F398093
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 305 | 191 | 303 | 307 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10088738|Ga0105247_100887382 |
| Length | 344 |
| Sequence | MAKTLDSSPSILPLYARAALPMIPGASLLXXXXGGGGEIPDGLDLELAGVTAKPEDVAAYARVCGFALRDTLPPTYPHMLAFPLHMAVMSDGSFPFGAVGLVHVENSIVQKRPIGIHEEMTIRVRPTPLQPHPKGKTFSLETEVLVDGEVVWESVSTMLRRGKGDESAKPERGFESLPADAPASAEWKLGGDLGRRYAGVSGDRNPIHMHSLTAKPLGFPSAIAHGMWTKARALAQLGSKLPDAFEADVRFRKPVLLPARVEFASREQEGEILFAVRDAKKGTPHLDGRVQPLSSPKPQTKSKSDAARGLAKSKTAKTGMNFMRGPPPRSREWRSAAWATACGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 2 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 38 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 103 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 104 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 105 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 106 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 107 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 108 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 109 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 110 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 111 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 112 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 149 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 150 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 151 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 152 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 153 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 154 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 157 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 158 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 159 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 160 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 161 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 162 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 163 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 164 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 165 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 166 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 167 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 168 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 191 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.34 |
| Metatranscriptomes | 0 |
| Isolates | 0.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.33 |
| Nodule | 0 |
| Rhizoplane | 12.79 |
| Rhizosphere | 80.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10000136 | 3300002239 | Bacteria | 10868 |
| 2 | Ga0070682_100000117 | 3300005337 | Bacteria | 69662 |
| 3 | Ga0070682_100161833 | 3300005337 | Bacteria | 1546 |
| 4 | Ga0068868_100001577 | 3300005338 | Bacteria | 15543 |
| 5 | Ga0068868_100461339 | 3300005338 | Bacteria | 1107 |
| 6 | Ga0070661_100001375 | 3300005344 | Bacteria | 16996 |
| 7 | Ga0070668_100001695 | 3300005347 | Bacteria | 15984 |
| 8 | Ga0070668_100012580 | 3300005347 | Bacteria | 6302 |
| 9 | Ga0070675_100000111 | 3300005354 | Bacteria | 47699 |
| 10 | Ga0070675_100377164 | 3300005354 | Bacteria | 1262 |
| 11 | Ga0070673_100001567 | 3300005364 | Bacteria | 13472 |
| 12 | Ga0070688_100003353 | 3300005365 | Bacteria | 8214 |
| 13 | Ga0070688_100017896 | 3300005365 | Bacteria | 4076 |
| 14 | Ga0070659_100159262 | 3300005366 | Bacteria | 1845 |
| 15 | Ga0070667_100005090 | 3300005367 | Bacteria | 11004 |
| 16 | Ga0070667_100079255 | 3300005367 | Bacteria | 2808 |
| 17 | Ga0070667_100135909 | 3300005367 | Bacteria | 2150 |
| 18 | Ga0070714_100071280 | 3300005435 | Bacteria | 3004 |
| 19 | Ga0070714_100393318 | 3300005435 | Bacteria | 1309 |
| 20 | Ga0070713_100000390 | 3300005436 | Bacteria | 28149 |
| 21 | Ga0070711_100002341 | 3300005439 | Bacteria | 10769 |
| 22 | Ga0070678_100348125 | 3300005456 | Bacteria | 1273 |
| 23 | Ga0070678_100480837 | 3300005456 | Bacteria | 1093 |
| 24 | Ga0070662_100000004 | 3300005457 | Bacteria | 195534 |
| 25 | Ga0068867_100165898 | 3300005459 | Bacteria | 1745 |
| 26 | Ga0070685_10004176 | 3300005466 | Bacteria | 7284 |
| 27 | Ga0070685_10015192 | 3300005466 | Bacteria | 4088 |
| 28 | Ga0070679_100009133 | 3300005530 | Bacteria | 9358 |
| 29 | Ga0070684_100011369 | 3300005535 | Bacteria | 7089 |
| 30 | Ga0070684_100060607 | 3300005535 | Bacteria | 3311 |
| 31 | Ga0070672_100000015 | 3300005543 | Bacteria | 72591 |
| 32 | Ga0070686_100059890 | 3300005544 | Bacteria | 2454 |
| 33 | Ga0070693_100014133 | 3300005547 | Bacteria | 4083 |
| 34 | Ga0070665_100050774 | 3300005548 | Bacteria | 4162 |
| 35 | Ga0070665_100059195 | 3300005548 | Bacteria | 3840 |
| 36 | Ga0070665_100118283 | 3300005548 | Bacteria | 2652 |
| 37 | Ga0070664_100449600 | 3300005564 | Bacteria | 1183 |
| 38 | Ga0068854_100000183 | 3300005578 | Bacteria | 42525 |
| 39 | Ga0068854_100175322 | 3300005578 | Bacteria | 1671 |
| 40 | Ga0068856_100000757 | 3300005614 | Bacteria | 35080 |
| 41 | Ga0068852_100000093 | 3300005616 | Bacteria | 60834 |
| 42 | Ga0068852_100133914 | 3300005616 | Bacteria | 2286 |
| 43 | Ga0068861_100199652 | 3300005719 | Bacteria | 1678 |
| 44 | Ga0068851_10017894 | 3300005834 | Bacteria | 3410 |
| 45 | Ga0068870_10060843 | 3300005840 | Bacteria | 2028 |
| 46 | Ga0068863_100006700 | 3300005841 | Bacteria | 11301 |
| 47 | Ga0068860_100175443 | 3300005843 | Bacteria | 2071 |
| 48 | Ga0068862_100001210 | 3300005844 | Bacteria | 24342 |
| 49 | Ga0081455_10008758 | 3300005937 | Bacteria | 10475 |
| 50 | Ga0081540_1000049 | 3300005983 | Bacteria | 127322 |
| 51 | Ga0081539_10002609 | 3300005985 | Bacteria | 24708 |
| 52 | Ga0070717_10000005 | 3300006028 | Bacteria | 357819 |
| 53 | Ga0070712_100008485 | 3300006175 | Bacteria | 6466 |
| 54 | Ga0068865_100001277 | 3300006881 | Bacteria | 14651 |
| 55 | Ga0105240_10125841 | 3300009093 | Bacteria | 3080 |
| 56 | Ga0105245_10001150 | 3300009098 | Bacteria | 23924 |
| 57 | Ga0105245_10001831 | 3300009098 | Bacteria | 19354 |
| 58 | Ga0105245_10024675 | 3300009098 | Bacteria | 5282 |
| 59 | Ga0105247_10000242 | 3300009101 | Bacteria | 51204 |
| 60 | Ga0105247_10088738 | 3300009101 | Bacteria | 1960 |
| 61 | Ga0105247_10108527 | 3300009101 | Bacteria | 1783 |
| 62 | Ga0105243_10107153 | 3300009148 | Bacteria | 2330 |
| 63 | Ga0105242_10002871 | 3300009176 | Bacteria | 13495 |
| 64 | Ga0105248_10000008 | 3300009177 | Bacteria | 403910 |
| 65 | Ga0105237_10344367 | 3300009545 | Bacteria | 1495 |
| 66 | Ga0105238_10000011 | 3300009551 | Bacteria | 261080 |
| 67 | Ga0105238_10289854 | 3300009551 | Bacteria | 1619 |
| 68 | Ga0105249_10000203 | 3300009553 | Bacteria | 67783 |
| 69 | Ga0105249_10013176 | 3300009553 | Bacteria | 7295 |
| 70 | Ga0105249_10156839 | 3300009553 | Bacteria | 2196 |
| 71 | Ga0105246_10040043 | 3300011119 | Bacteria | 3160 |
| 72 | Ga0157370_10128059 | 3300013104 | Bacteria | 2369 |
| 73 | Ga0157369_10000110 | 3300013105 | Bacteria | 115514 |
| 74 | Ga0157378_10024610 | 3300013297 | Bacteria | 5300 |
| 75 | Ga0157378_10031281 | 3300013297 | Bacteria | 4701 |
| 76 | Ga0157378_10042428 | 3300013297 | Bacteria | 4038 |
| 77 | Ga0163162_10265894 | 3300013306 | Bacteria | 1847 |
| 78 | Ga0157372_10001384 | 3300013307 | Bacteria | 26176 |
| 79 | Ga0157375_10085412 | 3300013308 | Bacteria | 3206 |
| 80 | Ga0163163_10255421 | 3300014325 | Bacteria | 1803 |
| 81 | Ga0157380_10000253 | 3300014326 | Bacteria | 32008 |
| 82 | Ga0157380_10000843 | 3300014326 | Bacteria | 19177 |
| 83 | Ga0157380_10044551 | 3300014326 | Bacteria | 3478 |
| 84 | Ga0157379_10015187 | 3300014968 | Bacteria | 6754 |
| 85 | Ga0157379_10037861 | 3300014968 | Bacteria | 4302 |
| 86 | Ga0157379_10133895 | 3300014968 | Bacteria | 2232 |
| 87 | Ga0157376_10015687 | 3300014969 | Bacteria | 5730 |
| 88 | Ga0157376_10079843 | 3300014969 | Bacteria | 2805 |
| 89 | Ga0207656_10002156 | 3300025321 | Bacteria | 6575 |
| 90 | Ga0207710_10000531 | 3300025900 | Bacteria | 23383 |
| 91 | Ga0207710_10073683 | 3300025900 | Bacteria | 1570 |
| 92 | Ga0207695_10098294 | 3300025913 | Bacteria | 2926 |
| 93 | Ga0207671_10220143 | 3300025914 | Bacteria | 1487 |
| 94 | Ga0207693_10006065 | 3300025915 | Bacteria | 10009 |
| 95 | Ga0207663_10001197 | 3300025916 | Bacteria | 11982 |
| 96 | Ga0207663_10202215 | 3300025916 | Bacteria | 1434 |
| 97 | Ga0207649_10000009 | 3300025920 | Bacteria | 295544 |
| 98 | Ga0207652_10023267 | 3300025921 | Bacteria | 5131 |
| 99 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 100 | Ga0207659_10000010 | 3300025926 | Bacteria | 286639 |
| 101 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 102 | Ga0207687_10000013 | 3300025927 | Bacteria | 299826 |
| 103 | Ga0207687_10027923 | 3300025927 | Bacteria | 3789 |
| 104 | Ga0207700_10000027 | 3300025928 | Bacteria | 137708 |
| 105 | Ga0207664_10000529 | 3300025929 | Bacteria | 27133 |
| 106 | Ga0207664_10368302 | 3300025929 | Bacteria | 1274 |
| 107 | Ga0207690_10123708 | 3300025932 | Bacteria | 1883 |
| 108 | Ga0207706_10000012 | 3300025933 | Bacteria | 195475 |
| 109 | Ga0207686_10000468 | 3300025934 | Bacteria | 26729 |
| 110 | Ga0207709_10007242 | 3300025935 | Bacteria | 6188 |
| 111 | Ga0207704_10000093 | 3300025938 | Bacteria | 52224 |
| 112 | Ga0207691_10000044 | 3300025940 | Bacteria | 100027 |
| 113 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 114 | Ga0207689_10082155 | 3300025942 | Bacteria | 2649 |
| 115 | Ga0207689_10376461 | 3300025942 | Bacteria | 1182 |
| 116 | Ga0207661_10002098 | 3300025944 | Bacteria | 13720 |
| 117 | Ga0207679_10263672 | 3300025945 | Bacteria | 1471 |
| 118 | Ga0207651_10274754 | 3300025960 | Bacteria | 1389 |
| 119 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 120 | Ga0207712_10011553 | 3300025961 | Bacteria | 5629 |
| 121 | Ga0207712_10297123 | 3300025961 | Bacteria | 1324 |
| 122 | Ga0207668_10002674 | 3300025972 | Bacteria | 10429 |
| 123 | Ga0207640_10000200 | 3300025981 | Bacteria | 42738 |
| 124 | Ga0207640_10033780 | 3300025981 | Bacteria | 3186 |
| 125 | Ga0207658_10032850 | 3300025986 | Bacteria | 3697 |
| 126 | Ga0207658_10065171 | 3300025986 | Bacteria | 2735 |
| 127 | Ga0207677_10001542 | 3300026023 | Bacteria | 12184 |
| 128 | Ga0207639_10196199 | 3300026041 | Bacteria | 1728 |
| 129 | Ga0207678_10017704 | 3300026067 | Bacteria | 6257 |
| 130 | Ga0207702_10000060 | 3300026078 | Bacteria | 125473 |
| 131 | Ga0207702_10090900 | 3300026078 | Bacteria | 2672 |
| 132 | Ga0207641_10000405 | 3300026088 | Bacteria | 50517 |
| 133 | Ga0207648_10002260 | 3300026089 | Bacteria | 20839 |
| 134 | Ga0207674_10129673 | 3300026116 | Bacteria | 2486 |
| 135 | Ga0207675_100127284 | 3300026118 | Bacteria | 2413 |
| 136 | Ga0207698_10000440 | 3300026142 | Bacteria | 23916 |
| 137 | Ga0207698_10660695 | 3300026142 | Bacteria | 1036 |
| 138 | Ga0268266_10000285 | 3300028379 | Bacteria | 83300 |
| 139 | Ga0268266_10005034 | 3300028379 | Bacteria | 12475 |
| 140 | Ga0268266_10043788 | 3300028379 | Bacteria | 3826 |
| 141 | Ga0268266_10084487 | 3300028379 | Bacteria | 2772 |
| 142 | Ga0268266_10116648 | 3300028379 | Bacteria | 2371 |
| 143 | Ga0268265_10008345 | 3300028380 | Bacteria | 6994 |
| 144 | Ga0268264_10017683 | 3300028381 | Bacteria | 5837 |
| 145 | Ga0307415_100003742 | 3300032126 | Bacteria | 7793 |
| 146 | Ga0395898_0206037 | 3300037466 | Bacteria | 1876 |
| 147 | Ga0395901_0058354 | 3300038443 | Bacteria | 4014 |
| 148 | Ga0395901_0177417 | 3300038443 | Bacteria | 2234 |
| 149 | Ga0395901_0182160 | 3300038443 | Bacteria | 2203 |
| 150 | Ga0451833_0468266 | 3300041491 | Bacteria | 2382 |
| 151 | Ga0466972_0173599 | 3300044658 | Bacteria | 1011 |
| 152 | Ga0466961_0250836 | 3300044693 | Bacteria | 1087 |
| 153 | Ga0466963_0000001 | 3300044694 | Bacteria | 110556 |
| 154 | Ga0466963_0090973 | 3300044694 | Bacteria | 2078 |
| 155 | Ga0466963_0196193 | 3300044694 | Bacteria | 1411 |
| 156 | Ga0466957_0021361 | 3300044842 | Bacteria | 3813 |
| 157 | Ga0466960_0000093 | 3300044901 | Bacteria | 29301 |
| 158 | Ga0466967_0000009 | 3300045976 | Bacteria | 122610 |
| 159 | Ga0466967_0121411 | 3300045976 | Bacteria | 2415 |
| 160 | Ga0466967_0435645 | 3300045976 | Bacteria | 1279 |
| 161 | Ga0466967_0721935 | 3300045976 | Bacteria | 988 |
| 162 | Ga0495592_0221219 | 3300046454 | Bacteria | 1266 |
| 163 | Ga0495603_0000333 | 3300046455 | Bacteria | 25490 |
| 164 | Ga0495629_0005201 | 3300046459 | Bacteria | 9743 |
| 165 | Ga0495638_0037786 | 3300046460 | Bacteria | 3071 |
| 166 | Ga0495641_0017016 | 3300046461 | Bacteria | 3805 |
| 167 | Ga0495641_0073815 | 3300046461 | Bacteria | 1530 |
| 168 | Ga0495662_0018203 | 3300046476 | Bacteria | 3399 |
| 169 | Ga0495606_0000565 | 3300046507 | Bacteria | 58752 |
| 170 | Ga0495608_0000068 | 3300046511 | Bacteria | 79694 |
| 171 | Ga0495610_0023820 | 3300046512 | Bacteria | 3319 |
| 172 | Ga0495618_0115330 | 3300046514 | Bacteria | 1720 |
| 173 | Ga0495628_0000190 | 3300046516 | Bacteria | 53586 |
| 174 | Ga0495628_0018184 | 3300046516 | Bacteria | 5829 |
| 175 | Ga0495628_0032736 | 3300046516 | Bacteria | 4195 |
| 176 | Ga0495628_0145089 | 3300046516 | Bacteria | 1810 |
| 177 | Ga0495630_0000056 | 3300046517 | Bacteria | 91477 |
| 178 | Ga0495630_0007275 | 3300046517 | Bacteria | 7900 |
| 179 | Ga0495652_0000546 | 3300046529 | Bacteria | 44003 |
| 180 | Ga0495640_0070585 | 3300046533 | Bacteria | 2346 |
| 181 | Ga0495586_0114466 | 3300046535 | Bacteria | 1503 |
| 182 | Ga0495586_0142853 | 3300046535 | Bacteria | 1344 |
| 183 | Ga0495587_0003427 | 3300046536 | Bacteria | 10576 |
| 184 | Ga0495656_0004834 | 3300046615 | Bacteria | 4635 |
| 185 | Ga0495634_0007615 | 3300046642 | Bacteria | 8114 |
| 186 | Ga0495625_0000587 | 3300046660 | Bacteria | 52838 |
| 187 | Ga0495588_0000165 | 3300046674 | Bacteria | 85841 |
| 188 | Ga0495657_0000004 | 3300046675 | Bacteria | 266465 |
| 189 | Ga0495657_0003153 | 3300046675 | Bacteria | 13588 |
| 190 | Ga0495657_0055610 | 3300046675 | Bacteria | 2639 |
| 191 | Ga0495647_0000018 | 3300046681 | Bacteria | 81701 |
| 192 | Ga0495647_0000904 | 3300046681 | Bacteria | 8893 |
| 193 | Ga0495658_0015784 | 3300046683 | Bacteria | 3879 |
| 194 | Ga0495669_0000033 | 3300046684 | Bacteria | 98629 |
| 195 | Ga0495613_0000179 | 3300046689 | Bacteria | 62109 |
| 196 | Ga0495624_0000073 | 3300046690 | Bacteria | 65582 |
| 197 | Ga0495624_0039122 | 3300046690 | Bacteria | 3042 |
| 198 | Ga0495600_0016433 | 3300046809 | Bacteria | 4696 |
| 199 | Ga0495604_0000357 | 3300047317 | Bacteria | 40931 |
| 200 | Ga0495604_0215283 | 3300047317 | Bacteria | 1325 |
| 201 | Ga0495674_0000607 | 3300047319 | Bacteria | 33608 |
| 202 | Ga0495676_0053202 | 3300047321 | Bacteria | 3228 |
| 203 | Ga0495675_0000175 | 3300047444 | Bacteria | 46609 |
| 204 | Ga0495675_0011012 | 3300047444 | Bacteria | 5669 |
| 205 | Ga0495686_0036751 | 3300047472 | Bacteria | 3142 |
| 206 | Ga0495593_0084634 | 3300047673 | Bacteria | 1637 |
| 207 | Ga0495602_0002588 | 3300048088 | Bacteria | 18471 |
| 208 | Ga0495602_0005883 | 3300048088 | Bacteria | 12880 |
| 209 | Ga0495602_0102248 | 3300048088 | Bacteria | 2349 |
| 210 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 211 | Ga0496100_0000018 | 3300048903 | Bacteria | 162451 |
| 212 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 213 | Ga0496101_0000062 | 3300048904 | Bacteria | 126595 |
| 214 | Ga0496102_0010620 | 3300048905 | Bacteria | 7933 |
| 215 | Ga0496103_0116168 | 3300048906 | Bacteria | 1702 |
| 216 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 217 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 218 | Ga0496104_0000650 | 3300048907 | Bacteria | 29817 |
| 219 | Ga0496104_0083915 | 3300048907 | Bacteria | 3039 |
| 220 | Ga0496104_0163943 | 3300048907 | Bacteria | 2131 |
| 221 | Ga0496104_0732385 | 3300048907 | Bacteria | 896 |
| 222 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 223 | Ga0496105_0000007 | 3300048908 | Bacteria | 339658 |
| 224 | Ga0496105_0000347 | 3300048908 | Bacteria | 30490 |
| 225 | Ga0496106_0000061 | 3300048909 | Bacteria | 86524 |
| 226 | Ga0496106_0000122 | 3300048909 | Bacteria | 59816 |
| 227 | Ga0496106_0000312 | 3300048909 | Bacteria | 34208 |
| 228 | Ga0496107_0000006 | 3300048910 | Bacteria | 258746 |
| 229 | Ga0496107_0000013 | 3300048910 | Bacteria | 178284 |
| 230 | Ga0496107_0169588 | 3300048910 | Bacteria | 1619 |
| 231 | Ga0496108_0000062 | 3300048911 | Bacteria | 122391 |
| 232 | Ga0496108_0000187 | 3300048911 | Bacteria | 57568 |
| 233 | Ga0496108_0034278 | 3300048911 | Bacteria | 4217 |
| 234 | Ga0496108_0035606 | 3300048911 | Bacteria | 4139 |
| 235 | Ga0496108_0077852 | 3300048911 | Bacteria | 2806 |
| 236 | Ga0496108_0436960 | 3300048911 | Bacteria | 1143 |
| 237 | Ga0496109_0000121 | 3300048912 | Bacteria | 81487 |
| 238 | Ga0496109_0000129 | 3300048912 | Bacteria | 77469 |
| 239 | Ga0496109_0000611 | 3300048912 | Bacteria | 29848 |
| 240 | Ga0496109_0417691 | 3300048912 | Bacteria | 1267 |
| 241 | Ga0496110_0000089 | 3300048913 | Bacteria | 48723 |
| 242 | Ga0496110_0126161 | 3300048913 | Bacteria | 2309 |
| 243 | Ga0496111_0003847 | 3300048914 | Bacteria | 9377 |
| 244 | Ga0496112_0000006 | 3300048915 | Bacteria | 365227 |
| 245 | Ga0496112_0001770 | 3300048915 | Bacteria | 16950 |
| 246 | Ga0496113_0000628 | 3300048916 | Bacteria | 17756 |
| 247 | Ga0496113_0027889 | 3300048916 | Bacteria | 4054 |
| 248 | Ga0496113_0342264 | 3300048916 | Bacteria | 1199 |
| 249 | Ga0496116_0001565 | 3300048919 | Bacteria | 25265 |
| 250 | Ga0496117_0031120 | 3300048920 | Bacteria | 4080 |
| 251 | Ga0496118_0000818 | 3300048921 | Bacteria | 49518 |
| 252 | Ga0496118_0116358 | 3300048921 | Bacteria | 1757 |
| 253 | Ga0496118_0133060 | 3300048921 | Bacteria | 1592 |
| 254 | Ga0496119_0005786 | 3300048922 | Bacteria | 11703 |
| 255 | Ga0496119_0034494 | 3300048922 | Bacteria | 3331 |
| 256 | Ga0496119_0051890 | 3300048922 | Bacteria | 2516 |
| 257 | Ga0496120_0005134 | 3300048923 | Bacteria | 10578 |
| 258 | Ga0496120_0020754 | 3300048923 | Bacteria | 4167 |
| 259 | Ga0496120_0094721 | 3300048923 | Bacteria | 1589 |
| 260 | Ga0496121_0006714 | 3300048924 | Bacteria | 14134 |
| 261 | Ga0496121_0032232 | 3300048924 | Bacteria | 4768 |
| 262 | Ga0496121_0227112 | 3300048924 | Bacteria | 1310 |
| 263 | Ga0496124_0101149 | 3300048927 | Bacteria | 2336 |
| 264 | Ga0496126_0033929 | 3300048929 | Bacteria | 4799 |
| 265 | Ga0496126_0119743 | 3300048929 | Bacteria | 2284 |
| 266 | Ga0501033_0207355 | 3300049570 | Bacteria | 1398 |
| 267 | Ga0501034_0006426 | 3300049571 | Bacteria | 12656 |
| 268 | Ga0501034_0326870 | 3300049571 | Bacteria | 1465 |
| 269 | Ga0501034_0363318 | 3300049571 | Bacteria | 1374 |
| 270 | Ga0501037_0022414 | 3300049573 | Bacteria | 4671 |
| 271 | Ga0501038_0055974 | 3300049574 | Bacteria | 3387 |
| 272 | Ga0501042_0013041 | 3300049578 | Bacteria | 5649 |
| 273 | Ga0501042_0028770 | 3300049578 | Bacteria | 3919 |
| 274 | Ga0501043_0024076 | 3300049579 | Bacteria | 4778 |
| 275 | Ga0501043_0281172 | 3300049579 | Bacteria | 1275 |
| 276 | Ga0501046_0103920 | 3300049580 | Bacteria | 2177 |
| 277 | Ga0501047_0105786 | 3300049581 | Bacteria | 2694 |
| 278 | Ga0501047_0143970 | 3300049581 | Bacteria | 2261 |
| 279 | Ga0501047_0169949 | 3300049581 | Bacteria | 2049 |
| 280 | Ga0501048_0002374 | 3300049582 | Bacteria | 14372 |
| 281 | Ga0501067_0046470 | 3300049583 | Bacteria | 2410 |
| 282 | Ga0501070_0198373 | 3300049586 | Bacteria | 1648 |
| 283 | Ga0501074_0175872 | 3300049590 | Bacteria | 1527 |
| 284 | Ga0501075_0000990 | 3300049591 | Bacteria | 18117 |
| 285 | Ga0501079_0254199 | 3300049741 | Bacteria | 1373 |
| 286 | Ga0501080_0046434 | 3300049742 | Bacteria | 4043 |
| 287 | Ga0501080_0057677 | 3300049742 | Bacteria | 3615 |
| 288 | Ga0501083_0051840 | 3300049744 | Bacteria | 2758 |
| 289 | Ga0501083_0056200 | 3300049744 | Bacteria | 2638 |
| 290 | Ga0501044_0039969 | 3300049823 | Bacteria | 4890 |
| 291 | Ga0501045_0130629 | 3300049824 | Bacteria | 1867 |
| 292 | Ga0495601_0000013 | 3300053077 | Bacteria | 226476 |
| 293 | Ga0495601_0015708 | 3300053077 | Bacteria | 4578 |
| 294 | Ga0495601_0130978 | 3300053077 | Bacteria | 1633 |
| 295 | Ga0495612_0012406 | 3300053078 | Bacteria | 3435 |
| 296 | Ga0495612_0103938 | 3300053078 | Bacteria | 1211 |
| 297 | Ga0495595_0000003 | 3300053084 | Bacteria | 266465 |
| 298 | Ga0495619_0000031 | 3300053085 | Bacteria | 145508 |
| 299 | Ga0495619_0000257 | 3300053085 | Bacteria | 38653 |
| 300 | Ga0495619_0001230 | 3300053085 | Bacteria | 16755 |
| 301 | Ga0495619_0003554 | 3300053085 | Bacteria | 10055 |
| 302 | Ga0500658_0067203 | 3300053134 | Bacteria | 1505 |
| 303 | Ga0501084_0108581 | 3300054114 | Bacteria | 2331 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048907 | Ga0496104_0732385 | Ga0496104_0732385_57_797 | 238 |
| 2 | 3300049578 | Ga0501042_0028770 | Ga0501042_0028770_1649_2527 | 259 |
| 3 | 3300053077 | Ga0495601_0130978 | Ga0495601_0130978_273_1106 | 259 |
| 4 | 3300046460 | Ga0495638_0037786 | Ga0495638_0037786_1838_2737 | 260 |
| 5 | 3300046660 | Ga0495625_0000587 | Ga0495625_0000587_27929_28807 | 263 |
| 6 | 3300005985 | Ga0081539_10002609 | Ga0081539_100026096 | 264 |
| 7 | 3300005435 | Ga0070714_100071280 | Ga0070714_1000712802 | 265 |
| 8 | 3300006028 | Ga0070717_10000005 | Ga0070717_10000005159 | 265 |
| 9 | 3300025929 | Ga0207664_10000529 | Ga0207664_1000052913 | 265 |
| 10 | 3300044658 | Ga0466972_0173599 | Ga0466972_0173599_28_852 | 266 |
| 11 | 3300044693 | Ga0466961_0250836 | Ga0466961_0250836_245_1069 | 266 |
| 12 | 3300045976 | Ga0466967_0435645 | Ga0466967_0435645_437_1261 | 266 |
| 13 | 3300048911 | Ga0496108_0436960 | Ga0496108_0436960_157_1101 | 267 |
| 14 | 3300048907 | Ga0496104_0000650 | Ga0496104_0000650_23379_24278 | 268 |
| 15 | 3300048908 | Ga0496105_0000347 | Ga0496105_0000347_7449_8348 | 268 |
| 16 | 3300049571 | Ga0501034_0006426 | Ga0501034_0006426_6962_7870 | 268 |
| 17 | iso_pu_bacteria | 2818991462 | 2819691612 | 268 |
| 18 | iso_pu_bacteria | 2818991469 | 2819729608 | 268 |
| 19 | 3300044901 | Ga0466960_0000093 | Ga0466960_0000093_12485_13396 | 269 |
| 20 | 3300037466 | Ga0395898_0206037 | Ga0395898_0206037_19_876 | 270 |
| 21 | 3300038443 | Ga0395901_0058354 | Ga0395901_0058354_1927_2784 | 270 |
| 22 | 3300038443 | Ga0395901_0177417 | Ga0395901_0177417_184_1041 | 270 |
| 23 | 3300038443 | Ga0395901_0182160 | Ga0395901_0182160_109_966 | 270 |
| 24 | 3300044694 | Ga0466963_0090973 | Ga0466963_0090973_132_998 | 272 |
| 25 | 3300045976 | Ga0466967_0121411 | Ga0466967_0121411_1130_1972 | 272 |
| 26 | 3300005338 | Ga0068868_100461339 | Ga0068868_1004613391 | 274 |
| 27 | 3300009553 | Ga0105249_10156839 | Ga0105249_101568392 | 274 |
| 28 | 3300014326 | Ga0157380_10044551 | Ga0157380_100445512 | 274 |
| 29 | 3300025942 | Ga0207689_10082155 | Ga0207689_100821552 | 274 |
| 30 | 3300025961 | Ga0207712_10297123 | Ga0207712_102971232 | 274 |
| 31 | 3300026041 | Ga0207639_10196199 | Ga0207639_101961992 | 274 |
| 32 | 3300013306 | Ga0163162_10265894 | Ga0163162_102658942 | 275 |
| 33 | 3300045976 | Ga0466967_0721935 | Ga0466967_0721935_57_959 | 275 |
| 34 | 3300046455 | Ga0495603_0000333 | Ga0495603_0000333_23920_24825 | 275 |
| 35 | 3300047472 | Ga0495686_0036751 | Ga0495686_0036751_642_1613 | 275 |
| 36 | 3300014325 | Ga0163163_10255421 | Ga0163163_102554212 | 277 |
| 37 | 3300014969 | Ga0157376_10015687 | Ga0157376_100156876 | 277 |
| 38 | 3300005983 | Ga0081540_1000049 | Ga0081540_100004950 | 278 |
| 39 | 3300046514 | Ga0495618_0115330 | Ga0495618_0115330_634_1518 | 278 |
| 40 | 3300046516 | Ga0495628_0145089 | Ga0495628_0145089_255_1145 | 278 |
| 41 | 3300046517 | Ga0495630_0007275 | Ga0495630_0007275_3182_4072 | 278 |
| 42 | 3300046535 | Ga0495586_0114466 | Ga0495586_0114466_60_950 | 278 |
| 43 | 3300046535 | Ga0495586_0142853 | Ga0495586_0142853_358_1263 | 278 |
| 44 | 3300046642 | Ga0495634_0007615 | Ga0495634_0007615_3221_4102 | 278 |
| 45 | 3300046675 | Ga0495657_0055610 | Ga0495657_0055610_607_1497 | 278 |
| 46 | 3300046690 | Ga0495624_0039122 | Ga0495624_0039122_1008_1898 | 278 |
| 47 | 3300048911 | Ga0496108_0077852 | Ga0496108_0077852_24_917 | 278 |
| 48 | 3300048913 | Ga0496110_0126161 | Ga0496110_0126161_1375_2268 | 278 |
| 49 | 3300053077 | Ga0495601_0015708 | Ga0495601_0015708_732_1622 | 278 |
| 50 | 3300053078 | Ga0495612_0103938 | Ga0495612_0103938_196_1086 | 278 |
| 51 | 3300053085 | Ga0495619_0001230 | Ga0495619_0001230_3746_4636 | 278 |
| 52 | 3300005354 | Ga0070675_100377164 | Ga0070675_1003771642 | 279 |
| 53 | 3300013307 | Ga0157372_10001384 | Ga0157372_1000138416 | 279 |
| 54 | 3300046454 | Ga0495592_0221219 | Ga0495592_0221219_222_1103 | 279 |
| 55 | 3300048923 | Ga0496120_0005134 | Ga0496120_0005134_8310_9266 | 279 |
| 56 | 3300053085 | Ga0495619_0003554 | Ga0495619_0003554_6035_7051 | 279 |
| 57 | 3300005616 | Ga0068852_100133914 | Ga0068852_1001339141 | 280 |
| 58 | 3300026142 | Ga0207698_10660695 | Ga0207698_106606951 | 280 |
| 59 | 3300048909 | Ga0496106_0000312 | Ga0496106_0000312_2624_3532 | 280 |
| 60 | 3300048910 | Ga0496107_0169588 | Ga0496107_0169588_269_1177 | 280 |
| 61 | 3300048912 | Ga0496109_0417691 | Ga0496109_0417691_51_950 | 281 |
| 62 | 3300028379 | Ga0268266_10084487 | Ga0268266_100844872 | 282 |
| 63 | 3300047673 | Ga0495593_0084634 | Ga0495593_0084634_137_1117 | 282 |
| 64 | 3300048911 | Ga0496108_0035606 | Ga0496108_0035606_2107_3006 | 282 |
| 65 | 3300048912 | Ga0496109_0000129 | Ga0496109_0000129_69471_70370 | 282 |
| 66 | 3300049741 | Ga0501079_0254199 | Ga0501079_0254199_378_1292 | 282 |
| 67 | 3300005354 | Ga0070675_100000111 | Ga0070675_10000011111 | 283 |
| 68 | 3300005457 | Ga0070662_100000004 | Ga0070662_100000004101 | 283 |
| 69 | 3300009551 | Ga0105238_10000011 | Ga0105238_10000011166 | 283 |
| 70 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004456 | 283 |
| 71 | 3300025926 | Ga0207659_10000010 | Ga0207659_10000010108 | 283 |
| 72 | 3300025933 | Ga0207706_10000012 | Ga0207706_10000012117 | 283 |
| 73 | 3300005578 | Ga0068854_100000183 | Ga0068854_10000018329 | 284 |
| 74 | 3300005937 | Ga0081455_10008758 | Ga0081455_100087582 | 284 |
| 75 | 3300009098 | Ga0105245_10024675 | Ga0105245_100246754 | 284 |
| 76 | 3300014326 | Ga0157380_10000843 | Ga0157380_1000084313 | 284 |
| 77 | 3300025927 | Ga0207687_10027923 | Ga0207687_100279233 | 284 |
| 78 | 3300025981 | Ga0207640_10000200 | Ga0207640_100002009 | 284 |
| 79 | 3300046476 | Ga0495662_0018203 | Ga0495662_0018203_1586_2509 | 284 |
| 80 | 3300046512 | Ga0495610_0023820 | Ga0495610_0023820_1835_2740 | 284 |
| 81 | 3300048919 | Ga0496116_0001565 | Ga0496116_0001565_15154_16131 | 284 |
| 82 | 3300048922 | Ga0496119_0005786 | Ga0496119_0005786_9164_10141 | 284 |
| 83 | 3300048924 | Ga0496121_0006714 | Ga0496121_0006714_5413_6363 | 284 |
| 84 | 3300049744 | Ga0501083_0051840 | Ga0501083_0051840_435_1379 | 284 |
| 85 | 3300053078 | Ga0495612_0012406 | Ga0495612_0012406_1066_2037 | 284 |
| 86 | 3300053134 | Ga0500658_0067203 | Ga0500658_0067203_23_1015 | 284 |
| 87 | 3300032126 | Ga0307415_100003742 | Ga0307415_1000037425 | 285 |
| 88 | 3300048905 | Ga0496102_0010620 | Ga0496102_0010620_1265_2263 | 285 |
| 89 | 3300048906 | Ga0496103_0116168 | Ga0496103_0116168_513_1511 | 285 |
| 90 | 3300048920 | Ga0496117_0031120 | Ga0496117_0031120_1535_2533 | 285 |
| 91 | 3300048921 | Ga0496118_0000818 | Ga0496118_0000818_38325_39323 | 285 |
| 92 | 3300048921 | Ga0496118_0116358 | Ga0496118_0116358_143_1126 | 285 |
| 93 | 3300048921 | Ga0496118_0133060 | Ga0496118_0133060_427_1419 | 285 |
| 94 | 3300048924 | Ga0496121_0227112 | Ga0496121_0227112_315_1298 | 285 |
| 95 | 3300005365 | Ga0070688_100003353 | Ga0070688_1000033533 | 286 |
| 96 | 3300005466 | Ga0070685_10015192 | Ga0070685_100151923 | 286 |
| 97 | 3300044842 | Ga0466957_0021361 | Ga0466957_0021361_241_1170 | 286 |
| 98 | 3300046516 | Ga0495628_0018184 | Ga0495628_0018184_767_1720 | 286 |
| 99 | 3300046615 | Ga0495656_0004834 | Ga0495656_0004834_554_1492 | 286 |
| 100 | 3300046809 | Ga0495600_0016433 | Ga0495600_0016433_3033_3962 | 286 |
| 101 | 3300053077 | Ga0495601_0000013 | Ga0495601_0000013_89920_90849 | 286 |
| 102 | 3300005366 | Ga0070659_100159262 | Ga0070659_1001592622 | 287 |
| 103 | 3300025932 | Ga0207690_10123708 | Ga0207690_101237082 | 287 |
| 104 | 3300026078 | Ga0207702_10090900 | Ga0207702_100909003 | 287 |
| 105 | 3300046689 | Ga0495613_0000179 | Ga0495613_0000179_15629_16561 | 287 |
| 106 | 3300047317 | Ga0495604_0000357 | Ga0495604_0000357_4903_5832 | 287 |
| 107 | 3300048907 | Ga0496104_0083915 | Ga0496104_0083915_1806_2735 | 287 |
| 108 | 3300005344 | Ga0070661_100001375 | Ga0070661_1000013758 | 288 |
| 109 | 3300005347 | Ga0070668_100001695 | Ga0070668_1000016958 | 288 |
| 110 | 3300005367 | Ga0070667_100005090 | Ga0070667_1000050905 | 288 |
| 111 | 3300005436 | Ga0070713_100000390 | Ga0070713_1000003908 | 288 |
| 112 | 3300005548 | Ga0070665_100059195 | Ga0070665_1000591952 | 288 |
| 113 | 3300005578 | Ga0068854_100175322 | Ga0068854_1001753222 | 288 |
| 114 | 3300005614 | Ga0068856_100000757 | Ga0068856_1000007572 | 288 |
| 115 | 3300005719 | Ga0068861_100199652 | Ga0068861_1001996522 | 288 |
| 116 | 3300005843 | Ga0068860_100175443 | Ga0068860_1001754432 | 288 |
| 117 | 3300005844 | Ga0068862_100001210 | Ga0068862_10000121012 | 288 |
| 118 | 3300006175 | Ga0070712_100008485 | Ga0070712_1000084853 | 288 |
| 119 | 3300009098 | Ga0105245_10001150 | Ga0105245_100011509 | 288 |
| 120 | 3300009101 | Ga0105247_10000242 | Ga0105247_1000024235 | 288 |
| 121 | 3300009553 | Ga0105249_10013176 | Ga0105249_100131762 | 288 |
| 122 | 3300014968 | Ga0157379_10037861 | Ga0157379_100378611 | 288 |
| 123 | 3300014968 | Ga0157379_10133895 | Ga0157379_101338952 | 288 |
| 124 | 3300014969 | Ga0157376_10079843 | Ga0157376_100798433 | 288 |
| 125 | 3300025900 | Ga0207710_10000531 | Ga0207710_1000053112 | 288 |
| 126 | 3300025915 | Ga0207693_10006065 | Ga0207693_100060655 | 288 |
| 127 | 3300025920 | Ga0207649_10000009 | Ga0207649_10000009285 | 288 |
| 128 | 3300025927 | Ga0207687_10000013 | Ga0207687_1000001315 | 288 |
| 129 | 3300025928 | Ga0207700_10000027 | Ga0207700_10000027103 | 288 |
| 130 | 3300025961 | Ga0207712_10011553 | Ga0207712_100115532 | 288 |
| 131 | 3300025972 | Ga0207668_10002674 | Ga0207668_100026746 | 288 |
| 132 | 3300025981 | Ga0207640_10033780 | Ga0207640_100337802 | 288 |
| 133 | 3300025986 | Ga0207658_10032850 | Ga0207658_100328503 | 288 |
| 134 | 3300026078 | Ga0207702_10000060 | Ga0207702_1000006027 | 288 |
| 135 | 3300026118 | Ga0207675_100127284 | Ga0207675_1001272842 | 288 |
| 136 | 3300028379 | Ga0268266_10043788 | Ga0268266_100437883 | 288 |
| 137 | 3300028380 | Ga0268265_10008345 | Ga0268265_100083454 | 288 |
| 138 | 3300028381 | Ga0268264_10017683 | Ga0268264_100176834 | 288 |
| 139 | 3300044694 | Ga0466963_0196193 | Ga0466963_0196193_10_942 | 288 |
| 140 | 3300046684 | Ga0495669_0000033 | Ga0495669_0000033_2608_3540 | 288 |
| 141 | 3300047317 | Ga0495604_0215283 | Ga0495604_0215283_114_1046 | 288 |
| 142 | 3300048088 | Ga0495602_0002588 | Ga0495602_0002588_10461_11393 | 288 |
| 143 | 3300048907 | Ga0496104_0163943 | Ga0496104_0163943_303_1217 | 288 |
| 144 | 3300048922 | Ga0496119_0034494 | Ga0496119_0034494_96_1010 | 288 |
| 145 | 3300048924 | Ga0496121_0032232 | Ga0496121_0032232_1488_2402 | 288 |
| 146 | 3300048929 | Ga0496126_0033929 | Ga0496126_0033929_1929_2861 | 288 |
| 147 | 3300048929 | Ga0496126_0119743 | Ga0496126_0119743_45_986 | 288 |
| 148 | 3300049571 | Ga0501034_0363318 | Ga0501034_0363318_306_1235 | 288 |
| 149 | 3300049579 | Ga0501043_0281172 | Ga0501043_0281172_126_1055 | 288 |
| 150 | 3300049580 | Ga0501046_0103920 | Ga0501046_0103920_1154_2083 | 288 |
| 151 | 3300049591 | Ga0501075_0000990 | Ga0501075_0000990_13080_14003 | 288 |
| 152 | 3300049742 | Ga0501080_0057677 | Ga0501080_0057677_350_1279 | 288 |
| 153 | 3300049824 | Ga0501045_0130629 | Ga0501045_0130629_112_1041 | 288 |
| 154 | 3300005439 | Ga0070711_100002341 | Ga0070711_1000023416 | 289 |
| 155 | 3300005456 | Ga0070678_100480837 | Ga0070678_1004808372 | 289 |
| 156 | 3300005535 | Ga0070684_100060607 | Ga0070684_1000606072 | 289 |
| 157 | 3300005841 | Ga0068863_100006700 | Ga0068863_1000067008 | 289 |
| 158 | 3300009553 | Ga0105249_10000203 | Ga0105249_1000020312 | 289 |
| 159 | 3300011119 | Ga0105246_10040043 | Ga0105246_100400432 | 289 |
| 160 | 3300014326 | Ga0157380_10000253 | Ga0157380_100002537 | 289 |
| 161 | 3300014968 | Ga0157379_10015187 | Ga0157379_100151872 | 289 |
| 162 | 3300025916 | Ga0207663_10001197 | Ga0207663_100011976 | 289 |
| 163 | 3300025944 | Ga0207661_10002098 | Ga0207661_100020983 | 289 |
| 164 | 3300025961 | Ga0207712_10000007 | Ga0207712_10000007351 | 289 |
| 165 | 3300026088 | Ga0207641_10000405 | Ga0207641_1000040527 | 289 |
| 166 | 3300044694 | Ga0466963_0000001 | Ga0466963_0000001_28122_29045 | 289 |
| 167 | 3300046675 | Ga0495657_0003153 | Ga0495657_0003153_9810_10772 | 289 |
| 168 | 3300048903 | Ga0496100_0000002 | Ga0496100_0000002_338870_339817 | 289 |
| 169 | 3300048904 | Ga0496101_0000001 | Ga0496101_0000001_338870_339817 | 289 |
| 170 | 3300048907 | Ga0496104_0000009 | Ga0496104_0000009_225370_226317 | 289 |
| 171 | 3300048908 | Ga0496105_0000007 | Ga0496105_0000007_261739_262686 | 289 |
| 172 | 3300048909 | Ga0496106_0000061 | Ga0496106_0000061_11425_12372 | 289 |
| 173 | 3300048910 | Ga0496107_0000013 | Ga0496107_0000013_165914_166861 | 289 |
| 174 | 3300048915 | Ga0496112_0000006 | Ga0496112_0000006_340924_341853 | 289 |
| 175 | 3300005338 | Ga0068868_100001577 | Ga0068868_10000157714 | 290 |
| 176 | 3300005364 | Ga0070673_100001567 | Ga0070673_1000015678 | 290 |
| 177 | 3300005459 | Ga0068867_100165898 | Ga0068867_1001658982 | 290 |
| 178 | 3300005547 | Ga0070693_100014133 | Ga0070693_1000141333 | 290 |
| 179 | 3300013297 | Ga0157378_10042428 | Ga0157378_100424284 | 290 |
| 180 | 3300025960 | Ga0207651_10274754 | Ga0207651_102747542 | 290 |
| 181 | 3300026023 | Ga0207677_10001542 | Ga0207677_100015423 | 290 |
| 182 | 3300026089 | Ga0207648_10002260 | Ga0207648_1000226016 | 290 |
| 183 | 3300046461 | Ga0495641_0073815 | Ga0495641_0073815_287_1207 | 290 |
| 184 | 3300046683 | Ga0495658_0015784 | Ga0495658_0015784_2814_3737 | 290 |
| 185 | 3300048911 | Ga0496108_0034278 | Ga0496108_0034278_514_1431 | 290 |
| 186 | 3300048916 | Ga0496113_0027889 | Ga0496113_0027889_636_1553 | 290 |
| 187 | 3300005347 | Ga0070668_100012580 | Ga0070668_1000125803 | 291 |
| 188 | 3300005435 | Ga0070714_100393318 | Ga0070714_1003933182 | 291 |
| 189 | 3300005834 | Ga0068851_10017894 | Ga0068851_100178943 | 291 |
| 190 | 3300009093 | Ga0105240_10125841 | Ga0105240_101258413 | 291 |
| 191 | 3300009545 | Ga0105237_10344367 | Ga0105237_103443672 | 291 |
| 192 | 3300025321 | Ga0207656_10002156 | Ga0207656_100021564 | 291 |
| 193 | 3300025913 | Ga0207695_10098294 | Ga0207695_100982942 | 291 |
| 194 | 3300025929 | Ga0207664_10368302 | Ga0207664_103683021 | 291 |
| 195 | 3300046536 | Ga0495587_0003427 | Ga0495587_0003427_8662_9615 | 291 |
| 196 | 3300048088 | Ga0495602_0102248 | Ga0495602_0102248_911_1870 | 291 |
| 197 | 3300049586 | Ga0501070_0198373 | Ga0501070_0198373_125_1048 | 291 |
| 198 | 3300005337 | Ga0070682_100000117 | Ga0070682_10000011754 | 292 |
| 199 | 3300005337 | Ga0070682_100161833 | Ga0070682_1001618332 | 292 |
| 200 | 3300005365 | Ga0070688_100017896 | Ga0070688_1000178963 | 292 |
| 201 | 3300005466 | Ga0070685_10004176 | Ga0070685_100041763 | 292 |
| 202 | 3300005544 | Ga0070686_100059890 | Ga0070686_1000598902 | 292 |
| 203 | 3300005548 | Ga0070665_100050774 | Ga0070665_1000507743 | 292 |
| 204 | 3300005616 | Ga0068852_100000093 | Ga0068852_10000009311 | 292 |
| 205 | 3300006881 | Ga0068865_100001277 | Ga0068865_1000012773 | 292 |
| 206 | 3300009148 | Ga0105243_10107153 | Ga0105243_101071532 | 292 |
| 207 | 3300009176 | Ga0105242_10002871 | Ga0105242_100028713 | 292 |
| 208 | 3300013105 | Ga0157369_10000110 | Ga0157369_10000110104 | 292 |
| 209 | 3300013297 | Ga0157378_10031281 | Ga0157378_100312812 | 292 |
| 210 | 3300013308 | Ga0157375_10085412 | Ga0157375_100854122 | 292 |
| 211 | 3300025916 | Ga0207663_10202215 | Ga0207663_102022152 | 292 |
| 212 | 3300025934 | Ga0207686_10000468 | Ga0207686_1000046826 | 292 |
| 213 | 3300025935 | Ga0207709_10007242 | Ga0207709_100072422 | 292 |
| 214 | 3300025938 | Ga0207704_10000093 | Ga0207704_1000009342 | 292 |
| 215 | 3300026142 | Ga0207698_10000440 | Ga0207698_1000044013 | 292 |
| 216 | 3300028379 | Ga0268266_10005034 | Ga0268266_100050349 | 292 |
| 217 | 3300041491 | Ga0451833_0468266 | Ga0451833_0468266_280_1203 | 292 |
| 218 | 3300046459 | Ga0495629_0005201 | Ga0495629_0005201_2628_3605 | 292 |
| 219 | 3300046461 | Ga0495641_0017016 | Ga0495641_0017016_1860_2831 | 292 |
| 220 | 3300046507 | Ga0495606_0000565 | Ga0495606_0000565_41224_42201 | 292 |
| 221 | 3300046511 | Ga0495608_0000068 | Ga0495608_0000068_72451_73380 | 292 |
| 222 | 3300046516 | Ga0495628_0032736 | Ga0495628_0032736_2468_3427 | 292 |
| 223 | 3300046517 | Ga0495630_0000056 | Ga0495630_0000056_83336_84268 | 292 |
| 224 | 3300046529 | Ga0495652_0000546 | Ga0495652_0000546_27941_28864 | 292 |
| 225 | 3300046674 | Ga0495588_0000165 | Ga0495588_0000165_6916_7926 | 292 |
| 226 | 3300046675 | Ga0495657_0000004 | Ga0495657_0000004_116200_117129 | 292 |
| 227 | 3300046681 | Ga0495647_0000018 | Ga0495647_0000018_15320_16282 | 292 |
| 228 | 3300046681 | Ga0495647_0000904 | Ga0495647_0000904_6491_7450 | 292 |
| 229 | 3300046690 | Ga0495624_0000073 | Ga0495624_0000073_44005_44937 | 292 |
| 230 | 3300047321 | Ga0495676_0053202 | Ga0495676_0053202_1113_2030 | 292 |
| 231 | 3300047444 | Ga0495675_0000175 | Ga0495675_0000175_43037_43966 | 292 |
| 232 | 3300048903 | Ga0496100_0000018 | Ga0496100_0000018_141995_142912 | 292 |
| 233 | 3300048904 | Ga0496101_0000062 | Ga0496101_0000062_50315_51232 | 292 |
| 234 | 3300048907 | Ga0496104_0000004 | Ga0496104_0000004_245511_246455 | 292 |
| 235 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_395376_396320 | 292 |
| 236 | 3300048909 | Ga0496106_0000122 | Ga0496106_0000122_56289_57206 | 292 |
| 237 | 3300048910 | Ga0496107_0000006 | Ga0496107_0000006_210918_211835 | 292 |
| 238 | 3300048911 | Ga0496108_0000062 | Ga0496108_0000062_117157_118089 | 292 |
| 239 | 3300048912 | Ga0496109_0000121 | Ga0496109_0000121_65356_66288 | 292 |
| 240 | 3300048913 | Ga0496110_0000089 | Ga0496110_0000089_2656_3585 | 292 |
| 241 | 3300048914 | Ga0496111_0003847 | Ga0496111_0003847_1557_2486 | 292 |
| 242 | 3300048915 | Ga0496112_0001770 | Ga0496112_0001770_7598_8530 | 292 |
| 243 | 3300048916 | Ga0496113_0000628 | Ga0496113_0000628_9231_10163 | 292 |
| 244 | 3300048916 | Ga0496113_0342264 | Ga0496113_0342264_138_1076 | 292 |
| 245 | 3300048922 | Ga0496119_0051890 | Ga0496119_0051890_660_1604 | 292 |
| 246 | 3300048923 | Ga0496120_0020754 | Ga0496120_0020754_1180_2124 | 292 |
| 247 | 3300049581 | Ga0501047_0143970 | Ga0501047_0143970_104_1030 | 292 |
| 248 | 3300049742 | Ga0501080_0046434 | Ga0501080_0046434_2266_3219 | 292 |
| 249 | 3300053084 | Ga0495595_0000003 | Ga0495595_0000003_116200_117129 | 292 |
| 250 | 3300053085 | Ga0495619_0000031 | Ga0495619_0000031_89786_90715 | 292 |
| 251 | 3300053085 | Ga0495619_0000257 | Ga0495619_0000257_2615_3544 | 292 |
| 252 | 3300005456 | Ga0070678_100348125 | Ga0070678_1003481252 | 293 |
| 253 | 3300005548 | Ga0070665_100118283 | Ga0070665_1001182832 | 293 |
| 254 | 3300005840 | Ga0068870_10060843 | Ga0068870_100608432 | 293 |
| 255 | 3300009098 | Ga0105245_10001831 | Ga0105245_100018317 | 293 |
| 256 | 3300009101 | Ga0105247_10088738 | Ga0105247_100887382 | 293 |
| 257 | 3300009101 | Ga0105247_10108527 | Ga0105247_101085272 | 293 |
| 258 | 3300009551 | Ga0105238_10289854 | Ga0105238_102898542 | 293 |
| 259 | 3300025900 | Ga0207710_10073683 | Ga0207710_100736832 | 293 |
| 260 | 3300025914 | Ga0207671_10220143 | Ga0207671_102201432 | 293 |
| 261 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007380 | 293 |
| 262 | 3300026116 | Ga0207674_10129673 | Ga0207674_101296732 | 293 |
| 263 | 3300028379 | Ga0268266_10000285 | Ga0268266_100002852 | 293 |
| 264 | 3300046533 | Ga0495640_0070585 | Ga0495640_0070585_826_1788 | 293 |
| 265 | 3300047319 | Ga0495674_0000607 | Ga0495674_0000607_3740_4702 | 293 |
| 266 | 3300048923 | Ga0496120_0094721 | Ga0496120_0094721_637_1575 | 293 |
| 267 | 3300049578 | Ga0501042_0013041 | Ga0501042_0013041_4622_5557 | 293 |
| 268 | 3300049583 | Ga0501067_0046470 | Ga0501067_0046470_448_1401 | 293 |
| 269 | 3300005367 | Ga0070667_100079255 | Ga0070667_1000792552 | 294 |
| 270 | 3300005367 | Ga0070667_100135909 | Ga0070667_1001359092 | 294 |
| 271 | 3300005535 | Ga0070684_100011369 | Ga0070684_1000113691 | 294 |
| 272 | 3300005543 | Ga0070672_100000015 | Ga0070672_10000001519 | 294 |
| 273 | 3300005564 | Ga0070664_100449600 | Ga0070664_1004496002 | 294 |
| 274 | 3300009177 | Ga0105248_10000008 | Ga0105248_10000008358 | 294 |
| 275 | 3300013104 | Ga0157370_10128059 | Ga0157370_101280592 | 294 |
| 276 | 3300025940 | Ga0207691_10000044 | Ga0207691_1000004444 | 294 |
| 277 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006752 | 294 |
| 278 | 3300025945 | Ga0207679_10263672 | Ga0207679_102636722 | 294 |
| 279 | 3300025986 | Ga0207658_10065171 | Ga0207658_100651713 | 294 |
| 280 | 3300028379 | Ga0268266_10116648 | Ga0268266_101166482 | 294 |
| 281 | 3300045976 | Ga0466967_0000009 | Ga0466967_0000009_52003_52965 | 294 |
| 282 | 3300048927 | Ga0496124_0101149 | Ga0496124_0101149_54_995 | 294 |
| 283 | 3300049570 | Ga0501033_0207355 | Ga0501033_0207355_140_1105 | 294 |
| 284 | 3300049571 | Ga0501034_0326870 | Ga0501034_0326870_361_1323 | 294 |
| 285 | 3300049573 | Ga0501037_0022414 | Ga0501037_0022414_274_1236 | 294 |
| 286 | 3300049574 | Ga0501038_0055974 | Ga0501038_0055974_1264_2229 | 294 |
| 287 | 3300049579 | Ga0501043_0024076 | Ga0501043_0024076_654_1616 | 294 |
| 288 | 3300049581 | Ga0501047_0105786 | Ga0501047_0105786_1306_2259 | 294 |
| 289 | 3300049581 | Ga0501047_0169949 | Ga0501047_0169949_831_1766 | 294 |
| 290 | 3300049582 | Ga0501048_0002374 | Ga0501048_0002374_1331_2293 | 294 |
| 291 | 3300049744 | Ga0501083_0056200 | Ga0501083_0056200_595_1557 | 294 |
| 292 | 3300049823 | Ga0501044_0039969 | Ga0501044_0039969_3786_4751 | 294 |
| 293 | 3300054114 | Ga0501084_0108581 | Ga0501084_0108581_520_1482 | 294 |
| 294 | 3300047444 | Ga0495675_0011012 | Ga0495675_0011012_2196_3137 | 295 |
| 295 | 3300013297 | Ga0157378_10024610 | Ga0157378_100246103 | 297 |
| 296 | 3300046516 | Ga0495628_0000190 | Ga0495628_0000190_49944_50930 | 297 |
| 297 | 3300048088 | Ga0495602_0005883 | Ga0495602_0005883_5167_6153 | 297 |
| 298 | 3300025942 | Ga0207689_10376461 | Ga0207689_103764612 | 298 |
| 299 | 3300049590 | Ga0501074_0175872 | Ga0501074_0175872_70_1014 | 299 |
| 300 | 3300005530 | Ga0070679_100009133 | Ga0070679_1000091332 | 300 |
| 301 | 3300025921 | Ga0207652_10023267 | Ga0207652_100232673 | 300 |
| 302 | 3300026067 | Ga0207678_10017704 | Ga0207678_100177043 | 300 |
| 303 | 3300048911 | Ga0496108_0000187 | Ga0496108_0000187_21807_22760 | 300 |
| 304 | 3300048912 | Ga0496109_0000611 | Ga0496109_0000611_7302_8255 | 300 |
| 305 | 3300002239 | JGI24034J26672_10000136 | JGI24034J26672_100001368 | 306 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3wew-assembly1.cif.gz_A | crystal structure of htdx (rv0241c) of mycobacterium tuberculosis at 2.4 a resolution | 0.962 | 44 | 289 |
| 3wew-assembly1.cif.gz_A | crystal structure of htdx (rv0241c) of mycobacterium tuberculosis at 2.4 a resolution | 0.9539 | 44 | 289 |
| 4oob-assembly1.cif.gz_A | crystal structure of htdx(rv0241c) from mycobacterium tuberculosis | 0.8933 | 46 | 289 |
| 4oob-assembly1.cif.gz_A | crystal structure of htdx(rv0241c) from mycobacterium tuberculosis | 0.8827 | 46 | 289 |
| 8psm-assembly1.cif.gz_G | asymmetric unit of the yeast fatty acid synthase in the non-rotated state with acp at the malonyl/palmitoyl transferase domain (fasx sample) | 0.8322 | 44 | 291 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4oobA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8933 | 46 | 289 | 3.10.129.10 |
| 4oobA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8827 | 46 | 289 | 3.10.129.10 |
| af_Q9W439_57_173_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8573 | 243 | 286 | 3.10.129.10 |
| 2gf6D00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8463 | 101 | 159 | 3.10.129.10 |
| af_Q2G0K1_2_118_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8459 | 46 | 160 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I1IPB5-F1-model_v4 | deleted | 0.9715 | 172 | 289 |
|
| AF-A0A6I1IPB5-F1-model_v4 | deleted | 0.9633 | 172 | 289 |
|
| AF-A0A7V8ZLL3-F1-model_v4 | MaoC-like domain-containing protein | 0.9593 | 1 | 294 |
|
| AF-A0A2W4IWE0-F1-model_v4 | MaoC-like domain-containing protein | 0.9544 | 42 | 287 |
GO:0004312
GO:0005835 GO:0006633 |
| AF-A0A7V8ZLL3-F1-model_v4 | MaoC-like domain-containing protein | 0.9466 | 1 | 294 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar