F398093

General Info

Members Datasets Scaffolds Average Seq Length
305 191 303 307

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10088738|Ga0105247_100887382
Length 344
Sequence MAKTLDSSPSILPLYARAALPMIPGASLLXXXXGGGGEIPDGLDLELAGVTAKPEDVAAYARVCGFALRDTLPPTYPHMLAFPLHMAVMSDGSFPFGAVGLVHVENSIVQKRPIGIHEEMTIRVRPTPLQPHPKGKTFSLETEVLVDGEVVWESVSTMLRRGKGDESAKPERGFESLPADAPASAEWKLGGDLGRRYAGVSGDRNPIHMHSLTAKPLGFPSAIAHGMWTKARALAQLGSKLPDAFEADVRFRKPVLLPARVEFASREQEGEILFAVRDAKKGTPHLDGRVQPLSSPKPQTKSKSDAARGLAKSKTAKTGMNFMRGPPPRSREWRSAAWATACGR

Samples

Sample ID Description Type Environment
1 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
2 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
106 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 12.79
Rhizosphere 80.98
Stem 0
Stem Tuber 0
Unclassified 5.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10000136 3300002239 Bacteria 10868
2 Ga0070682_100000117 3300005337 Bacteria 69662
3 Ga0070682_100161833 3300005337 Bacteria 1546
4 Ga0068868_100001577 3300005338 Bacteria 15543
5 Ga0068868_100461339 3300005338 Bacteria 1107
6 Ga0070661_100001375 3300005344 Bacteria 16996
7 Ga0070668_100001695 3300005347 Bacteria 15984
8 Ga0070668_100012580 3300005347 Bacteria 6302
9 Ga0070675_100000111 3300005354 Bacteria 47699
10 Ga0070675_100377164 3300005354 Bacteria 1262
11 Ga0070673_100001567 3300005364 Bacteria 13472
12 Ga0070688_100003353 3300005365 Bacteria 8214
13 Ga0070688_100017896 3300005365 Bacteria 4076
14 Ga0070659_100159262 3300005366 Bacteria 1845
15 Ga0070667_100005090 3300005367 Bacteria 11004
16 Ga0070667_100079255 3300005367 Bacteria 2808
17 Ga0070667_100135909 3300005367 Bacteria 2150
18 Ga0070714_100071280 3300005435 Bacteria 3004
19 Ga0070714_100393318 3300005435 Bacteria 1309
20 Ga0070713_100000390 3300005436 Bacteria 28149
21 Ga0070711_100002341 3300005439 Bacteria 10769
22 Ga0070678_100348125 3300005456 Bacteria 1273
23 Ga0070678_100480837 3300005456 Bacteria 1093
24 Ga0070662_100000004 3300005457 Bacteria 195534
25 Ga0068867_100165898 3300005459 Bacteria 1745
26 Ga0070685_10004176 3300005466 Bacteria 7284
27 Ga0070685_10015192 3300005466 Bacteria 4088
28 Ga0070679_100009133 3300005530 Bacteria 9358
29 Ga0070684_100011369 3300005535 Bacteria 7089
30 Ga0070684_100060607 3300005535 Bacteria 3311
31 Ga0070672_100000015 3300005543 Bacteria 72591
32 Ga0070686_100059890 3300005544 Bacteria 2454
33 Ga0070693_100014133 3300005547 Bacteria 4083
34 Ga0070665_100050774 3300005548 Bacteria 4162
35 Ga0070665_100059195 3300005548 Bacteria 3840
36 Ga0070665_100118283 3300005548 Bacteria 2652
37 Ga0070664_100449600 3300005564 Bacteria 1183
38 Ga0068854_100000183 3300005578 Bacteria 42525
39 Ga0068854_100175322 3300005578 Bacteria 1671
40 Ga0068856_100000757 3300005614 Bacteria 35080
41 Ga0068852_100000093 3300005616 Bacteria 60834
42 Ga0068852_100133914 3300005616 Bacteria 2286
43 Ga0068861_100199652 3300005719 Bacteria 1678
44 Ga0068851_10017894 3300005834 Bacteria 3410
45 Ga0068870_10060843 3300005840 Bacteria 2028
46 Ga0068863_100006700 3300005841 Bacteria 11301
47 Ga0068860_100175443 3300005843 Bacteria 2071
48 Ga0068862_100001210 3300005844 Bacteria 24342
49 Ga0081455_10008758 3300005937 Bacteria 10475
50 Ga0081540_1000049 3300005983 Bacteria 127322
51 Ga0081539_10002609 3300005985 Bacteria 24708
52 Ga0070717_10000005 3300006028 Bacteria 357819
53 Ga0070712_100008485 3300006175 Bacteria 6466
54 Ga0068865_100001277 3300006881 Bacteria 14651
55 Ga0105240_10125841 3300009093 Bacteria 3080
56 Ga0105245_10001150 3300009098 Bacteria 23924
57 Ga0105245_10001831 3300009098 Bacteria 19354
58 Ga0105245_10024675 3300009098 Bacteria 5282
59 Ga0105247_10000242 3300009101 Bacteria 51204
60 Ga0105247_10088738 3300009101 Bacteria 1960
61 Ga0105247_10108527 3300009101 Bacteria 1783
62 Ga0105243_10107153 3300009148 Bacteria 2330
63 Ga0105242_10002871 3300009176 Bacteria 13495
64 Ga0105248_10000008 3300009177 Bacteria 403910
65 Ga0105237_10344367 3300009545 Bacteria 1495
66 Ga0105238_10000011 3300009551 Bacteria 261080
67 Ga0105238_10289854 3300009551 Bacteria 1619
68 Ga0105249_10000203 3300009553 Bacteria 67783
69 Ga0105249_10013176 3300009553 Bacteria 7295
70 Ga0105249_10156839 3300009553 Bacteria 2196
71 Ga0105246_10040043 3300011119 Bacteria 3160
72 Ga0157370_10128059 3300013104 Bacteria 2369
73 Ga0157369_10000110 3300013105 Bacteria 115514
74 Ga0157378_10024610 3300013297 Bacteria 5300
75 Ga0157378_10031281 3300013297 Bacteria 4701
76 Ga0157378_10042428 3300013297 Bacteria 4038
77 Ga0163162_10265894 3300013306 Bacteria 1847
78 Ga0157372_10001384 3300013307 Bacteria 26176
79 Ga0157375_10085412 3300013308 Bacteria 3206
80 Ga0163163_10255421 3300014325 Bacteria 1803
81 Ga0157380_10000253 3300014326 Bacteria 32008
82 Ga0157380_10000843 3300014326 Bacteria 19177
83 Ga0157380_10044551 3300014326 Bacteria 3478
84 Ga0157379_10015187 3300014968 Bacteria 6754
85 Ga0157379_10037861 3300014968 Bacteria 4302
86 Ga0157379_10133895 3300014968 Bacteria 2232
87 Ga0157376_10015687 3300014969 Bacteria 5730
88 Ga0157376_10079843 3300014969 Bacteria 2805
89 Ga0207656_10002156 3300025321 Bacteria 6575
90 Ga0207710_10000531 3300025900 Bacteria 23383
91 Ga0207710_10073683 3300025900 Bacteria 1570
92 Ga0207695_10098294 3300025913 Bacteria 2926
93 Ga0207671_10220143 3300025914 Bacteria 1487
94 Ga0207693_10006065 3300025915 Bacteria 10009
95 Ga0207663_10001197 3300025916 Bacteria 11982
96 Ga0207663_10202215 3300025916 Bacteria 1434
97 Ga0207649_10000009 3300025920 Bacteria 295544
98 Ga0207652_10023267 3300025921 Bacteria 5131
99 Ga0207694_10000004 3300025924 Bacteria 967075
100 Ga0207659_10000010 3300025926 Bacteria 286639
101 Ga0207687_10000007 3300025927 Bacteria 604185
102 Ga0207687_10000013 3300025927 Bacteria 299826
103 Ga0207687_10027923 3300025927 Bacteria 3789
104 Ga0207700_10000027 3300025928 Bacteria 137708
105 Ga0207664_10000529 3300025929 Bacteria 27133
106 Ga0207664_10368302 3300025929 Bacteria 1274
107 Ga0207690_10123708 3300025932 Bacteria 1883
108 Ga0207706_10000012 3300025933 Bacteria 195475
109 Ga0207686_10000468 3300025934 Bacteria 26729
110 Ga0207709_10007242 3300025935 Bacteria 6188
111 Ga0207704_10000093 3300025938 Bacteria 52224
112 Ga0207691_10000044 3300025940 Bacteria 100027
113 Ga0207711_10000006 3300025941 Bacteria 792692
114 Ga0207689_10082155 3300025942 Bacteria 2649
115 Ga0207689_10376461 3300025942 Bacteria 1182
116 Ga0207661_10002098 3300025944 Bacteria 13720
117 Ga0207679_10263672 3300025945 Bacteria 1471
118 Ga0207651_10274754 3300025960 Bacteria 1389
119 Ga0207712_10000007 3300025961 Bacteria 539589
120 Ga0207712_10011553 3300025961 Bacteria 5629
121 Ga0207712_10297123 3300025961 Bacteria 1324
122 Ga0207668_10002674 3300025972 Bacteria 10429
123 Ga0207640_10000200 3300025981 Bacteria 42738
124 Ga0207640_10033780 3300025981 Bacteria 3186
125 Ga0207658_10032850 3300025986 Bacteria 3697
126 Ga0207658_10065171 3300025986 Bacteria 2735
127 Ga0207677_10001542 3300026023 Bacteria 12184
128 Ga0207639_10196199 3300026041 Bacteria 1728
129 Ga0207678_10017704 3300026067 Bacteria 6257
130 Ga0207702_10000060 3300026078 Bacteria 125473
131 Ga0207702_10090900 3300026078 Bacteria 2672
132 Ga0207641_10000405 3300026088 Bacteria 50517
133 Ga0207648_10002260 3300026089 Bacteria 20839
134 Ga0207674_10129673 3300026116 Bacteria 2486
135 Ga0207675_100127284 3300026118 Bacteria 2413
136 Ga0207698_10000440 3300026142 Bacteria 23916
137 Ga0207698_10660695 3300026142 Bacteria 1036
138 Ga0268266_10000285 3300028379 Bacteria 83300
139 Ga0268266_10005034 3300028379 Bacteria 12475
140 Ga0268266_10043788 3300028379 Bacteria 3826
141 Ga0268266_10084487 3300028379 Bacteria 2772
142 Ga0268266_10116648 3300028379 Bacteria 2371
143 Ga0268265_10008345 3300028380 Bacteria 6994
144 Ga0268264_10017683 3300028381 Bacteria 5837
145 Ga0307415_100003742 3300032126 Bacteria 7793
146 Ga0395898_0206037 3300037466 Bacteria 1876
147 Ga0395901_0058354 3300038443 Bacteria 4014
148 Ga0395901_0177417 3300038443 Bacteria 2234
149 Ga0395901_0182160 3300038443 Bacteria 2203
150 Ga0451833_0468266 3300041491 Bacteria 2382
151 Ga0466972_0173599 3300044658 Bacteria 1011
152 Ga0466961_0250836 3300044693 Bacteria 1087
153 Ga0466963_0000001 3300044694 Bacteria 110556
154 Ga0466963_0090973 3300044694 Bacteria 2078
155 Ga0466963_0196193 3300044694 Bacteria 1411
156 Ga0466957_0021361 3300044842 Bacteria 3813
157 Ga0466960_0000093 3300044901 Bacteria 29301
158 Ga0466967_0000009 3300045976 Bacteria 122610
159 Ga0466967_0121411 3300045976 Bacteria 2415
160 Ga0466967_0435645 3300045976 Bacteria 1279
161 Ga0466967_0721935 3300045976 Bacteria 988
162 Ga0495592_0221219 3300046454 Bacteria 1266
163 Ga0495603_0000333 3300046455 Bacteria 25490
164 Ga0495629_0005201 3300046459 Bacteria 9743
165 Ga0495638_0037786 3300046460 Bacteria 3071
166 Ga0495641_0017016 3300046461 Bacteria 3805
167 Ga0495641_0073815 3300046461 Bacteria 1530
168 Ga0495662_0018203 3300046476 Bacteria 3399
169 Ga0495606_0000565 3300046507 Bacteria 58752
170 Ga0495608_0000068 3300046511 Bacteria 79694
171 Ga0495610_0023820 3300046512 Bacteria 3319
172 Ga0495618_0115330 3300046514 Bacteria 1720
173 Ga0495628_0000190 3300046516 Bacteria 53586
174 Ga0495628_0018184 3300046516 Bacteria 5829
175 Ga0495628_0032736 3300046516 Bacteria 4195
176 Ga0495628_0145089 3300046516 Bacteria 1810
177 Ga0495630_0000056 3300046517 Bacteria 91477
178 Ga0495630_0007275 3300046517 Bacteria 7900
179 Ga0495652_0000546 3300046529 Bacteria 44003
180 Ga0495640_0070585 3300046533 Bacteria 2346
181 Ga0495586_0114466 3300046535 Bacteria 1503
182 Ga0495586_0142853 3300046535 Bacteria 1344
183 Ga0495587_0003427 3300046536 Bacteria 10576
184 Ga0495656_0004834 3300046615 Bacteria 4635
185 Ga0495634_0007615 3300046642 Bacteria 8114
186 Ga0495625_0000587 3300046660 Bacteria 52838
187 Ga0495588_0000165 3300046674 Bacteria 85841
188 Ga0495657_0000004 3300046675 Bacteria 266465
189 Ga0495657_0003153 3300046675 Bacteria 13588
190 Ga0495657_0055610 3300046675 Bacteria 2639
191 Ga0495647_0000018 3300046681 Bacteria 81701
192 Ga0495647_0000904 3300046681 Bacteria 8893
193 Ga0495658_0015784 3300046683 Bacteria 3879
194 Ga0495669_0000033 3300046684 Bacteria 98629
195 Ga0495613_0000179 3300046689 Bacteria 62109
196 Ga0495624_0000073 3300046690 Bacteria 65582
197 Ga0495624_0039122 3300046690 Bacteria 3042
198 Ga0495600_0016433 3300046809 Bacteria 4696
199 Ga0495604_0000357 3300047317 Bacteria 40931
200 Ga0495604_0215283 3300047317 Bacteria 1325
201 Ga0495674_0000607 3300047319 Bacteria 33608
202 Ga0495676_0053202 3300047321 Bacteria 3228
203 Ga0495675_0000175 3300047444 Bacteria 46609
204 Ga0495675_0011012 3300047444 Bacteria 5669
205 Ga0495686_0036751 3300047472 Bacteria 3142
206 Ga0495593_0084634 3300047673 Bacteria 1637
207 Ga0495602_0002588 3300048088 Bacteria 18471
208 Ga0495602_0005883 3300048088 Bacteria 12880
209 Ga0495602_0102248 3300048088 Bacteria 2349
210 Ga0496100_0000002 3300048903 Bacteria 489057
211 Ga0496100_0000018 3300048903 Bacteria 162451
212 Ga0496101_0000001 3300048904 Bacteria 489057
213 Ga0496101_0000062 3300048904 Bacteria 126595
214 Ga0496102_0010620 3300048905 Bacteria 7933
215 Ga0496103_0116168 3300048906 Bacteria 1702
216 Ga0496104_0000004 3300048907 Bacteria 641830
217 Ga0496104_0000009 3300048907 Bacteria 488055
218 Ga0496104_0000650 3300048907 Bacteria 29817
219 Ga0496104_0083915 3300048907 Bacteria 3039
220 Ga0496104_0163943 3300048907 Bacteria 2131
221 Ga0496104_0732385 3300048907 Bacteria 896
222 Ga0496105_0000001 3300048908 Bacteria 1328178
223 Ga0496105_0000007 3300048908 Bacteria 339658
224 Ga0496105_0000347 3300048908 Bacteria 30490
225 Ga0496106_0000061 3300048909 Bacteria 86524
226 Ga0496106_0000122 3300048909 Bacteria 59816
227 Ga0496106_0000312 3300048909 Bacteria 34208
228 Ga0496107_0000006 3300048910 Bacteria 258746
229 Ga0496107_0000013 3300048910 Bacteria 178284
230 Ga0496107_0169588 3300048910 Bacteria 1619
231 Ga0496108_0000062 3300048911 Bacteria 122391
232 Ga0496108_0000187 3300048911 Bacteria 57568
233 Ga0496108_0034278 3300048911 Bacteria 4217
234 Ga0496108_0035606 3300048911 Bacteria 4139
235 Ga0496108_0077852 3300048911 Bacteria 2806
236 Ga0496108_0436960 3300048911 Bacteria 1143
237 Ga0496109_0000121 3300048912 Bacteria 81487
238 Ga0496109_0000129 3300048912 Bacteria 77469
239 Ga0496109_0000611 3300048912 Bacteria 29848
240 Ga0496109_0417691 3300048912 Bacteria 1267
241 Ga0496110_0000089 3300048913 Bacteria 48723
242 Ga0496110_0126161 3300048913 Bacteria 2309
243 Ga0496111_0003847 3300048914 Bacteria 9377
244 Ga0496112_0000006 3300048915 Bacteria 365227
245 Ga0496112_0001770 3300048915 Bacteria 16950
246 Ga0496113_0000628 3300048916 Bacteria 17756
247 Ga0496113_0027889 3300048916 Bacteria 4054
248 Ga0496113_0342264 3300048916 Bacteria 1199
249 Ga0496116_0001565 3300048919 Bacteria 25265
250 Ga0496117_0031120 3300048920 Bacteria 4080
251 Ga0496118_0000818 3300048921 Bacteria 49518
252 Ga0496118_0116358 3300048921 Bacteria 1757
253 Ga0496118_0133060 3300048921 Bacteria 1592
254 Ga0496119_0005786 3300048922 Bacteria 11703
255 Ga0496119_0034494 3300048922 Bacteria 3331
256 Ga0496119_0051890 3300048922 Bacteria 2516
257 Ga0496120_0005134 3300048923 Bacteria 10578
258 Ga0496120_0020754 3300048923 Bacteria 4167
259 Ga0496120_0094721 3300048923 Bacteria 1589
260 Ga0496121_0006714 3300048924 Bacteria 14134
261 Ga0496121_0032232 3300048924 Bacteria 4768
262 Ga0496121_0227112 3300048924 Bacteria 1310
263 Ga0496124_0101149 3300048927 Bacteria 2336
264 Ga0496126_0033929 3300048929 Bacteria 4799
265 Ga0496126_0119743 3300048929 Bacteria 2284
266 Ga0501033_0207355 3300049570 Bacteria 1398
267 Ga0501034_0006426 3300049571 Bacteria 12656
268 Ga0501034_0326870 3300049571 Bacteria 1465
269 Ga0501034_0363318 3300049571 Bacteria 1374
270 Ga0501037_0022414 3300049573 Bacteria 4671
271 Ga0501038_0055974 3300049574 Bacteria 3387
272 Ga0501042_0013041 3300049578 Bacteria 5649
273 Ga0501042_0028770 3300049578 Bacteria 3919
274 Ga0501043_0024076 3300049579 Bacteria 4778
275 Ga0501043_0281172 3300049579 Bacteria 1275
276 Ga0501046_0103920 3300049580 Bacteria 2177
277 Ga0501047_0105786 3300049581 Bacteria 2694
278 Ga0501047_0143970 3300049581 Bacteria 2261
279 Ga0501047_0169949 3300049581 Bacteria 2049
280 Ga0501048_0002374 3300049582 Bacteria 14372
281 Ga0501067_0046470 3300049583 Bacteria 2410
282 Ga0501070_0198373 3300049586 Bacteria 1648
283 Ga0501074_0175872 3300049590 Bacteria 1527
284 Ga0501075_0000990 3300049591 Bacteria 18117
285 Ga0501079_0254199 3300049741 Bacteria 1373
286 Ga0501080_0046434 3300049742 Bacteria 4043
287 Ga0501080_0057677 3300049742 Bacteria 3615
288 Ga0501083_0051840 3300049744 Bacteria 2758
289 Ga0501083_0056200 3300049744 Bacteria 2638
290 Ga0501044_0039969 3300049823 Bacteria 4890
291 Ga0501045_0130629 3300049824 Bacteria 1867
292 Ga0495601_0000013 3300053077 Bacteria 226476
293 Ga0495601_0015708 3300053077 Bacteria 4578
294 Ga0495601_0130978 3300053077 Bacteria 1633
295 Ga0495612_0012406 3300053078 Bacteria 3435
296 Ga0495612_0103938 3300053078 Bacteria 1211
297 Ga0495595_0000003 3300053084 Bacteria 266465
298 Ga0495619_0000031 3300053085 Bacteria 145508
299 Ga0495619_0000257 3300053085 Bacteria 38653
300 Ga0495619_0001230 3300053085 Bacteria 16755
301 Ga0495619_0003554 3300053085 Bacteria 10055
302 Ga0500658_0067203 3300053134 Bacteria 1505
303 Ga0501084_0108581 3300054114 Bacteria 2331

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0732385 Ga0496104_0732385_57_797 238
2 3300049578 Ga0501042_0028770 Ga0501042_0028770_1649_2527 259
3 3300053077 Ga0495601_0130978 Ga0495601_0130978_273_1106 259
4 3300046460 Ga0495638_0037786 Ga0495638_0037786_1838_2737 260
5 3300046660 Ga0495625_0000587 Ga0495625_0000587_27929_28807 263
6 3300005985 Ga0081539_10002609 Ga0081539_100026096 264
7 3300005435 Ga0070714_100071280 Ga0070714_1000712802 265
8 3300006028 Ga0070717_10000005 Ga0070717_10000005159 265
9 3300025929 Ga0207664_10000529 Ga0207664_1000052913 265
10 3300044658 Ga0466972_0173599 Ga0466972_0173599_28_852 266
11 3300044693 Ga0466961_0250836 Ga0466961_0250836_245_1069 266
12 3300045976 Ga0466967_0435645 Ga0466967_0435645_437_1261 266
13 3300048911 Ga0496108_0436960 Ga0496108_0436960_157_1101 267
14 3300048907 Ga0496104_0000650 Ga0496104_0000650_23379_24278 268
15 3300048908 Ga0496105_0000347 Ga0496105_0000347_7449_8348 268
16 3300049571 Ga0501034_0006426 Ga0501034_0006426_6962_7870 268
17 iso_pu_bacteria 2818991462 2819691612 268
18 iso_pu_bacteria 2818991469 2819729608 268
19 3300044901 Ga0466960_0000093 Ga0466960_0000093_12485_13396 269
20 3300037466 Ga0395898_0206037 Ga0395898_0206037_19_876 270
21 3300038443 Ga0395901_0058354 Ga0395901_0058354_1927_2784 270
22 3300038443 Ga0395901_0177417 Ga0395901_0177417_184_1041 270
23 3300038443 Ga0395901_0182160 Ga0395901_0182160_109_966 270
24 3300044694 Ga0466963_0090973 Ga0466963_0090973_132_998 272
25 3300045976 Ga0466967_0121411 Ga0466967_0121411_1130_1972 272
26 3300005338 Ga0068868_100461339 Ga0068868_1004613391 274
27 3300009553 Ga0105249_10156839 Ga0105249_101568392 274
28 3300014326 Ga0157380_10044551 Ga0157380_100445512 274
29 3300025942 Ga0207689_10082155 Ga0207689_100821552 274
30 3300025961 Ga0207712_10297123 Ga0207712_102971232 274
31 3300026041 Ga0207639_10196199 Ga0207639_101961992 274
32 3300013306 Ga0163162_10265894 Ga0163162_102658942 275
33 3300045976 Ga0466967_0721935 Ga0466967_0721935_57_959 275
34 3300046455 Ga0495603_0000333 Ga0495603_0000333_23920_24825 275
35 3300047472 Ga0495686_0036751 Ga0495686_0036751_642_1613 275
36 3300014325 Ga0163163_10255421 Ga0163163_102554212 277
37 3300014969 Ga0157376_10015687 Ga0157376_100156876 277
38 3300005983 Ga0081540_1000049 Ga0081540_100004950 278
39 3300046514 Ga0495618_0115330 Ga0495618_0115330_634_1518 278
40 3300046516 Ga0495628_0145089 Ga0495628_0145089_255_1145 278
41 3300046517 Ga0495630_0007275 Ga0495630_0007275_3182_4072 278
42 3300046535 Ga0495586_0114466 Ga0495586_0114466_60_950 278
43 3300046535 Ga0495586_0142853 Ga0495586_0142853_358_1263 278
44 3300046642 Ga0495634_0007615 Ga0495634_0007615_3221_4102 278
45 3300046675 Ga0495657_0055610 Ga0495657_0055610_607_1497 278
46 3300046690 Ga0495624_0039122 Ga0495624_0039122_1008_1898 278
47 3300048911 Ga0496108_0077852 Ga0496108_0077852_24_917 278
48 3300048913 Ga0496110_0126161 Ga0496110_0126161_1375_2268 278
49 3300053077 Ga0495601_0015708 Ga0495601_0015708_732_1622 278
50 3300053078 Ga0495612_0103938 Ga0495612_0103938_196_1086 278
51 3300053085 Ga0495619_0001230 Ga0495619_0001230_3746_4636 278
52 3300005354 Ga0070675_100377164 Ga0070675_1003771642 279
53 3300013307 Ga0157372_10001384 Ga0157372_1000138416 279
54 3300046454 Ga0495592_0221219 Ga0495592_0221219_222_1103 279
55 3300048923 Ga0496120_0005134 Ga0496120_0005134_8310_9266 279
56 3300053085 Ga0495619_0003554 Ga0495619_0003554_6035_7051 279
57 3300005616 Ga0068852_100133914 Ga0068852_1001339141 280
58 3300026142 Ga0207698_10660695 Ga0207698_106606951 280
59 3300048909 Ga0496106_0000312 Ga0496106_0000312_2624_3532 280
60 3300048910 Ga0496107_0169588 Ga0496107_0169588_269_1177 280
61 3300048912 Ga0496109_0417691 Ga0496109_0417691_51_950 281
62 3300028379 Ga0268266_10084487 Ga0268266_100844872 282
63 3300047673 Ga0495593_0084634 Ga0495593_0084634_137_1117 282
64 3300048911 Ga0496108_0035606 Ga0496108_0035606_2107_3006 282
65 3300048912 Ga0496109_0000129 Ga0496109_0000129_69471_70370 282
66 3300049741 Ga0501079_0254199 Ga0501079_0254199_378_1292 282
67 3300005354 Ga0070675_100000111 Ga0070675_10000011111 283
68 3300005457 Ga0070662_100000004 Ga0070662_100000004101 283
69 3300009551 Ga0105238_10000011 Ga0105238_10000011166 283
70 3300025924 Ga0207694_10000004 Ga0207694_10000004456 283
71 3300025926 Ga0207659_10000010 Ga0207659_10000010108 283
72 3300025933 Ga0207706_10000012 Ga0207706_10000012117 283
73 3300005578 Ga0068854_100000183 Ga0068854_10000018329 284
74 3300005937 Ga0081455_10008758 Ga0081455_100087582 284
75 3300009098 Ga0105245_10024675 Ga0105245_100246754 284
76 3300014326 Ga0157380_10000843 Ga0157380_1000084313 284
77 3300025927 Ga0207687_10027923 Ga0207687_100279233 284
78 3300025981 Ga0207640_10000200 Ga0207640_100002009 284
79 3300046476 Ga0495662_0018203 Ga0495662_0018203_1586_2509 284
80 3300046512 Ga0495610_0023820 Ga0495610_0023820_1835_2740 284
81 3300048919 Ga0496116_0001565 Ga0496116_0001565_15154_16131 284
82 3300048922 Ga0496119_0005786 Ga0496119_0005786_9164_10141 284
83 3300048924 Ga0496121_0006714 Ga0496121_0006714_5413_6363 284
84 3300049744 Ga0501083_0051840 Ga0501083_0051840_435_1379 284
85 3300053078 Ga0495612_0012406 Ga0495612_0012406_1066_2037 284
86 3300053134 Ga0500658_0067203 Ga0500658_0067203_23_1015 284
87 3300032126 Ga0307415_100003742 Ga0307415_1000037425 285
88 3300048905 Ga0496102_0010620 Ga0496102_0010620_1265_2263 285
89 3300048906 Ga0496103_0116168 Ga0496103_0116168_513_1511 285
90 3300048920 Ga0496117_0031120 Ga0496117_0031120_1535_2533 285
91 3300048921 Ga0496118_0000818 Ga0496118_0000818_38325_39323 285
92 3300048921 Ga0496118_0116358 Ga0496118_0116358_143_1126 285
93 3300048921 Ga0496118_0133060 Ga0496118_0133060_427_1419 285
94 3300048924 Ga0496121_0227112 Ga0496121_0227112_315_1298 285
95 3300005365 Ga0070688_100003353 Ga0070688_1000033533 286
96 3300005466 Ga0070685_10015192 Ga0070685_100151923 286
97 3300044842 Ga0466957_0021361 Ga0466957_0021361_241_1170 286
98 3300046516 Ga0495628_0018184 Ga0495628_0018184_767_1720 286
99 3300046615 Ga0495656_0004834 Ga0495656_0004834_554_1492 286
100 3300046809 Ga0495600_0016433 Ga0495600_0016433_3033_3962 286
101 3300053077 Ga0495601_0000013 Ga0495601_0000013_89920_90849 286
102 3300005366 Ga0070659_100159262 Ga0070659_1001592622 287
103 3300025932 Ga0207690_10123708 Ga0207690_101237082 287
104 3300026078 Ga0207702_10090900 Ga0207702_100909003 287
105 3300046689 Ga0495613_0000179 Ga0495613_0000179_15629_16561 287
106 3300047317 Ga0495604_0000357 Ga0495604_0000357_4903_5832 287
107 3300048907 Ga0496104_0083915 Ga0496104_0083915_1806_2735 287
108 3300005344 Ga0070661_100001375 Ga0070661_1000013758 288
109 3300005347 Ga0070668_100001695 Ga0070668_1000016958 288
110 3300005367 Ga0070667_100005090 Ga0070667_1000050905 288
111 3300005436 Ga0070713_100000390 Ga0070713_1000003908 288
112 3300005548 Ga0070665_100059195 Ga0070665_1000591952 288
113 3300005578 Ga0068854_100175322 Ga0068854_1001753222 288
114 3300005614 Ga0068856_100000757 Ga0068856_1000007572 288
115 3300005719 Ga0068861_100199652 Ga0068861_1001996522 288
116 3300005843 Ga0068860_100175443 Ga0068860_1001754432 288
117 3300005844 Ga0068862_100001210 Ga0068862_10000121012 288
118 3300006175 Ga0070712_100008485 Ga0070712_1000084853 288
119 3300009098 Ga0105245_10001150 Ga0105245_100011509 288
120 3300009101 Ga0105247_10000242 Ga0105247_1000024235 288
121 3300009553 Ga0105249_10013176 Ga0105249_100131762 288
122 3300014968 Ga0157379_10037861 Ga0157379_100378611 288
123 3300014968 Ga0157379_10133895 Ga0157379_101338952 288
124 3300014969 Ga0157376_10079843 Ga0157376_100798433 288
125 3300025900 Ga0207710_10000531 Ga0207710_1000053112 288
126 3300025915 Ga0207693_10006065 Ga0207693_100060655 288
127 3300025920 Ga0207649_10000009 Ga0207649_10000009285 288
128 3300025927 Ga0207687_10000013 Ga0207687_1000001315 288
129 3300025928 Ga0207700_10000027 Ga0207700_10000027103 288
130 3300025961 Ga0207712_10011553 Ga0207712_100115532 288
131 3300025972 Ga0207668_10002674 Ga0207668_100026746 288
132 3300025981 Ga0207640_10033780 Ga0207640_100337802 288
133 3300025986 Ga0207658_10032850 Ga0207658_100328503 288
134 3300026078 Ga0207702_10000060 Ga0207702_1000006027 288
135 3300026118 Ga0207675_100127284 Ga0207675_1001272842 288
136 3300028379 Ga0268266_10043788 Ga0268266_100437883 288
137 3300028380 Ga0268265_10008345 Ga0268265_100083454 288
138 3300028381 Ga0268264_10017683 Ga0268264_100176834 288
139 3300044694 Ga0466963_0196193 Ga0466963_0196193_10_942 288
140 3300046684 Ga0495669_0000033 Ga0495669_0000033_2608_3540 288
141 3300047317 Ga0495604_0215283 Ga0495604_0215283_114_1046 288
142 3300048088 Ga0495602_0002588 Ga0495602_0002588_10461_11393 288
143 3300048907 Ga0496104_0163943 Ga0496104_0163943_303_1217 288
144 3300048922 Ga0496119_0034494 Ga0496119_0034494_96_1010 288
145 3300048924 Ga0496121_0032232 Ga0496121_0032232_1488_2402 288
146 3300048929 Ga0496126_0033929 Ga0496126_0033929_1929_2861 288
147 3300048929 Ga0496126_0119743 Ga0496126_0119743_45_986 288
148 3300049571 Ga0501034_0363318 Ga0501034_0363318_306_1235 288
149 3300049579 Ga0501043_0281172 Ga0501043_0281172_126_1055 288
150 3300049580 Ga0501046_0103920 Ga0501046_0103920_1154_2083 288
151 3300049591 Ga0501075_0000990 Ga0501075_0000990_13080_14003 288
152 3300049742 Ga0501080_0057677 Ga0501080_0057677_350_1279 288
153 3300049824 Ga0501045_0130629 Ga0501045_0130629_112_1041 288
154 3300005439 Ga0070711_100002341 Ga0070711_1000023416 289
155 3300005456 Ga0070678_100480837 Ga0070678_1004808372 289
156 3300005535 Ga0070684_100060607 Ga0070684_1000606072 289
157 3300005841 Ga0068863_100006700 Ga0068863_1000067008 289
158 3300009553 Ga0105249_10000203 Ga0105249_1000020312 289
159 3300011119 Ga0105246_10040043 Ga0105246_100400432 289
160 3300014326 Ga0157380_10000253 Ga0157380_100002537 289
161 3300014968 Ga0157379_10015187 Ga0157379_100151872 289
162 3300025916 Ga0207663_10001197 Ga0207663_100011976 289
163 3300025944 Ga0207661_10002098 Ga0207661_100020983 289
164 3300025961 Ga0207712_10000007 Ga0207712_10000007351 289
165 3300026088 Ga0207641_10000405 Ga0207641_1000040527 289
166 3300044694 Ga0466963_0000001 Ga0466963_0000001_28122_29045 289
167 3300046675 Ga0495657_0003153 Ga0495657_0003153_9810_10772 289
168 3300048903 Ga0496100_0000002 Ga0496100_0000002_338870_339817 289
169 3300048904 Ga0496101_0000001 Ga0496101_0000001_338870_339817 289
170 3300048907 Ga0496104_0000009 Ga0496104_0000009_225370_226317 289
171 3300048908 Ga0496105_0000007 Ga0496105_0000007_261739_262686 289
172 3300048909 Ga0496106_0000061 Ga0496106_0000061_11425_12372 289
173 3300048910 Ga0496107_0000013 Ga0496107_0000013_165914_166861 289
174 3300048915 Ga0496112_0000006 Ga0496112_0000006_340924_341853 289
175 3300005338 Ga0068868_100001577 Ga0068868_10000157714 290
176 3300005364 Ga0070673_100001567 Ga0070673_1000015678 290
177 3300005459 Ga0068867_100165898 Ga0068867_1001658982 290
178 3300005547 Ga0070693_100014133 Ga0070693_1000141333 290
179 3300013297 Ga0157378_10042428 Ga0157378_100424284 290
180 3300025960 Ga0207651_10274754 Ga0207651_102747542 290
181 3300026023 Ga0207677_10001542 Ga0207677_100015423 290
182 3300026089 Ga0207648_10002260 Ga0207648_1000226016 290
183 3300046461 Ga0495641_0073815 Ga0495641_0073815_287_1207 290
184 3300046683 Ga0495658_0015784 Ga0495658_0015784_2814_3737 290
185 3300048911 Ga0496108_0034278 Ga0496108_0034278_514_1431 290
186 3300048916 Ga0496113_0027889 Ga0496113_0027889_636_1553 290
187 3300005347 Ga0070668_100012580 Ga0070668_1000125803 291
188 3300005435 Ga0070714_100393318 Ga0070714_1003933182 291
189 3300005834 Ga0068851_10017894 Ga0068851_100178943 291
190 3300009093 Ga0105240_10125841 Ga0105240_101258413 291
191 3300009545 Ga0105237_10344367 Ga0105237_103443672 291
192 3300025321 Ga0207656_10002156 Ga0207656_100021564 291
193 3300025913 Ga0207695_10098294 Ga0207695_100982942 291
194 3300025929 Ga0207664_10368302 Ga0207664_103683021 291
195 3300046536 Ga0495587_0003427 Ga0495587_0003427_8662_9615 291
196 3300048088 Ga0495602_0102248 Ga0495602_0102248_911_1870 291
197 3300049586 Ga0501070_0198373 Ga0501070_0198373_125_1048 291
198 3300005337 Ga0070682_100000117 Ga0070682_10000011754 292
199 3300005337 Ga0070682_100161833 Ga0070682_1001618332 292
200 3300005365 Ga0070688_100017896 Ga0070688_1000178963 292
201 3300005466 Ga0070685_10004176 Ga0070685_100041763 292
202 3300005544 Ga0070686_100059890 Ga0070686_1000598902 292
203 3300005548 Ga0070665_100050774 Ga0070665_1000507743 292
204 3300005616 Ga0068852_100000093 Ga0068852_10000009311 292
205 3300006881 Ga0068865_100001277 Ga0068865_1000012773 292
206 3300009148 Ga0105243_10107153 Ga0105243_101071532 292
207 3300009176 Ga0105242_10002871 Ga0105242_100028713 292
208 3300013105 Ga0157369_10000110 Ga0157369_10000110104 292
209 3300013297 Ga0157378_10031281 Ga0157378_100312812 292
210 3300013308 Ga0157375_10085412 Ga0157375_100854122 292
211 3300025916 Ga0207663_10202215 Ga0207663_102022152 292
212 3300025934 Ga0207686_10000468 Ga0207686_1000046826 292
213 3300025935 Ga0207709_10007242 Ga0207709_100072422 292
214 3300025938 Ga0207704_10000093 Ga0207704_1000009342 292
215 3300026142 Ga0207698_10000440 Ga0207698_1000044013 292
216 3300028379 Ga0268266_10005034 Ga0268266_100050349 292
217 3300041491 Ga0451833_0468266 Ga0451833_0468266_280_1203 292
218 3300046459 Ga0495629_0005201 Ga0495629_0005201_2628_3605 292
219 3300046461 Ga0495641_0017016 Ga0495641_0017016_1860_2831 292
220 3300046507 Ga0495606_0000565 Ga0495606_0000565_41224_42201 292
221 3300046511 Ga0495608_0000068 Ga0495608_0000068_72451_73380 292
222 3300046516 Ga0495628_0032736 Ga0495628_0032736_2468_3427 292
223 3300046517 Ga0495630_0000056 Ga0495630_0000056_83336_84268 292
224 3300046529 Ga0495652_0000546 Ga0495652_0000546_27941_28864 292
225 3300046674 Ga0495588_0000165 Ga0495588_0000165_6916_7926 292
226 3300046675 Ga0495657_0000004 Ga0495657_0000004_116200_117129 292
227 3300046681 Ga0495647_0000018 Ga0495647_0000018_15320_16282 292
228 3300046681 Ga0495647_0000904 Ga0495647_0000904_6491_7450 292
229 3300046690 Ga0495624_0000073 Ga0495624_0000073_44005_44937 292
230 3300047321 Ga0495676_0053202 Ga0495676_0053202_1113_2030 292
231 3300047444 Ga0495675_0000175 Ga0495675_0000175_43037_43966 292
232 3300048903 Ga0496100_0000018 Ga0496100_0000018_141995_142912 292
233 3300048904 Ga0496101_0000062 Ga0496101_0000062_50315_51232 292
234 3300048907 Ga0496104_0000004 Ga0496104_0000004_245511_246455 292
235 3300048908 Ga0496105_0000001 Ga0496105_0000001_395376_396320 292
236 3300048909 Ga0496106_0000122 Ga0496106_0000122_56289_57206 292
237 3300048910 Ga0496107_0000006 Ga0496107_0000006_210918_211835 292
238 3300048911 Ga0496108_0000062 Ga0496108_0000062_117157_118089 292
239 3300048912 Ga0496109_0000121 Ga0496109_0000121_65356_66288 292
240 3300048913 Ga0496110_0000089 Ga0496110_0000089_2656_3585 292
241 3300048914 Ga0496111_0003847 Ga0496111_0003847_1557_2486 292
242 3300048915 Ga0496112_0001770 Ga0496112_0001770_7598_8530 292
243 3300048916 Ga0496113_0000628 Ga0496113_0000628_9231_10163 292
244 3300048916 Ga0496113_0342264 Ga0496113_0342264_138_1076 292
245 3300048922 Ga0496119_0051890 Ga0496119_0051890_660_1604 292
246 3300048923 Ga0496120_0020754 Ga0496120_0020754_1180_2124 292
247 3300049581 Ga0501047_0143970 Ga0501047_0143970_104_1030 292
248 3300049742 Ga0501080_0046434 Ga0501080_0046434_2266_3219 292
249 3300053084 Ga0495595_0000003 Ga0495595_0000003_116200_117129 292
250 3300053085 Ga0495619_0000031 Ga0495619_0000031_89786_90715 292
251 3300053085 Ga0495619_0000257 Ga0495619_0000257_2615_3544 292
252 3300005456 Ga0070678_100348125 Ga0070678_1003481252 293
253 3300005548 Ga0070665_100118283 Ga0070665_1001182832 293
254 3300005840 Ga0068870_10060843 Ga0068870_100608432 293
255 3300009098 Ga0105245_10001831 Ga0105245_100018317 293
256 3300009101 Ga0105247_10088738 Ga0105247_100887382 293
257 3300009101 Ga0105247_10108527 Ga0105247_101085272 293
258 3300009551 Ga0105238_10289854 Ga0105238_102898542 293
259 3300025900 Ga0207710_10073683 Ga0207710_100736832 293
260 3300025914 Ga0207671_10220143 Ga0207671_102201432 293
261 3300025927 Ga0207687_10000007 Ga0207687_10000007380 293
262 3300026116 Ga0207674_10129673 Ga0207674_101296732 293
263 3300028379 Ga0268266_10000285 Ga0268266_100002852 293
264 3300046533 Ga0495640_0070585 Ga0495640_0070585_826_1788 293
265 3300047319 Ga0495674_0000607 Ga0495674_0000607_3740_4702 293
266 3300048923 Ga0496120_0094721 Ga0496120_0094721_637_1575 293
267 3300049578 Ga0501042_0013041 Ga0501042_0013041_4622_5557 293
268 3300049583 Ga0501067_0046470 Ga0501067_0046470_448_1401 293
269 3300005367 Ga0070667_100079255 Ga0070667_1000792552 294
270 3300005367 Ga0070667_100135909 Ga0070667_1001359092 294
271 3300005535 Ga0070684_100011369 Ga0070684_1000113691 294
272 3300005543 Ga0070672_100000015 Ga0070672_10000001519 294
273 3300005564 Ga0070664_100449600 Ga0070664_1004496002 294
274 3300009177 Ga0105248_10000008 Ga0105248_10000008358 294
275 3300013104 Ga0157370_10128059 Ga0157370_101280592 294
276 3300025940 Ga0207691_10000044 Ga0207691_1000004444 294
277 3300025941 Ga0207711_10000006 Ga0207711_10000006752 294
278 3300025945 Ga0207679_10263672 Ga0207679_102636722 294
279 3300025986 Ga0207658_10065171 Ga0207658_100651713 294
280 3300028379 Ga0268266_10116648 Ga0268266_101166482 294
281 3300045976 Ga0466967_0000009 Ga0466967_0000009_52003_52965 294
282 3300048927 Ga0496124_0101149 Ga0496124_0101149_54_995 294
283 3300049570 Ga0501033_0207355 Ga0501033_0207355_140_1105 294
284 3300049571 Ga0501034_0326870 Ga0501034_0326870_361_1323 294
285 3300049573 Ga0501037_0022414 Ga0501037_0022414_274_1236 294
286 3300049574 Ga0501038_0055974 Ga0501038_0055974_1264_2229 294
287 3300049579 Ga0501043_0024076 Ga0501043_0024076_654_1616 294
288 3300049581 Ga0501047_0105786 Ga0501047_0105786_1306_2259 294
289 3300049581 Ga0501047_0169949 Ga0501047_0169949_831_1766 294
290 3300049582 Ga0501048_0002374 Ga0501048_0002374_1331_2293 294
291 3300049744 Ga0501083_0056200 Ga0501083_0056200_595_1557 294
292 3300049823 Ga0501044_0039969 Ga0501044_0039969_3786_4751 294
293 3300054114 Ga0501084_0108581 Ga0501084_0108581_520_1482 294
294 3300047444 Ga0495675_0011012 Ga0495675_0011012_2196_3137 295
295 3300013297 Ga0157378_10024610 Ga0157378_100246103 297
296 3300046516 Ga0495628_0000190 Ga0495628_0000190_49944_50930 297
297 3300048088 Ga0495602_0005883 Ga0495602_0005883_5167_6153 297
298 3300025942 Ga0207689_10376461 Ga0207689_103764612 298
299 3300049590 Ga0501074_0175872 Ga0501074_0175872_70_1014 299
300 3300005530 Ga0070679_100009133 Ga0070679_1000091332 300
301 3300025921 Ga0207652_10023267 Ga0207652_100232673 300
302 3300026067 Ga0207678_10017704 Ga0207678_100177043 300
303 3300048911 Ga0496108_0000187 Ga0496108_0000187_21807_22760 300
304 3300048912 Ga0496109_0000611 Ga0496109_0000611_7302_8255 300
305 3300002239 JGI24034J26672_10000136 JGI24034J26672_100001368 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

179

288

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wew-assembly1.cif.gz_A crystal structure of htdx (rv0241c) of mycobacterium tuberculosis at 2.4 a resolution 0.962 44 289
3wew-assembly1.cif.gz_A crystal structure of htdx (rv0241c) of mycobacterium tuberculosis at 2.4 a resolution 0.9539 44 289
4oob-assembly1.cif.gz_A crystal structure of htdx(rv0241c) from mycobacterium tuberculosis 0.8933 46 289
4oob-assembly1.cif.gz_A crystal structure of htdx(rv0241c) from mycobacterium tuberculosis 0.8827 46 289
8psm-assembly1.cif.gz_G asymmetric unit of the yeast fatty acid synthase in the non-rotated state with acp at the malonyl/palmitoyl transferase domain (fasx sample) 0.8322 44 291
ID Description Score Start End Superfamily
4oobA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8933 46 289 3.10.129.10
4oobA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8827 46 289 3.10.129.10
af_Q9W439_57_173_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8573 243 286 3.10.129.10
2gf6D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8463 101 159 3.10.129.10
af_Q2G0K1_2_118_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8459 46 160 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A6I1IPB5-F1-model_v4 deleted 0.9715 172 289
AF-A0A6I1IPB5-F1-model_v4 deleted 0.9633 172 289
AF-A0A7V8ZLL3-F1-model_v4 MaoC-like domain-containing protein 0.9593 1 294
AF-A0A2W4IWE0-F1-model_v4 MaoC-like domain-containing protein 0.9544 42 287 GO:0004312
GO:0005835
GO:0006633
AF-A0A7V8ZLL3-F1-model_v4 MaoC-like domain-containing protein 0.9466 1 294

Feature Viewer

pLDDT pTM Quality
84.73 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map