F397925

General Info

Members Datasets Scaffolds Average Seq Length
305 159 610 136

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100028579|Ga0070683_1000285795
Length 148
Sequence MVTPAERRRLKPMNYFLAKSEPAVYSIDDLQRDKKTTWDGVINAQAVKNIRDMRPGDRVFIYHSGGVSAIVGLATVRSAPRDDAKNPKSAVVELEYLGRIDPPATLAEIKSSKKFEDWALVRQSRLSTMAAPESFVAWMRSKYLGAKI

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
97 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
98 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
148 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
149 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
150 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
151 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 1.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 0.66
Rhizosphere 98.69
Stem 0
Stem Tuber 0
Unclassified 37.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100028579 3300005329 Bacteria 5040
2 Ga0070658_10265433 3300005327 Bacteria 1459
3 Ga0070683_100000005 3300005329 Bacteria 361724
4 Ga0070683_100010831 3300005329 Bacteria 7849
5 Ga0070683_100096387 3300005329 Bacteria 2782
6 Ga0070683_100120921 3300005329 Bacteria 2474
7 Ga0070683_101852114 3300005329 Unclassified 580
8 Ga0070682_100479587 3300005337 Bacteria 959
9 Ga0070660_100421763 3300005339 Bacteria 1105
10 Ga0070674_100142476 3300005356 Bacteria 1800
11 Ga0070673_100723994 3300005364 Unclassified 915
12 Ga0070673_101180633 3300005364 Bacteria 717
13 Ga0070709_10017692 3300005434 Bacteria 4093
14 Ga0070709_10480201 3300005434 Unclassified 941
15 Ga0070714_100008855 3300005435 Bacteria 7872
16 Ga0070714_100559439 3300005435 Unclassified 1095
17 Ga0070713_100000494 3300005436 Bacteria 25196
18 Ga0070713_100011536 3300005436 Bacteria 6440
19 Ga0070713_100287120 3300005436 Bacteria 1511
20 Ga0070713_102212924 3300005436 Unclassified 533
21 Ga0070710_10251555 3300005437 Unclassified 1136
22 Ga0070710_10978710 3300005437 Unclassified 615
23 Ga0070711_100055495 3300005439 Bacteria 2737
24 Ga0070711_100664166 3300005439 Unclassified 875
25 Ga0070708_102116045 3300005445 Unclassified 520
26 Ga0070662_101734656 3300005457 Unclassified 539
27 Ga0068867_100122910 3300005459 Bacteria 2008
28 Ga0068867_100321583 3300005459 Bacteria 1282
29 Ga0070684_100000053 3300005535 Bacteria 77715
30 Ga0070684_100040384 3300005535 Bacteria 4017
31 Ga0070684_100212037 3300005535 Bacteria 1765
32 Ga0070684_100509233 3300005535 Unclassified 1115
33 Ga0070684_100974799 3300005535 Bacteria 795
34 Ga0068853_100660146 3300005539 Unclassified 996
35 Ga0070672_100303721 3300005543 Bacteria 1353
36 Ga0070695_100020747 3300005545 Bacteria 4014
37 Ga0070693_100676259 3300005547 Unclassified 753
38 Ga0070665_100125479 3300005548 Unclassified 2569
39 Ga0070665_100330134 3300005548 Bacteria 1530
40 Ga0070665_100688701 3300005548 Unclassified 1035
41 Ga0070665_101323189 3300005548 Unclassified 730
42 Ga0070665_102186331 3300005548 Bacteria 557
43 Ga0068855_100121004 3300005563 Bacteria 2996
44 Ga0070664_100949746 3300005564 Unclassified 807
45 Ga0068856_101102013 3300005614 Bacteria 811
46 Ga0068852_100061579 3300005616 Bacteria 3262
47 Ga0068864_100411701 3300005618 Unclassified 1286
48 Ga0068861_100192167 3300005719 Bacteria 1707
49 Ga0068870_10959580 3300005840 Unclassified 607
50 Ga0068863_100030718 3300005841 Bacteria 5130
51 Ga0068863_100812853 3300005841 Unclassified 933
52 Ga0068858_100020437 3300005842 Bacteria 6191
53 Ga0068858_100569947 3300005842 Unclassified 1097
54 Ga0068858_100790923 3300005842 Unclassified 925
55 Ga0068860_100560615 3300005843 Bacteria 1145
56 Ga0068860_100661403 3300005843 Bacteria 1053
57 Ga0068860_100905746 3300005843 Archaea 898
58 Ga0068860_101968178 3300005843 Unclassified 606
59 Ga0070717_10148641 3300006028 Bacteria 2026
60 Ga0070716_100653252 3300006173 Unclassified 798
61 Ga0097621_100338212 3300006237 Bacteria 1336
62 Ga0068865_100183377 3300006881 Bacteria 1613
63 Ga0075435_100614103 3300007076 Unclassified 943
64 Ga0105240_10000632 3300009093 Bacteria 64968
65 Ga0105240_10001383 3300009093 Bacteria 41701
66 Ga0105240_10072456 3300009093 Bacteria 4258
67 Ga0105240_10080158 3300009093 Bacteria 4016
68 Ga0105240_10162592 3300009093 Bacteria 2650
69 Ga0105240_10189791 3300009093 Bacteria 2417
70 Ga0105240_11106080 3300009093 Bacteria 843
71 Ga0105240_11469082 3300009093 Bacteria 715
72 Ga0105245_10464740 3300009098 Bacteria 1276
73 Ga0105245_10686253 3300009098 Bacteria 1056
74 Ga0105247_10328654 3300009101 Unclassified 1069
75 Ga0105243_10106301 3300009148 Bacteria 2339
76 Ga0105243_11598108 3300009148 Unclassified 678
77 Ga0105241_10787310 3300009174 Unclassified 875
78 Ga0105241_12072049 3300009174 Unclassified 561
79 Ga0105241_12145442 3300009174 Unclassified 553
80 Ga0105242_10012086 3300009176 Bacteria 6642
81 Ga0105242_10016028 3300009176 Bacteria 5822
82 Ga0105242_10126981 3300009176 Unclassified 2196
83 Ga0105242_10468452 3300009176 Bacteria 1191
84 Ga0105248_10023114 3300009177 Bacteria 6905
85 Ga0105248_10049544 3300009177 Bacteria 4711
86 Ga0105248_10123879 3300009177 Bacteria 2915
87 Ga0105248_10193666 3300009177 Unclassified 2291
88 Ga0105248_12322892 3300009177 Unclassified 611
89 Ga0105237_10008899 3300009545 Bacteria 10819
90 Ga0105237_10260460 3300009545 Bacteria 1737
91 Ga0105237_10309939 3300009545 Bacteria 1582
92 Ga0105237_10698607 3300009545 Unclassified 1021
93 Ga0105237_10907768 3300009545 Unclassified 888
94 Ga0105237_11328154 3300009545 Unclassified 725
95 Ga0105238_10346272 3300009551 Unclassified 1475
96 Ga0105238_10349110 3300009551 Bacteria 1468
97 Ga0105238_10690511 3300009551 Unclassified 1032
98 Ga0105249_10023847 3300009553 Bacteria 5495
99 Ga0105249_10394139 3300009553 Bacteria 1413
100 Ga0105239_10353500 3300010375 Bacteria 1659
101 Ga0105239_10530347 3300010375 Unclassified 1340
102 Ga0105239_10619318 3300010375 Bacteria 1235
103 Ga0105246_10064288 3300011119 Bacteria 2563
104 Ga0105246_10110678 3300011119 Bacteria 2017
105 Ga0157373_10863110 3300013100 Bacteria 670
106 Ga0157370_10244843 3300013104 Unclassified 1659
107 Ga0157370_11709284 3300013104 Unclassified 565
108 Ga0157369_10384857 3300013105 Bacteria 1456
109 Ga0157369_11011090 3300013105 Bacteria 851
110 Ga0157374_10094483 3300013296 Bacteria 2857
111 Ga0157374_10864287 3300013296 Unclassified 921
112 Ga0157378_10972751 3300013297 Unclassified 882
113 Ga0157372_10830251 3300013307 Unclassified 1073
114 Ga0157372_11380088 3300013307 Bacteria 812
115 Ga0157375_10311228 3300013308 Bacteria 1739
116 Ga0157375_10357398 3300013308 Bacteria 1627
117 Ga0157376_11196776 3300014969 Unclassified 788
118 Ga0157376_12377985 3300014969 Unclassified 569
119 Ga0228598_1022289 3300024227 Unclassified 1246
120 Ga0228598_1074189 3300024227 Unclassified 681
121 Ga0207699_10076930 3300025906 Bacteria 2057
122 Ga0207699_10889129 3300025906 Bacteria 657
123 Ga0207699_11141240 3300025906 Unclassified 577
124 Ga0207699_11352576 3300025906 Unclassified 527
125 Ga0207705_10692691 3300025909 Bacteria 792
126 Ga0207654_10878920 3300025911 Unclassified 649
127 Ga0207695_10186185 3300025913 Unclassified 1995
128 Ga0207695_10900670 3300025913 Bacteria 764
129 Ga0207671_10699584 3300025914 Bacteria 806
130 Ga0207671_11024725 3300025914 Unclassified 650
131 Ga0207663_10020340 3300025916 Bacteria 3757
132 Ga0207657_10368196 3300025919 Bacteria 1132
133 Ga0207694_10321845 3300025924 Bacteria 1276
134 Ga0207694_10485261 3300025924 Unclassified 1034
135 Ga0207700_10001995 3300025928 Bacteria 11639
136 Ga0207700_10004047 3300025928 Bacteria 8588
137 Ga0207664_10015102 3300025929 Bacteria 5595
138 Ga0207706_11650152 3300025933 Unclassified 518
139 Ga0207686_10012697 3300025934 Bacteria 4637
140 Ga0207686_10180274 3300025934 Bacteria 1497
141 Ga0207686_10275220 3300025934 Bacteria 1240
142 Ga0207686_10295179 3300025934 Unclassified 1202
143 Ga0207709_10101179 3300025935 Bacteria 1906
144 Ga0207704_10802596 3300025938 Bacteria 786
145 Ga0207665_10897755 3300025939 Unclassified 703
146 Ga0207711_10066538 3300025941 Bacteria 3116
147 Ga0207711_10766911 3300025941 Bacteria 899
148 Ga0207711_11042758 3300025941 Unclassified 758
149 Ga0207689_10215176 3300025942 Unclassified 1588
150 Ga0207689_10541883 3300025942 Unclassified 977
151 Ga0207661_10000031 3300025944 Bacteria 164429
152 Ga0207661_10081049 3300025944 Unclassified 2680
153 Ga0207661_10082791 3300025944 Bacteria 2654
154 Ga0207651_11182930 3300025960 Unclassified 686
155 Ga0207712_10017890 3300025961 Bacteria 4611
156 Ga0207712_10259404 3300025961 Bacteria 1409
157 Ga0207703_10027666 3300026035 Unclassified 4465
158 Ga0207703_10644089 3300026035 Bacteria 1005
159 Ga0207639_10372194 3300026041 Bacteria 1281
160 Ga0207641_10016406 3300026088 Bacteria 6065
161 Ga0207641_10796441 3300026088 Unclassified 935
162 Ga0207648_10156768 3300026089 Bacteria 2010
163 Ga0207648_10562943 3300026089 Unclassified 1048
164 Ga0207676_10426440 3300026095 Unclassified 1245
165 Ga0207675_100131463 3300026118 Bacteria 2374
166 Ga0207698_10115292 3300026142 Bacteria 2262
167 Ga0268266_10286540 3300028379 Bacteria 1533
168 Ga0268266_10342684 3300028379 Unclassified 1403
169 Ga0268264_10477898 3300028381 Bacteria 1212
170 Ga0268264_10487063 3300028381 Bacteria 1200
171 Ga0268264_11566344 3300028381 Unclassified 670
172 Ga0265770_1005644 3300030878 Unclassified 1732
173 Ga0265770_1005818 3300030878 Bacteria 1705
174 Ga0265760_10037577 3300031090 Unclassified 1438
175 Ga0265760_10082639 3300031090 Bacteria 997
176 Ga0265760_10218001 3300031090 Unclassified 650
177 Ga0265325_10012280 3300031241 Unclassified 4900
178 Ga0265340_10058881 3300031247 Bacteria 1844
179 Ga0265331_10052623 3300031250 Bacteria 1944
180 Ga0265316_10004502 3300031344 Bacteria 13846
181 Ga0265316_10051510 3300031344 Bacteria 3234
182 Ga0265314_10000776 3300031711 Bacteria 37903
183 Ga0265314_10034698 3300031711 Bacteria 3682
184 Ga0265342_10183147 3300031712 Unclassified 1146
185 Ga0307413_10730329 3300031824 Bacteria 826
186 Ga0307406_11885119 3300031901 Bacteria 533
187 Ga0373926_0079883 3300035083 Bacteria 1209
188 Ga0373926_0144293 3300035083 Bacteria 905
189 Ga0373934_0016943 3300035086 Bacteria 2775
190 Ga0373934_0069179 3300035086 Unclassified 1411
191 Ga0373923_0006778 3300035111 Bacteria 3984
192 Ga0373953_0063963 3300035117 Bacteria 1508
193 Ga0373953_0242885 3300035117 Unclassified 782
194 Ga0373954_0000830 3300035118 Bacteria 11985
195 Ga0373954_0012728 3300035118 Bacteria 3745
196 Ga0373954_0146225 3300035118 Bacteria 1154
197 Ga0373956_0078274 3300035119 Bacteria 1514
198 Ga0373956_0368807 3300035119 Unclassified 685
199 Ga0373957_0024221 3300035120 Bacteria 2178
200 Ga0373957_0528948 3300035120 Unclassified 515
201 Ga0373943_0304673 3300035170 Unclassified 905
202 Ga0373943_0879374 3300035170 Unclassified 535
203 Ga0373955_0040649 3300035172 Bacteria 2488
204 Ga0373955_0201864 3300035172 Unclassified 1184
205 Ga0373935_0031808 3300035692 Bacteria 3277
206 Ga0373935_0099509 3300035692 Bacteria 1915
207 Ga0373927_0001587 3300035695 Bacteria 17055
208 Ga0373927_0002104 3300035695 Bacteria 14694
209 Ga0373927_0051840 3300035695 Bacteria 2654
210 Ga0373927_0657688 3300035695 Unclassified 692
211 Ga0373927_0685911 3300035695 Bacteria 677
212 Ga0373933_0008817 3300035724 Bacteria 5498
213 Ga0373933_0534777 3300035724 Bacteria 769
214 Ga0373933_1030206 3300035724 Unclassified 542
215 Ga0373937_0010133 3300036401 Bacteria 8222
216 Ga0373937_0024338 3300036401 Bacteria 5459
217 Ga0373937_0140033 3300036401 Unclassified 2263
218 Ga0373937_0238667 3300036401 Bacteria 1712
219 Ga0373937_0747889 3300036401 Bacteria 925
220 Ga0373937_1100224 3300036401 Bacteria 743
221 Ga0373925_0027524 3300037068 Bacteria 4160
222 Ga0373925_0064444 3300037068 Bacteria 2758
223 Ga0373925_0646586 3300037068 Bacteria 871
224 Ga0373925_0893536 3300037068 Unclassified 732
225 Ga0373925_1211246 3300037068 Unclassified 620
226 Ga0436361_1190473 3300039447 Unclassified 1100
227 Ga0451853_1916786 3300041512 Unclassified 730
228 Ga0453684_0460004 3300044712 Bacteria 1415
229 Ga0451576_0250221 3300045051 Bacteria 1852
230 Ga0451576_0413533 3300045051 Bacteria 1415
231 Ga0495592_0075482 3300046454 Bacteria 2448
232 Ga0495651_0064344 3300046462 Bacteria 2803
233 Ga0495651_0253872 3300046462 Unclassified 1199
234 Ga0495651_0719737 3300046462 Unclassified 621
235 Ga0495653_0204553 3300046463 Bacteria 1338
236 Ga0495580_0001837 3300046472 Bacteria 18662
237 Ga0495580_0082246 3300046472 Bacteria 2244
238 Ga0495639_0094260 3300046475 Bacteria 1408
239 Ga0495662_0011338 3300046476 Bacteria 4356
240 Ga0495608_0137478 3300046511 Bacteria 1561
241 Ga0495608_0172817 3300046511 Bacteria 1370
242 Ga0495618_0076883 3300046514 Bacteria 2127
243 Ga0495628_0078277 3300046516 Bacteria 2571
244 Ga0495628_0408258 3300046516 Unclassified 991
245 Ga0495630_0032261 3300046517 Bacteria 3902
246 Ga0495630_0083024 3300046517 Bacteria 2419
247 Ga0495630_1055376 3300046517 Unclassified 617
248 Ga0495652_0038463 3300046529 Bacteria 4145
249 Ga0495652_0252678 3300046529 Bacteria 1305
250 Ga0495665_0043856 3300046531 Bacteria 2378
251 Ga0495640_0063303 3300046533 Bacteria 2506
252 Ga0495586_0136974 3300046535 Unclassified 1373
253 Ga0495586_0762429 3300046535 Unclassified 558
254 Ga0495587_0047818 3300046536 Bacteria 2536
255 Ga0495587_0175300 3300046536 Bacteria 1217
256 Ga0495587_0705726 3300046536 Bacteria 553
257 Ga0495645_0032542 3300046543 Bacteria 3804
258 Ga0495645_0103913 3300046543 Bacteria 2018
259 Ga0495667_0975816 3300046559 Unclassified 517
260 Ga0495634_0071442 3300046642 Bacteria 2285
261 Ga0495635_0040758 3300046663 Bacteria 3208
262 Ga0495635_0284347 3300046663 Unclassified 1111
263 Ga0495599_0024111 3300046678 Bacteria 3805
264 Ga0495623_0494651 3300046679 Bacteria 646
265 Ga0495658_0920662 3300046683 Unclassified 559
266 Ga0495624_0091013 3300046690 Unclassified 1882
267 Ga0495600_0016821 3300046809 Bacteria 4649
268 Ga0495600_0151790 3300046809 Bacteria 1499
269 Ga0495600_0522991 3300046809 Unclassified 727
270 Ga0495581_0805274 3300047315 Unclassified 539
271 Ga0495604_0071105 3300047317 Bacteria 2633
272 Ga0495604_0543857 3300047317 Unclassified 749
273 Ga0495604_0963730 3300047317 Unclassified 530
274 Ga0495674_0045342 3300047319 Bacteria 3904
275 Ga0495674_0173617 3300047319 Unclassified 1797
276 Ga0495674_0181193 3300047319 Bacteria 1754
277 Ga0495674_0209134 3300047319 Unclassified 1617
278 Ga0495674_0300023 3300047319 Bacteria 1312
279 Ga0495674_1198359 3300047319 Bacteria 574
280 Ga0495680_0314829 3300047322 Unclassified 1096
281 Ga0495675_0054460 3300047444 Bacteria 2538
282 Ga0495675_0068014 3300047444 Bacteria 2251
283 Ga0495675_0386774 3300047444 Unclassified 817
284 Ga0495675_0405610 3300047444 Unclassified 794
285 Ga0495684_0001690 3300047471 Bacteria 17741
286 Ga0495684_0030021 3300047471 Bacteria 4174
287 Ga0495684_0313906 3300047471 Bacteria 1122
288 Ga0495684_0556266 3300047471 Bacteria 780
289 Ga0495593_0358512 3300047673 Unclassified 729
290 Ga0496104_0511506 3300048907 Unclassified 1112
291 Ga0496110_1896631 3300048913 Unclassified 506
292 Ga0501233_097888 3300049668 Bacteria 773
293 Ga0501249_033281 3300049679 Bacteria 1154
294 Ga0501259_064380 3300049688 Bacteria 773
295 Ga0501268_166024 3300049765 Bacteria 518
296 Ga0501280_058791 3300049776 Bacteria 664
297 nmdc:mga0qj67_377477_c1 3300050509 Unclassified 1145
298 nmdc:mga0rr50_1001075_c1 3300050513 Unclassified 712
299 Ga0495601_0103725 3300053077 Bacteria 1838
300 Ga0495601_0794518 3300053077 Bacteria 601
301 Ga0495595_0356306 3300053084 Unclassified 739
302 Ga0495619_0684543 3300053085 Unclassified 698
303 Ga0500568_0001619 3300053139 Bacteria 14190
304 Ga0501082_0001335 3300060353 Bacteria 21627
305 Ga0530510_0477563 3300061734 Bacteria 944
306 Ga0070683_100028579
307 Ga0070658_10265433
308 Ga0070683_100000005
309 Ga0070683_100010831
310 Ga0070683_100096387
311 Ga0070683_100120921
312 Ga0070683_101852114
313 Ga0070682_100479587
314 Ga0070660_100421763
315 Ga0070674_100142476
316 Ga0070673_100723994
317 Ga0070673_101180633
318 Ga0070709_10017692
319 Ga0070709_10480201
320 Ga0070714_100008855
321 Ga0070714_100559439
322 Ga0070713_100000494
323 Ga0070713_100011536
324 Ga0070713_100287120
325 Ga0070713_102212924
326 Ga0070710_10251555
327 Ga0070710_10978710
328 Ga0070711_100055495
329 Ga0070711_100664166
330 Ga0070708_102116045
331 Ga0070662_101734656
332 Ga0068867_100122910
333 Ga0068867_100321583
334 Ga0070684_100000053
335 Ga0070684_100040384
336 Ga0070684_100212037
337 Ga0070684_100509233
338 Ga0070684_100974799
339 Ga0068853_100660146
340 Ga0070672_100303721
341 Ga0070695_100020747
342 Ga0070693_100676259
343 Ga0070665_100125479
344 Ga0070665_100330134
345 Ga0070665_100688701
346 Ga0070665_101323189
347 Ga0070665_102186331
348 Ga0068855_100121004
349 Ga0070664_100949746
350 Ga0068856_101102013
351 Ga0068852_100061579
352 Ga0068864_100411701
353 Ga0068861_100192167
354 Ga0068870_10959580
355 Ga0068863_100030718
356 Ga0068863_100812853
357 Ga0068858_100020437
358 Ga0068858_100569947
359 Ga0068858_100790923
360 Ga0068860_100560615
361 Ga0068860_100661403
362 Ga0068860_100905746
363 Ga0068860_101968178
364 Ga0070717_10148641
365 Ga0070716_100653252
366 Ga0097621_100338212
367 Ga0068865_100183377
368 Ga0075435_100614103
369 Ga0105240_10000632
370 Ga0105240_10001383
371 Ga0105240_10072456
372 Ga0105240_10080158
373 Ga0105240_10162592
374 Ga0105240_10189791
375 Ga0105240_11106080
376 Ga0105240_11469082
377 Ga0105245_10464740
378 Ga0105245_10686253
379 Ga0105247_10328654
380 Ga0105243_10106301
381 Ga0105243_11598108
382 Ga0105241_10787310
383 Ga0105241_12072049
384 Ga0105241_12145442
385 Ga0105242_10012086
386 Ga0105242_10016028
387 Ga0105242_10126981
388 Ga0105242_10468452
389 Ga0105248_10023114
390 Ga0105248_10049544
391 Ga0105248_10123879
392 Ga0105248_10193666
393 Ga0105248_12322892
394 Ga0105237_10008899
395 Ga0105237_10260460
396 Ga0105237_10309939
397 Ga0105237_10698607
398 Ga0105237_10907768
399 Ga0105237_11328154
400 Ga0105238_10346272
401 Ga0105238_10349110
402 Ga0105238_10690511
403 Ga0105249_10023847
404 Ga0105249_10394139
405 Ga0105239_10353500
406 Ga0105239_10530347
407 Ga0105239_10619318
408 Ga0105246_10064288
409 Ga0105246_10110678
410 Ga0157373_10863110
411 Ga0157370_10244843
412 Ga0157370_11709284
413 Ga0157369_10384857
414 Ga0157369_11011090
415 Ga0157374_10094483
416 Ga0157374_10864287
417 Ga0157378_10972751
418 Ga0157372_10830251
419 Ga0157372_11380088
420 Ga0157375_10311228
421 Ga0157375_10357398
422 Ga0157376_11196776
423 Ga0157376_12377985
424 Ga0228598_1022289
425 Ga0228598_1074189
426 Ga0207699_10076930
427 Ga0207699_10889129
428 Ga0207699_11141240
429 Ga0207699_11352576
430 Ga0207705_10692691
431 Ga0207654_10878920
432 Ga0207695_10186185
433 Ga0207695_10900670
434 Ga0207671_10699584
435 Ga0207671_11024725
436 Ga0207663_10020340
437 Ga0207657_10368196
438 Ga0207694_10321845
439 Ga0207694_10485261
440 Ga0207700_10001995
441 Ga0207700_10004047
442 Ga0207664_10015102
443 Ga0207706_11650152
444 Ga0207686_10012697
445 Ga0207686_10180274
446 Ga0207686_10275220
447 Ga0207686_10295179
448 Ga0207709_10101179
449 Ga0207704_10802596
450 Ga0207665_10897755
451 Ga0207711_10066538
452 Ga0207711_10766911
453 Ga0207711_11042758
454 Ga0207689_10215176
455 Ga0207689_10541883
456 Ga0207661_10000031
457 Ga0207661_10081049
458 Ga0207661_10082791
459 Ga0207651_11182930
460 Ga0207712_10017890
461 Ga0207712_10259404
462 Ga0207703_10027666
463 Ga0207703_10644089
464 Ga0207639_10372194
465 Ga0207641_10016406
466 Ga0207641_10796441
467 Ga0207648_10156768
468 Ga0207648_10562943
469 Ga0207676_10426440
470 Ga0207675_100131463
471 Ga0207698_10115292
472 Ga0268266_10286540
473 Ga0268266_10342684
474 Ga0268264_10477898
475 Ga0268264_10487063
476 Ga0268264_11566344
477 Ga0265770_1005644
478 Ga0265770_1005818
479 Ga0265760_10037577
480 Ga0265760_10082639
481 Ga0265760_10218001
482 Ga0265325_10012280
483 Ga0265340_10058881
484 Ga0265331_10052623
485 Ga0265316_10004502
486 Ga0265316_10051510
487 Ga0265314_10000776
488 Ga0265314_10034698
489 Ga0265342_10183147
490 Ga0307413_10730329
491 Ga0307406_11885119
492 Ga0373926_0079883
493 Ga0373926_0144293
494 Ga0373934_0016943
495 Ga0373934_0069179
496 Ga0373923_0006778
497 Ga0373953_0063963
498 Ga0373953_0242885
499 Ga0373954_0000830
500 Ga0373954_0012728
501 Ga0373954_0146225
502 Ga0373956_0078274
503 Ga0373956_0368807
504 Ga0373957_0024221
505 Ga0373957_0528948
506 Ga0373943_0304673
507 Ga0373943_0879374
508 Ga0373955_0040649
509 Ga0373955_0201864
510 Ga0373935_0031808
511 Ga0373935_0099509
512 Ga0373927_0001587
513 Ga0373927_0002104
514 Ga0373927_0051840
515 Ga0373927_0657688
516 Ga0373927_0685911
517 Ga0373933_0008817
518 Ga0373933_0534777
519 Ga0373933_1030206
520 Ga0373937_0010133
521 Ga0373937_0024338
522 Ga0373937_0140033
523 Ga0373937_0238667
524 Ga0373937_0747889
525 Ga0373937_1100224
526 Ga0373925_0027524
527 Ga0373925_0064444
528 Ga0373925_0646586
529 Ga0373925_0893536
530 Ga0373925_1211246
531 Ga0436361_1190473
532 Ga0451853_1916786
533 Ga0453684_0460004
534 Ga0451576_0250221
535 Ga0451576_0413533
536 Ga0495592_0075482
537 Ga0495651_0064344
538 Ga0495651_0253872
539 Ga0495651_0719737
540 Ga0495653_0204553
541 Ga0495580_0001837
542 Ga0495580_0082246
543 Ga0495639_0094260
544 Ga0495662_0011338
545 Ga0495608_0137478
546 Ga0495608_0172817
547 Ga0495618_0076883
548 Ga0495628_0078277
549 Ga0495628_0408258
550 Ga0495630_0032261
551 Ga0495630_0083024
552 Ga0495630_1055376
553 Ga0495652_0038463
554 Ga0495652_0252678
555 Ga0495665_0043856
556 Ga0495640_0063303
557 Ga0495586_0136974
558 Ga0495586_0762429
559 Ga0495587_0047818
560 Ga0495587_0175300
561 Ga0495587_0705726
562 Ga0495645_0032542
563 Ga0495645_0103913
564 Ga0495667_0975816
565 Ga0495634_0071442
566 Ga0495635_0040758
567 Ga0495635_0284347
568 Ga0495599_0024111
569 Ga0495623_0494651
570 Ga0495658_0920662
571 Ga0495624_0091013
572 Ga0495600_0016821
573 Ga0495600_0151790
574 Ga0495600_0522991
575 Ga0495581_0805274
576 Ga0495604_0071105
577 Ga0495604_0543857
578 Ga0495604_0963730
579 Ga0495674_0045342
580 Ga0495674_0173617
581 Ga0495674_0181193
582 Ga0495674_0209134
583 Ga0495674_0300023
584 Ga0495674_1198359
585 Ga0495680_0314829
586 Ga0495675_0054460
587 Ga0495675_0068014
588 Ga0495675_0386774
589 Ga0495675_0405610
590 Ga0495684_0001690
591 Ga0495684_0030021
592 Ga0495684_0313906
593 Ga0495684_0556266
594 Ga0495593_0358512
595 Ga0496104_0511506
596 Ga0496110_1896631
597 Ga0501233_097888
598 Ga0501249_033281
599 Ga0501259_064380
600 Ga0501268_166024
601 Ga0501280_058791
602 nmdc:mga0qj67_377477_c1
603 nmdc:mga0rr50_1001075_c1
604 Ga0495601_0103725
605 Ga0495601_0794518
606 Ga0495595_0356306
607 Ga0495619_0684543
608 Ga0500568_0001619
609 Ga0501082_0001335
610 Ga0530510_0477563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

14

142

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eve-assembly1.cif.gz_A x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 0.914 3 130
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9131 1 129
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9053 1 136
5j3e-assembly2.cif.gz_B crystal structure of human thyn1 protein in complex with 5-methylcytosine containing dna 0.9018 1 127
2g2x-assembly3.cif.gz_C x-ray crystal structure protein q88ch6 from pseudomonas putida. northeast structural genomics consortium target ppr72. 0.901 3 127
ID Description Score Start End Superfamily
af_I1JAX2_1_77_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9203 1 71 3.10.590.10
af_Q9ZVK5_4_152_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9105 2 129 3.10.590.10
af_O94645_8_177_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8993 1 129 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8963 1 132 3.10.590.10
2eveA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8837 3 130 3.10.590.10
ID Description Score Start End GO Terms
AF-A0A7C2IA37-F1-model_v4 EVE domain-containing protein 0.9983 1 132
AF-A0A7C3DS23-F1-model_v4 EVE domain-containing protein 0.9964 24 132
AF-A0A536M2D5-F1-model_v4 EVE domain-containing protein 0.9903 1 130
AF-A0A2V6EM40-F1-model_v4 EVE domain-containing protein 0.9799 2 67
AF-A0A2S6TIU4-F1-model_v4 EVE domain-containing protein 0.9765 1 66

Map