified 4602
12 Ga0070681_10026741 3300005458 Bacteria 5801
13 Ga0070681_10066673 3300005458 Bacteria 3568
14 Ga0070681_10134420 3300005458 Bacteria 2404
15 Ga0070707_100373289 3300005468 Archaea 1386
16 Ga0070698_100101753 3300005471 Bacteria 2844
17 Ga0070679_100162890 3300005530 Bacteria 2204
18 Ga0070697_100095275 3300005536 Bacteria 2468
19 Ga0068853_100453503 3300005539 Unclassified 1206
20 Ga0070665_100008541 3300005548 Bacteria 10364
21 Ga0068855_100152601 3300005563 Bacteria 2626
22 Ga0068859_100160424 3300005617 Unclassified 2328
23 Ga0068861_100152043 3300005719 Bacteria 1900
24 Ga0068863_100033821 3300005841 Bacteria 4870
25 Ga0068858_100152156 3300005842 Unclassified 2176
26 Ga0068860_100210735 3300005843 Bacteria 1885
27 Ga0068862_100101074 3300005844 Bacteria 2522
28 Ga0081455_10012035 3300005937 Bacteria 8656
29 Ga0081455_10052804 3300005937 Bacteria 3476
30 Ga0081540_1014025 3300005983 Bacteria 5168
31 Ga0070717_10077158 3300006028 Bacteria 2789
32 Ga0070716_100025508 3300006173 Unclassified 3155
33 Ga0070712_100142705 3300006175 Unclassified 1830
34 Ga0068871_100026672 3300006358 Bacteria 4511
35 Ga0068871_100116901 3300006358 Bacteria 2249
36 Ga0068871_100270655 3300006358 Unclassified 1484
37 Ga0075433_10000823 3300006852 Bacteria 21653
38 Ga0075433_10009249 3300006852 Bacteria 7875
39 Ga0075433_10026968 3300006852 Bacteria 4869
40 Ga0075433_10118590 3300006852 Bacteria 2349
41 Ga0075433_10184164 3300006852 Unclassified 1858
42 Ga0075433_10191911 3300006852 Bacteria 1817
43 Ga0075433_10230725 3300006852 Unclassified 1644
44 Ga0075433_10339514 3300006852 Bacteria 1328
45 Ga0075434_100012310 3300006871 Bacteria 8104
46 Ga0075434_100015097 3300006871 Bacteria 7398
47 Ga0075434_100023502 3300006871 Bacteria 6009
48 Ga0075434_100032433 3300006871 Bacteria 5151
49 Ga0075434_100129006 3300006871 Bacteria 2547
50 Ga0075434_100371540 3300006871 Bacteria 1451
51 Ga0075436_100005862 3300006914 Bacteria 8443
52 Ga0075436_100020194 3300006914 Bacteria 4572
53 Ga0075436_100032039 3300006914 Bacteria 3622
54 Ga0075436_100053072 3300006914 Bacteria 2798
55 Ga0097620_100160416 3300006931 Unclassified 2328
56 Ga0075435_100006882 3300007076 Bacteria 8070
57 Ga0075435_100016612 3300007076 Bacteria 5551
58 Ga0075435_100017148 3300007076 Bacteria 5475
59 Ga0075435_100029122 3300007076 Bacteria 4333
60 Ga0075435_100095179 3300007076 Bacteria 2463
61 Ga0099794_10019351 3300007265 Bacteria 3066
62 Ga0099794_10031157 3300007265 Bacteria 2495
63 Ga0099794_10099730 3300007265 Bacteria 1449
64 Ga0099795_10003505 3300007788 Bacteria 3894
65 Ga0105240_10008052 3300009093 Bacteria 15167
66 Ga0105240_10185154 3300009093 Bacteria 2453
67 Ga0111539_10127072 3300009094 Bacteria 2986
68 Ga0111539_10157184 3300009094 Bacteria 2660
69 Ga0105245_10044675 3300009098 Bacteria 3955
70 Ga0114129_10164734 3300009147 Bacteria 3026
71 Ga0114129_10188231 3300009147 Bacteria 2804
72 Ga0114129_10197129 3300009147 Bacteria 2730
73 Ga0114129_10245756 3300009147 Bacteria 2404
74 Ga0114129_10328549 3300009147 Bacteria 2031
75 Ga0105241_10244737 3300009174 Unclassified 1518
76 Ga0105242_10014408 3300009176 Bacteria 6127
77 Ga0105248_10089289 3300009177 Bacteria 3469
78 Ga0099796_10065870 3300010159 Unclassified 1296
79 Ga0157374_10063120 3300013296 Bacteria 3474
80 Ga0157378_10001122 3300013297 Bacteria 24418
81 Ga0157378_10001400 3300013297 Bacteria 21699
82 Ga0157380_10105328 3300014326 Bacteria 2357
83 Ga0157376_10126624 3300014969 Bacteria 2273
84 Ga0228598_1005588 3300024227 Unclassified 2623
85 Ga0209025_1000038 3300025294 Bacteria 380508
86 Ga0207699_10086776 3300025906 Bacteria 1955
87 Ga0207699_10115888 3300025906 Bacteria 1725
88 Ga0207699_10131495 3300025906 Bacteria 1633
89 Ga0207707_10014485 3300025912 Bacteria 6868
90 Ga0207707_10052021 3300025912 Bacteria 3567
91 Ga0207707_10224748 3300025912 Bacteria 1634
92 Ga0207707_10409794 3300025912 Bacteria 1163
93 Ga0207695_10019139 3300025913 Bacteria 7891
94 Ga0207660_10296983 3300025917 Bacteria 1286
95 Ga0207652_10297059 3300025921 Bacteria 1458
96 Ga0207700_10054921 3300025928 Bacteria 2992
97 Ga0207686_10039989 3300025934 Bacteria 2848
98 Ga0207670_10074426 3300025936 Bacteria 2358
99 Ga0207665_10043664 3300025939 Unclassified 2997
100 Ga0207651_10085013 3300025960 Unclassified 2294
101 Ga0207651_10111523 3300025960 Unclassified 2054
102 Ga0207651_10263587 3300025960 Bacteria 1416
103 Ga0207712_10320558 3300025961 Bacteria 1278
104 Ga0207675_100203985 3300026118 Bacteria 1900
105 Ga0207683_10050680 3300026121 Bacteria 3637
106 Ga0209179_1028540 3300027512 Bacteria 1131
107 Ga0209588_1023283 3300027671 Bacteria 1951
108 Ga0207428_10091091 3300027907 Unclassified 2367
109 Ga0207428_10110572 3300027907 Unclassified 2116
110 Ga0268266_10014502 3300028379 Bacteria 6774
111 Ga0265327_10028255 3300031251 Bacteria 3213
112 Ga0373923_0015033 3300035111 Bacteria 2916
113 Ga0373923_0033480 3300035111 Bacteria 2081
114 Ga0373936_0021854 3300035113 Bacteria 2489
115 Ga0373941_0054258 3300035115 Bacteria 1284
116 Ga0373945_0005521 3300035116 Bacteria 4050
117 Ga0373945_0075423 3300035116 Unclassified 1284
118 Ga0373953_0016134 3300035117 Bacteria 2722
119 Ga0373954_0002020 3300035118 Bacteria 8429
120 Ga0373956_0193072 3300035119 Bacteria 964
121 Ga0373957_0002442 3300035120 Bacteria 5304
122 Ga0373955_0000403 3300035172 Bacteria 18347
123 Ga0373955_0087955 3300035172 Unclassified 1766
124 Ga0373962_0037410 3300035242 Bacteria 1355
125 Ga0373924_0034762 3300035410 Bacteria 2042
126 Ga0373931_0154213 3300035691 Bacteria 1341
127 Ga0373935_0000352 3300035692 Bacteria 23400
128 Ga0373935_0048022 3300035692 Bacteria 2701
129 Ga0373935_0068051 3300035692 Unclassified 2291
130 Ga0373935_0198447 3300035692 Bacteria 1385
131 Ga0373927_0022656 3300035695 Bacteria 4113
132 Ga0373927_0176732 3300035695 Viruses 1400
133 Ga0373927_0276348 3300035695 Unclassified 1105
134 Ga0373933_0004495 3300035724 Bacteria 7650
135 Ga0373947_0002161 3300035725 Bacteria 11951
136 Ga0373947_0071037 3300035725 Bacteria 2134
137 Ga0373947_0103169 3300035725 Bacteria 1795
138 Ga0373937_0000068 3300036401 Bacteria 94138
139 Ga0373937_0048590 3300036401 Bacteria 3884
140 Ga0373937_0472490 3300036401 Unclassified 1191
141 Ga0373925_0000295 3300037068 Bacteria 52150
142 Ga0373925_0038958 3300037068 Unclassified 3516
143 Ga0373925_0041540 3300037068 Bacteria 3409
144 Ga0436364_0801400 3300037853 Bacteria 1970
145 Ga0436365_0102360 3300039437 Bacteria 3432
146 Ga0436362_0448402 3300039453 Bacteria 1044
147 Ga0451576_0011916 3300045051 Bacteria 9833
148 Ga0451576_0222414 3300045051 Unclassified 1971
149 Ga0451576_0418102 3300045051 Bacteria 1406
150 Ga0495592_0000793 3300046454 Bacteria 21835
151 Ga0495592_0017756 3300046454 Bacteria 5407
152 Ga0495629_0009751 3300046459 Bacteria 7008
153 Ga0495638_0002299 3300046460 Bacteria 15768
154 Ga0495651_0000533 3300046462 Bacteria 29377
155 Ga0495651_0001226 3300046462 Bacteria 19830
156 Ga0495651_0011348 3300046462 Bacteria 6846
157 Ga0495651_0057260 3300046462 Bacteria 2992
158 Ga0495653_0000947 3300046463 Bacteria 22293
159 Ga0495653_0001464 3300046463 Bacteria 18435
160 Ga0495653_0043071 3300046463 Bacteria 3512
161 Ga0495580_0006795 3300046472 Bacteria 9274
162 Ga0495580_0084002 3300046472 Bacteria 2218
163 Ga0495582_0015917 3300046473 Bacteria 4123
164 Ga0495582_0042470 3300046473 Bacteria 2504
165 Ga0495664_0000060 3300046477 Bacteria 52213
166 Ga0495664_0035174 3300046477 Bacteria 2949
167 Ga0495584_0053399 3300046491 Unclassified 2034
168 Ga0495608_0000308 3300046511 Bacteria 34379
169 Ga0495608_0037444 3300046511 Unclassified 3262
170 Ga0495608_0041196 3300046511 Bacteria 3092
171 Ga0495618_0000792 3300046514 Bacteria 22077
172 Ga0495618_0069003 3300046514 Bacteria 2247
173 Ga0495628_0000005 3300046516 Bacteria 420969
174 Ga0495628_0013713 3300046516 Bacteria 6811
175 Ga0495628_0065654 3300046516 Bacteria 2837
176 Ga0495628_0122902 3300046516 Bacteria 1990
177 Ga0495630_0002182 3300046517 Bacteria 13641
178 Ga0495630_0024072 3300046517 Bacteria 4503
179 Ga0495630_0047674 3300046517 Unclassified 3205
180 Ga0495630_0141879 3300046517 Bacteria 1827
181 Ga0495666_0054749 3300046526 Bacteria 1913
182 Ga0495652_0000897 3300046529 Bacteria 34143
183 Ga0495652_0013822 3300046529 Bacteria 7263
184 Ga0495652_0083535 3300046529 Bacteria 2628
185 Ga0495665_0039436 3300046531 Bacteria 2516
186 Ga0495665_0138212 3300046531 Unclassified 1274
187 Ga0495640_0000027 3300046533 Bacteria 90638
188 Ga0495587_0000230 3300046536 Bacteria 41395
189 Ga0495587_0001513 3300046536 Bacteria 15459
190 Ga0495645_0000239 3300046543 Bacteria 40105
191 Ga0495645_0027810 3300046543 Bacteria 4109
192 Ga0495667_0000660 3300046559 Bacteria 22055
193 Ga0495667_0009845 3300046559 Bacteria 6475
194 Ga0495667_0009989 3300046559 Bacteria 6427
195 Ga0495667_0012195 3300046559 Bacteria 5822
196 Ga0495634_0000696 3300046642 Bacteria 32694
197 Ga0495625_0022178 3300046660 Bacteria 4872
198 Ga0495635_0000019 3300046663 Bacteria 193402
199 Ga0495635_0102024 3300046663 Bacteria 1961
200 Ga0495635_0167978 3300046663 Unclassified 1492
201 Ga0495659_0011535 3300046664 Unclassified 2847
202 Ga0495657_0002171 3300046675 Bacteria 16643
203 Ga0495657_0003430 3300046675 Bacteria 12933
204 Ga0495599_0000051 3300046678 Bacteria 81853
205 Ga0495599_0199932 3300046678 Unclassified 1228
206 Ga0495623_0003794 3300046679 Bacteria 9955
207 Ga0495623_0005437 3300046679 Bacteria 8321
208 Ga0495623_0097527 3300046679 Bacteria 1795
209 Ga0495646_0000711 3300046680 Bacteria 18442
210 Ga0495646_0156447 3300046680 Unclassified 1264
211 Ga0495658_0024991 3300046683 Bacteria 3189
212 Ga0495658_0027817 3300046683 Bacteria 3046
213 Ga0495613_0010194 3300046689 Bacteria 6980
214 Ga0495613_0016004 3300046689 Bacteria 5583
215 Ga0495613_0040207 3300046689 Bacteria 3466
216 Ga0495613_0113285 3300046689 Bacteria 1953
217 Ga0495613_0127374 3300046689 Unclassified 1825
218 Ga0495624_0023687 3300046690 Bacteria 4046
219 Ga0495624_0142584 3300046690 Bacteria 1467
220 Ga0495624_0161437 3300046690 Bacteria 1369
221 Ga0495670_0000006 3300046691 Bacteria 255322
222 Ga0495600_0001448 3300046809 Bacteria 13154
223 Ga0495600_0003246 3300046809 Bacteria 9518
224 Ga0495581_0039781 3300047315 Bacteria 2722
225 Ga0495604_0000507 3300047317 Bacteria 34224
226 Ga0495604_0003574 3300047317 Bacteria 12393
227 Ga0495604_0011077 3300047317 Bacteria 7157
228 Ga0495674_0000580 3300047319 Bacteria 34223
229 Ga0495674_0017043 3300047319 Bacteria 6770
230 Ga0495674_0027356 3300047319 Bacteria 5211
231 Ga0495674_0095802 3300047319 Unclassified 2530
232 Ga0495674_0147793 3300047319 Unclassified 1972
233 Ga0495674_0320811 3300047319 Bacteria 1262
234 Ga0495680_0000216 3300047322 Bacteria 62986
235 Ga0495680_0001171 3300047322 Bacteria 28858
236 Ga0495680_0010358 3300047322 Bacteria 8320
237 Ga0495675_0000652 3300047444 Bacteria 21999
238 Ga0495675_0003127 3300047444 Bacteria 9936
239 Ga0495675_0007399 3300047444 Bacteria 6762
240 Ga0495675_0009090 3300047444 Bacteria 6175
241 Ga0495675_0055309 3300047444 Unclassified 2517
242 Ga0495675_0111509 3300047444 Bacteria 1707
243 Ga0495684_0001079 3300047471 Bacteria 22061
244 Ga0495684_0002147 3300047471 Bacteria 15804
245 Ga0495684_0011541 3300047471 Bacteria 6825
246 Ga0495686_0007628 3300047472 Bacteria 8078
247 Ga0495593_0031480 3300047673 Bacteria 2897
248 Ga0495602_0001686 3300048088 Bacteria 22004
249 Ga0495602_0014089 3300048088 Bacteria 8132
250 Ga0495614_0020351 3300048089 Bacteria 2870
251 Ga0496100_0051235 3300048903 Bacteria 2679
252 Ga0496100_0105770 3300048903 Bacteria 1947
253 Ga0496100_0133565 3300048903 Bacteria 1751
254 Ga0496101_0135305 3300048904 Bacteria 1875
255 Ga0496101_0148406 3300048904 Unclassified 1792
256 Ga0496104_0038706 3300048907 Bacteria 4463
257 Ga0496104_0062761 3300048907 Bacteria 3524
258 Ga0496104_0192586 3300048907 Bacteria 1951
259 Ga0496105_0003572 3300048908 Bacteria 11537
260 Ga0496105_0119718 3300048908 Bacteria 2171
261 Ga0496105_0230858 3300048908 Bacteria 1504
262 Ga0496106_0189739 3300048909 Unclassified 1634
263 Ga0496109_0135258 3300048912 Bacteria 2303
264 Ga0496115_0036621 3300048918 Bacteria 3886
265 Ga0496115_0043071 3300048918 Bacteria 3599
266 Ga0496121_0001695 3300048924 Bacteria 36208
267 nmdc:mga05p37_184499_c1 3300050507 Bacteria 2537
268 nmdc:mga05p37_637459_c1 3300050507 Unclassified 1196
269 nmdc:mga05p37_95587_c1 3300050507 Bacteria 3661
270 nmdc:mga08y16_187048_c1 3300050511 Bacteria 2149
271 nmdc:mga08y16_70423_c1 3300050511 Bacteria 3646
272 nmdc:mga0n895_16682_c1 3300050512 Bacteria 6747
273 nmdc:mga0n895_23152_c1 3300050512 Bacteria 5834
274 nmdc:mga0n895_340164_c1 3300050512 Bacteria 1520
275 nmdc:mga0n895_351111_c1 3300050512 Bacteria 1494
276 nmdc:mga0n895_414942_c1 3300050512 Unclassified 1361
277 nmdc:mga0n895_55658_c1 3300050512 Unclassified 3893
278 nmdc:mga0n895_6962_c1 3300050512 Bacteria 9652
279 nmdc:mga0rr50_164284_c1 3300050513 Bacteria 1804
280 nmdc:mga0rr50_212846_c1 3300050513 Bacteria 1593
281 nmdc:mga0rr50_2559_c1 3300050513 Bacteria 10305
282 nmdc:mga0rr50_30600_c1 3300050513 Bacteria 3813
283 nmdc:mga0rr50_37752_c1 3300050513 Unclassified 3490
284 nmdc:mga0rr50_4118_c1 3300050513 Bacteria 8498
285 nmdc:mga08x19_33862_c1 3300050514 Bacteria 3226
286 nmdc:mga08x19_39308_c1 3300050514 Bacteria 3007
287 nmdc:mga0a205_1054_c1 3300050515 Bacteria 22949
288 nmdc:mga0a205_138273_c2 3300050515 Unclassified 1263
289 nmdc:mga0a205_147113_c1 3300050515 Bacteria 2256
290 nmdc:mga0a205_14762_c1 3300050515 Bacteria 2684
291 nmdc:mga0a205_216044_c1 3300050515 Bacteria 1804
292 nmdc:mga0a205_448152_c1 3300050515 Bacteria 1151
293 nmdc:mga0a205_4514_c1 3300050515 Bacteria 12491
294 nmdc:mga0a205_7011_c1 3300050515 Bacteria 10180
295 Ga0495601_0000146 3300053077 Bacteria 40193
296 Ga0495612_0000030 3300053078 Bacteria 81917
297 Ga0495612_0033611 3300053078 Unclassified 2075
298 Ga0495595_0000098 3300053084 Bacteria 39925
299 Ga0495619_0000238 3300053085 Bacteria 40071
300 Ga0495619_0159636 3300053085 Unclassified 1557
301 Ga0500619_000042 3300053154 Bacteria 39509
302 2904542286 2904541872 Bacteria 8915136
303 2929167570 2929160207 Bacteria 9075316
304 Ga0114129_10162366
305 JGI25151J46595_10001021
306 Ga0065707_10017752
307 Ga0070680_100114937
308 Ga0070691_10118958
309 Ga0070671_100011053
310 Ga0070673_100111358
311 Ga0070709_10066177
312 Ga0070709_10067104
313 Ga0070713_100052430
314 Ga0070694_100016889
315 Ga0070681_10026741
316 Ga0070681_10066673
317 Ga0070681_10134420
318 Ga0070707_100373289
319 Ga0070698_100101753
320 Ga0070679_100162890
321 Ga0070697_100095275
322 Ga0068853_100453503
323 Ga0070665_100008541
324 Ga0068855_100152601
325 Ga0068859_100160424
326 Ga0068861_100152043
327 Ga0068863_100033821
328 Ga0068858_100152156
329 Ga0068860_100210735
330 Ga0068862_100101074
331 Ga0081455_10012035
332 Ga0081455_10052804
333 Ga0081540_1014025
334 Ga0070717_10077158
335 Ga0070716_100025508
336 Ga0070712_100142705
337 Ga0068871_100026672
338 Ga0068871_100116901
339 Ga0068871_100270655
340 Ga0075433_10000823
341 Ga0075433_10009249
342 Ga0075433_10026968
343 Ga0075433_10118590
344 Ga0075433_10184164
345 Ga0075433_10191911
346 Ga0075433_10230725
347 Ga0075433_10339514
348 Ga0075434_100012310
349 Ga0075434_100015097
350 Ga0075434_100023502
351 Ga0075434_100032433
352 Ga0075434_100129006
353 Ga0075434_100371540
354 Ga0075436_100005862
355 Ga0075436_100020194
356 Ga0075436_100032039
357 Ga0075436_100053072
358 Ga0097620_100160416
359 Ga0075435_100006882
360 Ga0075435_100016612
361 Ga0075435_100017148
362 Ga0075435_100029122
363 Ga0075435_100095179
364 Ga0099794_10019351
365 Ga0099794_10031157
366 Ga0099794_10099730
367 Ga0099795_10003505
368 Ga0105240_10008052
369 Ga0105240_10185154
370 Ga0111539_10127072
371 Ga0111539_10157184
372 Ga0105245_10044675
373 Ga0114129_10164734
374 Ga0114129_10188231
375 Ga0114129_10197129
376 Ga0114129_10245756
377 Ga0114129_10328549
378 Ga0105241_10244737
379 Ga0105242_10014408
380 Ga0105248_10089289
381 Ga0099796_10065870
382 Ga0157374_10063120
383 Ga0157378_10001122
384 Ga0157378_10001400
385 Ga0157380_10105328
386 Ga0157376_10126624
387 Ga0228598_1005588
388 Ga0209025_1000038
389 Ga0207699_10086776
390 Ga0207699_10115888
391 Ga0207699_10131495
392 Ga0207707_10014485
393 Ga0207707_10052021
394 Ga0207707_10224748
395 Ga0207707_10409794
396 Ga0207695_10019139
397 Ga0207660_10296983
398 Ga0207652_10297059
399 Ga0207700_10054921
400 Ga0207686_10039989
401 Ga0207670_10074426
402 Ga0207665_10043664
403 Ga0207651_10085013
404 Ga0207651_10111523
405 Ga0207651_10263587
406 Ga0207712_10320558
407 Ga0207675_100203985
408 Ga0207683_10050680
409 Ga0209179_1028540
410 Ga0209588_1023283
411 Ga0207428_10091091
412 Ga0207428_10110572
413 Ga0268266_10014502
414 Ga0265327_10028255
415 Ga0373923_0015033
416 Ga0373923_0033480
417 Ga0373936_0021854
418 Ga0373941_0054258
419 Ga0373945_0005521
420 Ga0373945_0075423
421 Ga0373953_0016134
422 Ga0373954_0002020
423 Ga0373956_0193072
424 Ga0373957_0002442
425 Ga0373955_0000403
426 Ga0373955_0087955
427 Ga0373962_0037410
428 Ga0373924_0034762
429 Ga0373931_0154213
430 Ga0373935_0000352
431 Ga0373935_0048022
432 Ga0373935_0068051
433 Ga0373935_0198447
434 Ga0373927_0022656
435 Ga0373927_0176732
436 Ga0373927_0276348
437 Ga0373933_0004495
438 Ga0373947_0002161
439 Ga0373947_0071037
440 Ga0373947_0103169
441 Ga0373937_0000068
442 Ga0373937_0048590
443 Ga0373937_0472490
444 Ga0373925_0000295
445 Ga0373925_0038958
446 Ga0373925_0041540
447 Ga0436364_0801400
448 Ga0436365_0102360
449 Ga0436362_0448402
450 Ga0451576_0011916
451 Ga0451576_0222414
452 Ga0451576_0418102
453 Ga0495592_0000793
454 Ga0495592_0017756
455 Ga0495629_0009751
456 Ga0495638_0002299
457 Ga0495651_0000533
458 Ga0495651_0001226
459 Ga0495651_0011348
460 Ga0495651_0057260
461 Ga0495653_0000947
462 Ga0495653_0001464
463 Ga0495653_0043071
464 Ga0495580_0006795
465 Ga0495580_0084002
466 Ga0495582_0015917
467 Ga0495582_0042470
468 Ga0495664_0000060
469 Ga0495664_0035174
470 Ga0495584_0053399
471 Ga0495608_0000308
472 Ga0495608_0037444
473 Ga0495608_0041196
474 Ga0495618_0000792
475 Ga0495618_0069003
476 Ga0495628_0000005
477 Ga0495628_0013713
478 Ga0495628_0065654
479 Ga0495628_0122902
480 Ga0495630_0002182
481 Ga0495630_0024072
482 Ga0495630_0047674
483 Ga0495630_0141879
484 Ga0495666_0054749
485 Ga0495652_0000897
486 Ga0495652_0013822
487 Ga0495652_0083535
488 Ga0495665_0039436
489 Ga0495665_0138212
490 Ga0495640_0000027
491 Ga0495587_0000230
492 Ga0495587_0001513
493 Ga0495645_0000239
494 Ga0495645_0027810
495 Ga0495667_0000660
496 Ga0495667_0009845
497 Ga0495667_0009989
498 Ga0495667_0012195
499 Ga0495634_0000696
500 Ga0495625_0022178
501 Ga0495635_0000019
502 Ga0495635_0102024
503 Ga0495635_0167978
504 Ga0495659_0011535
505 Ga0495657_0002171
506 Ga0495657_0003430
507 Ga0495599_0000051
508 Ga0495599_0199932
509 Ga0495623_0003794
510 Ga0495623_0005437
511 Ga0495623_0097527
512 Ga0495646_0000711
513 Ga0495646_0156447
514 Ga0495658_0024991
515 Ga0495658_0027817
516 Ga0495613_0010194
517 Ga0495613_0016004
518 Ga0495613_0040207
519 Ga0495613_0113285
520 Ga0495613_0127374
521 Ga0495624_0023687
522 Ga0495624_0142584
523 Ga0495624_0161437
524 Ga0495670_0000006
525 Ga0495600_0001448
526 Ga0495600_0003246
527 Ga0495581_0039781
528 Ga0495604_0000507
529 Ga0495604_0003574
530 Ga0495604_0011077
531 Ga0495674_0000580
532 Ga0495674_0017043
533 Ga0495674_0027356
534 Ga0495674_0095802
535 Ga0495674_0147793
536 Ga0495674_0320811
537 Ga0495680_0000216
538 Ga0495680_0001171
539 Ga0495680_0010358
540 Ga0495675_0000652
541 Ga0495675_0003127
542 Ga0495675_0007399
543 Ga0495675_0009090
544 Ga0495675_0055309
545 Ga0495675_0111509
546 Ga0495684_0001079
547 Ga0495684_0002147
548 Ga0495684_0011541
549 Ga0495686_0007628
550 Ga0495593_0031480
551 Ga0495602_0001686
552 Ga0495602_0014089
553 Ga0495614_0020351
554 Ga0496100_0051235
555 Ga0496100_0105770
556 Ga0496100_0133565
557 Ga0496101_0135305
558 Ga0496101_0148406
559 Ga0496104_0038706
560 Ga0496104_0062761
561 Ga0496104_0192586
562 Ga0496105_0003572
563 Ga0496105_0119718
564 Ga0496105_0230858
565 Ga0496106_0189739
566 Ga0496109_0135258
567 Ga0496115_0036621
568 Ga0496115_0043071
569 Ga0496121_0001695
570 nmdc:mga05p37_184499_c1
571 nmdc:mga05p37_637459_c1
572 nmdc:mga05p37_95587_c1
573 nmdc:mga08y16_187048_c1
574 nmdc:mga08y16_70423_c1
575 nmdc:mga0n895_16682_c1
576 nmdc:mga0n895_23152_c1
577 nmdc:mga0n895_340164_c1
578 nmdc:mga0n895_351111_c1
579 nmdc:mga0n895_414942_c1
580 nmdc:mga0n895_55658_c1
581 nmdc:mga0n895_6962_c1
582 nmdc:mga0rr50_164284_c1
583 nmdc:mga0rr50_212846_c1
584 nmdc:mga0rr50_2559_c1
585 nmdc:mga0rr50_30600_c1
586 nmdc:mga0rr50_37752_c1
587 nmdc:mga0rr50_4118_c1
588 nmdc:mga08x19_33862_c1
589 nmdc:mga08x19_39308_c1
590 nmdc:mga0a205_1054_c1
591 nmdc:mga0a205_138273_c2
592 nmdc:mga0a205_147113_c1
593 nmdc:mga0a205_14762_c1
594 nmdc:mga0a205_216044_c1
595 nmdc:mga0a205_448152_c1
596 nmdc:mga0a205_4514_c1
597 nmdc:mga0a205_7011_c1
598 Ga0495601_0000146
599 Ga0495612_0000030
600 Ga0495612_0033611
601 Ga0495595_0000098
602 Ga0495619_0000238
603 Ga0495619_0159636
604 Ga0500619_000042
605 2904542286
606 2929167570

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

88

369

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.8471 31 342
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.8421 31 342
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.8318 22 336
3dr2-assembly1.cif.gz_A structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.8284 22 336
5chb-assembly1.cif.gz_C crystal structure of nvpizza2-s16h58 coordinating a cdcl2 nanocrystal 0.8209 132 224
ID Description Score Start End Superfamily
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8356 31 342 2.120.10.30
af_A0A1D6F614_54_166_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8329 59 192 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8304 31 342 2.120.10.30
af_D3ZQG6_660_743_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8293 131 192 2.40.10.500
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8284 22 336 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A534SBQ5-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9759 84 342 GO:0016787
AF-A0A534MYH2-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.97 32 342 GO:0016787
AF-A0A1Y5PQX5-F1-model_v4 Galactose mutarotase family enzyme 0.9673 32 341 GO:0016787
AF-A0A537C8G5-F1-model_v4 SMP-30/Gluconolactonase/LRE-like region domain-containing protein 0.9652 32 342 GO:0016787
AF-A0A536Z634-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9631 226 342 GO:0016787

Map