F397894

General Info

Members Datasets Scaffolds Average Seq Length
305 212 248 221

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1008066|JGI25159J45721_10080662
Length 253
Sequence MKWQCTAHHWTSQRWADAAPAAYVATQENQGIAMDLSDWKGVPRPERIVLDGRYARLEPLDAARHGEDLLASAREPGADARFRYLFEDTPADMTALSVWLDKATTSADPLFFAVVDKKTGRAEGRQALMRIDPVHGVIEIGNILWGPAIARSRVATEALYLFARYAFDTLGYRRFEWKCNNHNEPSKRAAERFGFTPEGIFRQHMVQKGRNRDSAWFAMIDADWPRLRAGYEAWLAPENFDENGQQRARLSFD

Samples

Sample ID Description Type Environment
1 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
2 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
3 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
4 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
5 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
6 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
7 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
8 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
9 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
10 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
11 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
12 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
13 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
14 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
15 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
16 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
17 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
18 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
19 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
20 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
21 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
22 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
23 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
24 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
25 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
26 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
27 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
28 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
29 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
30 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
31 2643221734 Bosea sp. Root670 Isolate Unclassified
32 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
33 2738541293 Rhizobium sp. GV031 Isolate Unclassified
34 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
35 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
36 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
37 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
38 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
39 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
40 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
41 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
42 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
43 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
44 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
45 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
46 2909042592 Labrys sp. LIt4 Isolate Nodule
47 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
48 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
49 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
50 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
51 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
52 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
53 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
54 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
55 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
56 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
57 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
58 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
59 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
60 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
61 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
62 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
63 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
64 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
65 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
66 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
67 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
68 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
69 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
70 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
102 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
143 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
144 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
197 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
198 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
199 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
200 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
201 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
202 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
203 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
206 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
207 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
208 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
209 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
210 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
211 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
212 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.31
Metatranscriptomes 0
Isolates 18.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.57
Nodule 6.23
Rhizoplane 7.87
Rhizosphere 32.79
Stem 0
Stem Tuber 0
Unclassified 27.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000200 3300001979 Bacteria 24792
2 JGI25155J39150_1000122 3300002704 Bacteria 37833
3 JGI25156J39149_1000242 3300002705 Bacteria 37833
4 JGI25162J39368_1000149 3300002737 Bacteria 76227
5 JGI25162J39368_1000545 3300002737 Bacteria 27820
6 JGI25154J39366_1000225 3300002738 Bacteria 37833
7 JGI25157J39369_1000273 3300002741 Bacteria 37833
8 JGI25150J39212_1000040 3300002774 Bacteria 84981
9 JGI25159J45721_1001427 3300002987 Bacteria 9903
10 JGI25159J45721_1008066 3300002987 Bacteria 2935
11 JGI25151J46595_10000036 3300003187 Bacteria 188770
12 JGI25151J46595_10000152 3300003187 Bacteria 90443
13 JGI25151J46595_10036354 3300003187 Bacteria 1859
14 JGI25165J46597_1000411 3300003214 Bacteria 45055
15 JGI25165J46597_1001193 3300003214 Bacteria 15766
16 JGI25165J46597_1002029 3300003214 Bacteria 7704
17 JGI25153J46596_10000022 3300003215 Bacteria 251919
18 JGI25153J46596_10024882 3300003215 Bacteria 2150
19 rootH2_10017572 3300003320 Bacteria 4553
20 rootH2_10132803 3300003320 Bacteria 1660
21 rootL2_10096032 3300003322 Bacteria 6681
22 rootH1_10122817 3300003323 Bacteria 1474
23 JGI25160J50197_1000001 3300003354 Bacteria 782301
24 JGI25161J50226_1000001 3300003374 Bacteria 655036
25 Ga0055526_1000610 3300003771 Bacteria 27782
26 Ga0055524_1000018 3300003775 Bacteria 234806
27 Ga0055543_1000152 3300004625 Bacteria 57688
28 Ga0065165_1000008 3300005262 Bacteria 334429
29 Ga0065165_1000014 3300005262 Bacteria 292366
30 Ga0070658_10274847 3300005327 Bacteria 1433
31 Ga0070658_10388237 3300005327 Bacteria 1198
32 Ga0070674_100335746 3300005356 Bacteria 1216
33 Ga0070667_100151528 3300005367 Bacteria 2037
34 Ga0070663_100184543 3300005455 Bacteria 1620
35 Ga0070665_100093773 3300005548 Bacteria 3007
36 Ga0068855_100058185 3300005563 Bacteria 4528
37 Ga0068854_100051266 3300005578 Bacteria 2956
38 Ga0068856_100039068 3300005614 Bacteria 4660
39 Ga0068852_100091515 3300005616 Bacteria 2722
40 Ga0068861_100007700 3300005719 Bacteria 7395
41 Ga0068862_100102820 3300005844 Bacteria 2501
42 Ga0081455_10269931 3300005937 Bacteria 1234
43 Ga0075365_10039591 3300006038 Plasmid 3070
44 Ga0075363_100023719 3300006048 Bacteria 3113
45 Ga0075363_100032783 3300006048 Bacteria 2701
46 Ga0075364_10000212 3300006051 Bacteria 27340
47 Ga0075367_10337953 3300006178 Bacteria 950
48 Ga0075369_10005128 3300006186 Bacteria 4879
49 Ga0075369_10248914 3300006186 Bacteria 825
50 Ga0075366_10026645 3300006195 Bacteria 3387
51 Ga0075370_10002122 3300006353 Bacteria 9051
52 Ga0075370_10005602 3300006353 Bacteria 6263
53 Ga0075370_10119298 3300006353 Bacteria 1535
54 Ga0068865_100166229 3300006881 Bacteria 1687
55 Ga0105240_10000014 3300009093 Bacteria 482033
56 Ga0105240_10007147 3300009093 Bacteria 16263
57 Ga0105240_10007812 3300009093 Bacteria 15447
58 Ga0105243_10050664 3300009148 Bacteria 3281
59 Ga0105243_10471988 3300009148 Bacteria 1182
60 Ga0105237_10001161 3300009545 Bacteria 35234
61 Ga0105239_10000405 3300010375 Bacteria 63265
62 Ga0105239_10005173 3300010375 Bacteria 15375
63 Ga0105239_11133765 3300010375 Bacteria 901
64 Ga0157370_10000015 3300013104 Bacteria 185771
65 Ga0157369_10203733 3300013105 Bacteria 2076
66 Ga0171462_1018 3300013250 Bacteria 157875
67 Ga0157378_11238744 3300013297 Bacteria 786
68 Ga0182007_10046274 3300015262 Bacteria 1441
69 Ga0182005_1006580 3300015265 Bacteria 3536
70 Ga0209435_100005 3300025206 Bacteria 573745
71 Ga0209760_101801 3300025207 Bacteria 2132
72 Ga0209437_100058 3300025233 Bacteria 357279
73 Ga0209437_100060 3300025233 Bacteria 355034
74 Ga0207425_1000046 3300025245 Bacteria 189433
75 Ga0209646_1000011 3300025246 Bacteria 573745
76 Ga0209026_1000008 3300025250 Bacteria 573745
77 Ga0209677_100897 3300025253 Bacteria 14582
78 Ga0209148_1032291 3300025254 Bacteria 772
79 Ga0209759_1000004 3300025256 Bacteria 573745
80 Ga0209129_1000170 3300025258 Bacteria 95792
81 Ga0209233_1000137 3300025261 Bacteria 200314
82 Ga0209233_1000149 3300025261 Bacteria 181183
83 Ga0209233_1000160 3300025261 Bacteria 159035
84 Ga0209455_1019903 3300025272 Bacteria 1343
85 Ga0209673_1006099 3300025273 Bacteria 5910
86 Ga0209673_1014528 3300025273 Bacteria 3043
87 Ga0209130_1000003 3300025284 Bacteria 677988
88 Ga0209130_1000024 3300025284 Bacteria 354212
89 Ga0209675_1000872 3300025291 Bacteria 19414
90 Ga0209025_1000017 3300025294 Bacteria 768983
91 Ga0209025_1000137 3300025294 Bacteria 190136
92 Ga0209025_1006499 3300025294 Bacteria 9042
93 Ga0209564_1000059 3300025295 Bacteria 328782
94 Ga0209758_1000005 3300025297 Bacteria 1368918
95 Ga0209758_1000123 3300025297 Bacteria 190136
96 Ga0209050_1048848 3300025298 Bacteria 1089
97 Ga0209050_1074179 3300025298 Bacteria 748
98 Ga0209256_1000032 3300025299 Bacteria 395041
99 Ga0207426_1000011 3300025302 Bacteria 791203
100 Ga0207426_1011167 3300025302 Bacteria 3440
101 Ga0209257_1019217 3300025304 Bacteria 2584
102 Ga0209257_1028436 3300025304 Bacteria 1840
103 Ga0207647_10176241 3300025904 Bacteria 1244
104 Ga0207695_10000037 3300025913 Bacteria 476303
105 Ga0207695_10004669 3300025913 Bacteria 18565
106 Ga0207695_10005988 3300025913 Bacteria 15901
107 Ga0207671_10007582 3300025914 Bacteria 9394
108 Ga0207709_10196148 3300025935 Bacteria 1438
109 Ga0207667_10037412 3300025949 Bacteria 5187
110 Ga0207640_10029045 3300025981 Bacteria 3389
111 Ga0207678_10136756 3300026067 Bacteria 2091
112 Ga0207675_100002399 3300026118 Bacteria 18554
113 Ga0209371_1013252 3300027312 Bacteria 2330
114 Ga0209971_1015185 3300027682 Bacteria 1825
115 Ga0268266_10259712 3300028379 Bacteria 1609
116 Ga0268256_1014509 3300030500 Bacteria 2333
117 Ga0307513_10035119 3300031456 Bacteria 5615
118 Ga0265314_10029074 3300031711 Bacteria 4112
119 Ga0307405_10004117 3300031731 Bacteria 6832
120 Ga0307412_10005919 3300031911 Bacteria 6892
121 Ga0307510_10369996 3300033180 Bacteria 880
122 Ga0436364_1137474 3300037853 Bacteria 2962
123 Ga0436365_0728156 3300039437 Bacteria 2962
124 Ga0451841_0214470 3300041498 Bacteria 1035
125 Ga0451845_0136825 3300041501 Bacteria 5113
126 Ga0451845_0161814 3300041501 Bacteria 1573
127 Ga0451849_0041417 3300041505 Bacteria 7145
128 Ga0451853_2969678 3300041512 Bacteria 4858
129 Ga0466966_0048081 3300044684 Bacteria 2718
130 Ga0466970_0008792 3300044765 Bacteria 5086
131 Ga0495638_0040401 3300046460 Bacteria 2956
132 Ga0495638_0211263 3300046460 Bacteria 1090
133 Ga0495638_0243982 3300046460 Bacteria 993
134 Ga0495650_0084808 3300046471 Bacteria 1215
135 Ga0495605_0010735 3300046474 Bacteria 5117
136 Ga0495585_0154763 3300046492 Bacteria 1193
137 Ga0495585_0260661 3300046492 Bacteria 862
138 Ga0495607_0065468 3300046501 Bacteria 2049
139 Ga0495607_0129025 3300046501 Bacteria 1318
140 Ga0495583_0002570 3300046506 Bacteria 15262
141 Ga0495606_0217668 3300046507 Bacteria 1078
142 Ga0495606_0230497 3300046507 Bacteria 1038
143 Ga0495610_0001038 3300046512 Bacteria 25516
144 Ga0495620_0117676 3300046515 Bacteria 1049
145 Ga0495632_0052012 3300046519 Bacteria 2015
146 Ga0495632_0105578 3300046519 Bacteria 1325
147 Ga0495643_0010219 3300046522 Bacteria 5783
148 Ga0495643_0019793 3300046522 Bacteria 3891
149 Ga0495648_0056727 3300046524 Bacteria 2354
150 Ga0495633_0021986 3300046558 Bacteria 3182
151 Ga0495668_0094960 3300046616 Bacteria 1632
152 Ga0495625_0008286 3300046660 Bacteria 8883
153 Ga0495625_0060252 3300046660 Bacteria 2690
154 Ga0495625_0303069 3300046660 Bacteria 1022
155 Ga0495661_0102556 3300046665 Bacteria 1608
156 Ga0495588_0024930 3300046674 Unclassified 2976
157 Ga0495672_0096489 3300047320 Bacteria 1612
158 Ga0495673_0015945 3300047469 Bacteria 3855
159 Ga0495673_0054802 3300047469 Bacteria 1733
160 Ga0495681_0069260 3300047470 Bacteria 1603
161 Ga0495686_0072851 3300047472 Bacteria 2111
162 Ga0496100_0027721 3300048903 Bacteria 3486
163 Ga0496100_0381812 3300048903 Bacteria 1070
164 Ga0496100_0434442 3300048903 Bacteria 1004
165 Ga0496101_0018096 3300048904 Bacteria 4785
166 Ga0496101_0115446 3300048904 Bacteria 2025
167 Ga0496102_0074825 3300048905 Bacteria 3113
168 Ga0496102_0263959 3300048905 Bacteria 1623
169 Ga0496103_0029517 3300048906 Bacteria 3333
170 Ga0496105_0041394 3300048908 Bacteria 3797
171 Ga0496107_0249253 3300048910 Bacteria 1321
172 Ga0496113_0055325 3300048916 Bacteria 2974
173 Ga0496113_0756807 3300048916 Bacteria 773
174 Ga0496114_0045726 3300048917 Bacteria 3638
175 Ga0496115_0070667 3300048918 Bacteria 2830
176 Ga0496116_0001842 3300048919 Bacteria 22927
177 Ga0496116_0010084 3300048919 Bacteria 7965
178 Ga0496116_0011223 3300048919 Bacteria 7439
179 Ga0496116_0026899 3300048919 Bacteria 4196
180 Ga0496116_0128036 3300048919 Bacteria 1453
181 Ga0496117_0004154 3300048920 Bacteria 16186
182 Ga0496117_0004648 3300048920 Bacteria 14942
183 Ga0496117_0005013 3300048920 Bacteria 14206
184 Ga0496117_0014100 3300048920 Bacteria 6910
185 Ga0496117_0027499 3300048920 Bacteria 4431
186 Ga0496118_0002863 3300048921 Bacteria 22510
187 Ga0496118_0006309 3300048921 Bacteria 13103
188 Ga0496118_0013787 3300048921 Bacteria 7615
189 Ga0496118_0018242 3300048921 Bacteria 6339
190 Ga0496118_0136079 3300048921 Bacteria 1568
191 Ga0496118_0305473 3300048921 Bacteria 871
192 Ga0496119_0000029 3300048922 Bacteria 243194
193 Ga0496119_0025362 3300048922 Bacteria 4143
194 Ga0496119_0045497 3300048922 Bacteria 2750
195 Ga0496119_0080287 3300048922 Bacteria 1882
196 Ga0496120_0002339 3300048923 Bacteria 19488
197 Ga0496120_0094391 3300048923 Bacteria 1592
198 Ga0496121_0000862 3300048924 Bacteria 54859
199 Ga0496121_0003295 3300048924 Bacteria 23190
200 Ga0496121_0019291 3300048924 Bacteria 6824
201 Ga0496121_0024264 3300048924 Bacteria 5808
202 Ga0496121_0034626 3300048924 Bacteria 4543
203 Ga0496121_0036801 3300048924 Bacteria 4356
204 Ga0496122_0003708 3300048925 Bacteria 19764
205 Ga0496122_0009004 3300048925 Bacteria 10607
206 Ga0496122_0015397 3300048925 Bacteria 7314
207 Ga0496122_0057404 3300048925 Bacteria 2891
208 Ga0496123_0003218 3300048926 Bacteria 18598
209 Ga0496123_0006650 3300048926 Bacteria 11147
210 Ga0496123_0058547 3300048926 Bacteria 2498
211 Ga0496123_0060934 3300048926 Bacteria 2429
212 Ga0496124_0003621 3300048927 Bacteria 18752
213 Ga0496124_0007667 3300048927 Bacteria 11416
214 Ga0496124_0043392 3300048927 Bacteria 3866
215 Ga0496124_0052537 3300048927 Bacteria 3461
216 Ga0496124_0075313 3300048927 Bacteria 2788
217 Ga0496124_0095185 3300048927 Bacteria 2421
218 Ga0496124_0096942 3300048927 Bacteria 2395
219 Ga0496124_0113640 3300048927 Bacteria 2175
220 Ga0496125_0016121 3300048928 Bacteria 7189
221 Ga0496125_0020862 3300048928 Bacteria 6132
222 Ga0496125_0106289 3300048928 Bacteria 2049
223 Ga0496125_0290029 3300048928 Bacteria 1008
224 Ga0496125_0293800 3300048928 Bacteria 999
225 Ga0496126_0003594 3300048929 Bacteria 19421
226 Ga0496126_0060947 3300048929 Bacteria 3391
227 Ga0496126_0079227 3300048929 Bacteria 2908
228 Ga0501034_0012694 3300049571 Bacteria 8692
229 Ga0501034_0067518 3300049571 Bacteria 3588
230 Ga0501076_0353330 3300049592 Bacteria 1207
231 nmdc:mga03n38_181035_c1 3300050490 Bacteria 1080
232 nmdc:mga00v17_31_c1 3300050491 Bacteria 87312
233 nmdc:mga0yw44_16955_c1 3300050492 Plasmid 3949
234 nmdc:mga06z11_144312_c1 3300050494 Bacteria 1348
235 nmdc:mga06z11_238597_c1 3300050494 Bacteria 1067
236 nmdc:mga06z11_25663_c1 3300050494 Plasmid 2795
237 nmdc:mga0sz30_15134_c1 3300050516 Bacteria 3047
238 Ga0500644_0019540 3300053088 Bacteria 2001
239 Ga0500618_003919 3300053125 Bacteria 4951
240 Ga0500618_026281 3300053125 Bacteria 1390
241 Ga0500642_0000327 3300053130 Bacteria 16582
242 Ga0500658_0179670 3300053134 Bacteria 963
243 Ga0500559_0067570 3300053136 Bacteria 1605
244 Ga0500604_0116760 3300053151 Bacteria 890
245 Ga0500622_0003608 3300053156 Bacteria 10190
246 Ga0500634_0003510 3300053161 Bacteria 6991
247 Ga0500636_0049241 3300053177 Bacteria 2479
248 Ga0500609_003933 3300053731 Bacteria 2069

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025207 Ga0209760_101801 Ga0209760_1018011 192
2 3300046471 Ga0495650_0084808 Ga0495650_0084808_518_1120 198
3 3300048927 Ga0496124_0095185 Ga0496124_0095185_1229_1828 198
4 3300005719 Ga0068861_100007700 Ga0068861_1000077003 208
5 3300026118 Ga0207675_100002399 Ga0207675_10000239915 208
6 3300046660 Ga0495625_0303069 Ga0495625_0303069_364_1002 212
7 3300048928 Ga0496125_0290029 Ga0496125_0290029_249_887 212
8 3300049571 Ga0501034_0067518 Ga0501034_0067518_1433_2080 212
9 3300003320 rootH2_10132803 rootH2_101328032 214
10 3300005356 Ga0070674_100335746 Ga0070674_1003357462 214
11 3300006048 Ga0075363_100032783 Ga0075363_1000327831 214
12 3300006195 Ga0075366_10026645 Ga0075366_100266451 214
13 3300006353 Ga0075370_10005602 Ga0075370_100056024 214
14 3300049571 Ga0501034_0012694 Ga0501034_0012694_1961_2605 214
15 3300050494 nmdc:mga06z11_144312_c1 nmdc:mga06z11_144312_c1_154_798 214
16 3300006048 Ga0075363_100023719 Ga0075363_1000237193 215
17 3300006178 Ga0075367_10337953 Ga0075367_103379532 215
18 3300006353 Ga0075370_10119298 Ga0075370_101192982 215
19 3300050490 nmdc:mga03n38_181035_c1 nmdc:mga03n38_181035_c1_230_877 215
20 3300050494 nmdc:mga06z11_238597_c1 nmdc:mga06z11_238597_c1_119_766 215
21 iso_pu_bacteria 2510461076 2510900505 215
22 iso_pu_bacteria 2513237162 2514021370 215
23 iso_pu_bacteria 2515154116 2515658015 215
24 iso_pu_bacteria 2510917022 2511131897 216
25 iso_pu_bacteria 2524023209 2524458982 216
26 iso_pu_bacteria 2582581299 2585233443 216
27 iso_pu_bacteria 2582581307 2585273939 216
28 iso_pu_bacteria 2582581308 2585279397 216
29 iso_pu_bacteria 2582581315 2585322943 216
30 iso_pu_bacteria 2582581316 2585331112 216
31 iso_pu_bacteria 2585427527 2585531118 216
32 iso_pu_bacteria 2585427530 2585552960 216
33 iso_pu_bacteria 2585427531 2585560390 216
34 iso_pu_bacteria 2585427594 2585847920 216
35 iso_pu_bacteria 2585427608 2585898583 216
36 iso_pu_bacteria 2585427609 2585903829 216
37 iso_pu_bacteria 2585428125 2587981052 216
38 iso_pu_bacteria 2615840626 2616306970 216
39 iso_pu_bacteria 2615840698 2616554582 216
40 iso_pu_bacteria 2617270742 2617384916 216
41 iso_pu_bacteria 2643221734 2644736846 216
42 iso_pu_bacteria 2667528174 2671111831 216
43 iso_pu_bacteria 2738541293 2738805026 216
44 iso_pu_bacteria 2775507266 2778173333 216
45 iso_pu_bacteria 2818991448 2819609958 216
46 iso_pu_bacteria 2818991453 2819640070 216
47 iso_pu_bacteria 2838029111 2838033268 216
48 iso_pu_bacteria 2842298080 2842298334 216
49 iso_pu_bacteria 2842357229 2842360345 216
50 iso_pu_bacteria 2842475841 2842480067 216
51 iso_pu_bacteria 2842482326 2842483743 216
52 iso_pu_bacteria 2842502639 2842505148 216
53 iso_pu_bacteria 2842509118 2842515541 216
54 iso_pu_bacteria 2852387548 2852390758 216
55 iso_pu_bacteria 2909042592 2909046432 216
56 iso_pu_bacteria 2919408235 2919410331 216
57 iso_pu_bacteria 2929199973 2929204574 216
58 iso_pu_bacteria 3005416602 3005418848 216
59 iso_pu_bacteria 3005452660 3005455022 216
60 iso_pu_bacteria 8005314921 8005318260 216
61 iso_pu_bacteria 8005484373 8005488859 216
62 iso_pu_bacteria 8005645114 8005645766 216
63 iso_pu_bacteria 8005682033 8005682553 216
64 iso_pu_bacteria 8046767195 8046770466 216
65 iso_pu_bacteria 8055909800 8055914550 216
66 iso_pu_bacteria 8057575449 8057576573 216
67 3300025298 Ga0209050_1074179 Ga0209050_10741791 218
68 3300031456 Ga0307513_10035119 Ga0307513_100351192 218
69 3300041501 Ga0451845_0161814 Ga0451845_0161814_755_1411 218
70 3300053130 Ga0500642_0000327 Ga0500642_0000327_822_1478 218
71 3300053134 Ga0500658_0179670 Ga0500658_0179670_254_910 218
72 3300053151 Ga0500604_0116760 Ga0500604_0116760_99_755 218
73 3300053161 Ga0500634_0003510 Ga0500634_0003510_5734_6498 218
74 3300053731 Ga0500609_003933 Ga0500609_003933_470_1126 218
75 iso_pu_bacteria 2600255287 2601645712 218
76 iso_pu_bacteria 2600255291 2601665478 218
77 iso_pu_bacteria 2600255298 2601698337 218
78 iso_pu_bacteria 2600255299 2601703487 218
79 iso_pu_bacteria 2600255303 2601721895 218
80 iso_pu_bacteria 2602042052 2603663600 218
81 iso_pu_bacteria 2602042053 2603668212 218
82 iso_pu_bacteria 2602042111 2603878807 218
83 iso_pu_bacteria 2603880184 2606072634 218
84 3300003215 JGI25153J46596_10000022 JGI25153J46596_10000022184 219
85 3300005937 Ga0081455_10269931 Ga0081455_102699311 219
86 3300006038 Ga0075365_10039591 Ga0075365_100395914 219
87 3300006051 Ga0075364_10000212 Ga0075364_1000021220 219
88 3300006881 Ga0068865_100166229 Ga0068865_1001662291 219
89 3300009093 Ga0105240_10007147 Ga0105240_100071476 219
90 3300009093 Ga0105240_10007812 Ga0105240_100078125 219
91 3300009148 Ga0105243_10471988 Ga0105243_104719882 219
92 3300010375 Ga0105239_10000405 Ga0105239_100004058 219
93 3300025297 Ga0209758_1000005 Ga0209758_1000005379 219
94 3300025298 Ga0209050_1048848 Ga0209050_10488481 219
95 3300025304 Ga0209257_1019217 Ga0209257_10192171 219
96 3300025913 Ga0207695_10004669 Ga0207695_1000466911 219
97 3300025913 Ga0207695_10005988 Ga0207695_100059886 219
98 3300033180 Ga0307510_10369996 Ga0307510_103699962 219
99 3300039437 Ga0436365_0728156 Ga0436365_0728156_1917_2597 219
100 3300041498 Ga0451841_0214470 Ga0451841_0214470_203_862 219
101 3300041501 Ga0451845_0136825 Ga0451845_0136825_3774_4466 219
102 3300041505 Ga0451849_0041417 Ga0451849_0041417_6011_6703 219
103 3300041512 Ga0451853_2969678 Ga0451853_2969678_2923_3615 219
104 3300046460 Ga0495638_0040401 Ga0495638_0040401_1369_2028 219
105 3300046460 Ga0495638_0243982 Ga0495638_0243982_261_953 219
106 3300046474 Ga0495605_0010735 Ga0495605_0010735_3706_4398 219
107 3300046492 Ga0495585_0154763 Ga0495585_0154763_482_1174 219
108 3300046501 Ga0495607_0065468 Ga0495607_0065468_733_1425 219
109 3300046515 Ga0495620_0117676 Ga0495620_0117676_173_865 219
110 3300046519 Ga0495632_0052012 Ga0495632_0052012_722_1414 219
111 3300046524 Ga0495648_0056727 Ga0495648_0056727_1460_2152 219
112 3300046660 Ga0495625_0008286 Ga0495625_0008286_3563_4255 219
113 3300046665 Ga0495661_0102556 Ga0495661_0102556_695_1387 219
114 3300047469 Ga0495673_0015945 Ga0495673_0015945_872_1531 219
115 3300048903 Ga0496100_0381812 Ga0496100_0381812_93_752 219
116 3300048903 Ga0496100_0434442 Ga0496100_0434442_227_886 219
117 3300048904 Ga0496101_0018096 Ga0496101_0018096_1110_1769 219
118 3300048905 Ga0496102_0263959 Ga0496102_0263959_530_1189 219
119 3300048908 Ga0496105_0041394 Ga0496105_0041394_2726_3385 219
120 3300048910 Ga0496107_0249253 Ga0496107_0249253_22_681 219
121 3300048917 Ga0496114_0045726 Ga0496114_0045726_330_1076 219
122 3300048918 Ga0496115_0070667 Ga0496115_0070667_747_1406 219
123 3300048920 Ga0496117_0014100 Ga0496117_0014100_2448_3107 219
124 3300048920 Ga0496117_0027499 Ga0496117_0027499_326_985 219
125 3300048921 Ga0496118_0006309 Ga0496118_0006309_7357_8016 219
126 3300048921 Ga0496118_0013787 Ga0496118_0013787_1429_2088 219
127 3300048922 Ga0496119_0000029 Ga0496119_0000029_237400_238059 219
128 3300048923 Ga0496120_0002339 Ga0496120_0002339_5333_5992 219
129 3300048924 Ga0496121_0000862 Ga0496121_0000862_48536_49195 219
130 3300048924 Ga0496121_0024264 Ga0496121_0024264_3554_4213 219
131 3300048929 Ga0496126_0003594 Ga0496126_0003594_13630_14289 219
132 3300050491 nmdc:mga00v17_31_c1 nmdc:mga00v17_31_c1_50184_50915 219
133 3300050492 nmdc:mga0yw44_16955_c1 nmdc:mga0yw44_16955_c1_922_1581 219
134 3300050494 nmdc:mga06z11_25663_c1 nmdc:mga06z11_25663_c1_252_911 219
135 3300053088 Ga0500644_0019540 Ga0500644_0019540_909_1595 219
136 3300053136 Ga0500559_0067570 Ga0500559_0067570_880_1566 219
137 3300053156 Ga0500622_0003608 Ga0500622_0003608_6882_7568 219
138 iso_pu_bacteria 2838042994 2838043010 219
139 3300001979 JGI24740J21852_10000200 JGI24740J21852_100002009 220
140 3300002704 JGI25155J39150_1000122 JGI25155J39150_100012211 220
141 3300002705 JGI25156J39149_1000242 JGI25156J39149_100024211 220
142 3300002737 JGI25162J39368_1000149 JGI25162J39368_100014973 220
143 3300002737 JGI25162J39368_1000545 JGI25162J39368_100054517 220
144 3300002738 JGI25154J39366_1000225 JGI25154J39366_100022511 220
145 3300002741 JGI25157J39369_1000273 JGI25157J39369_100027311 220
146 3300002774 JGI25150J39212_1000040 JGI25150J39212_10000407 220
147 3300002987 JGI25159J45721_1001427 JGI25159J45721_10014276 220
148 3300002987 JGI25159J45721_1008066 JGI25159J45721_10080662 220
149 3300003187 JGI25151J46595_10000036 JGI25151J46595_10000036148 220
150 3300003187 JGI25151J46595_10000152 JGI25151J46595_1000015283 220
151 3300003187 JGI25151J46595_10036354 JGI25151J46595_100363541 220
152 3300003214 JGI25165J46597_1000411 JGI25165J46597_100041117 220
153 3300003214 JGI25165J46597_1001193 JGI25165J46597_10011938 220
154 3300003214 JGI25165J46597_1002029 JGI25165J46597_10020298 220
155 3300003215 JGI25153J46596_10024882 JGI25153J46596_100248822 220
156 3300003320 rootH2_10017572 rootH2_100175723 220
157 3300003322 rootL2_10096032 rootL2_100960324 220
158 3300003323 rootH1_10122817 rootH1_101228172 220
159 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001222 220
160 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001543 220
161 3300003771 Ga0055526_1000610 Ga0055526_10006103 220
162 3300003775 Ga0055524_1000018 Ga0055524_100001826 220
163 3300004625 Ga0055543_1000152 Ga0055543_100015229 220
164 3300005262 Ga0065165_1000008 Ga0065165_1000008238 220
165 3300005262 Ga0065165_1000014 Ga0065165_100001475 220
166 3300005327 Ga0070658_10274847 Ga0070658_102748471 220
167 3300005327 Ga0070658_10388237 Ga0070658_103882371 220
168 3300005367 Ga0070667_100151528 Ga0070667_1001515283 220
169 3300005455 Ga0070663_100184543 Ga0070663_1001845432 220
170 3300005548 Ga0070665_100093773 Ga0070665_1000937734 220
171 3300005563 Ga0068855_100058185 Ga0068855_1000581855 220
172 3300005578 Ga0068854_100051266 Ga0068854_1000512663 220
173 3300005614 Ga0068856_100039068 Ga0068856_1000390684 220
174 3300005616 Ga0068852_100091515 Ga0068852_1000915153 220
175 3300005844 Ga0068862_100102820 Ga0068862_1001028202 220
176 3300006186 Ga0075369_10005128 Ga0075369_100051284 220
177 3300006186 Ga0075369_10248914 Ga0075369_102489141 220
178 3300006353 Ga0075370_10002122 Ga0075370_100021225 220
179 3300009093 Ga0105240_10000014 Ga0105240_10000014165 220
180 3300009148 Ga0105243_10050664 Ga0105243_100506644 220
181 3300009545 Ga0105237_10001161 Ga0105237_1000116140 220
182 3300010375 Ga0105239_10005173 Ga0105239_100051735 220
183 3300010375 Ga0105239_11133765 Ga0105239_111337652 220
184 3300013104 Ga0157370_10000015 Ga0157370_10000015165 220
185 3300013105 Ga0157369_10203733 Ga0157369_102037333 220
186 3300013250 Ga0171462_1018 Ga0171462_101876 220
187 3300013297 Ga0157378_11238744 Ga0157378_112387441 220
188 3300015262 Ga0182007_10046274 Ga0182007_100462742 220
189 3300015265 Ga0182005_1006580 Ga0182005_10065802 220
190 3300025206 Ga0209435_100005 Ga0209435_100005528 220
191 3300025233 Ga0209437_100058 Ga0209437_10005870 220
192 3300025233 Ga0209437_100060 Ga0209437_100060185 220
193 3300025245 Ga0207425_1000046 Ga0207425_1000046185 220
194 3300025246 Ga0209646_1000011 Ga0209646_1000011528 220
195 3300025250 Ga0209026_1000008 Ga0209026_1000008528 220
196 3300025253 Ga0209677_100897 Ga0209677_10089716 220
197 3300025254 Ga0209148_1032291 Ga0209148_10322911 220
198 3300025256 Ga0209759_1000004 Ga0209759_1000004528 220
199 3300025258 Ga0209129_1000170 Ga0209129_100017085 220
200 3300025261 Ga0209233_1000137 Ga0209233_1000137166 220
201 3300025261 Ga0209233_1000149 Ga0209233_1000149114 220
202 3300025261 Ga0209233_1000160 Ga0209233_100016046 220
203 3300025272 Ga0209455_1019903 Ga0209455_10199031 220
204 3300025273 Ga0209673_1006099 Ga0209673_10060992 220
205 3300025273 Ga0209673_1014528 Ga0209673_10145282 220
206 3300025284 Ga0209130_1000003 Ga0209130_1000003552 220
207 3300025284 Ga0209130_1000024 Ga0209130_1000024198 220
208 3300025291 Ga0209675_1000872 Ga0209675_100087213 220
209 3300025294 Ga0209025_1000017 Ga0209025_1000017324 220
210 3300025294 Ga0209025_1000137 Ga0209025_10001377 220
211 3300025294 Ga0209025_1006499 Ga0209025_100649910 220
212 3300025295 Ga0209564_1000059 Ga0209564_1000059158 220
213 3300025297 Ga0209758_1000123 Ga0209758_10001237 220
214 3300025299 Ga0209256_1000032 Ga0209256_100003229 220
215 3300025302 Ga0207426_1000011 Ga0207426_1000011223 220
216 3300025302 Ga0207426_1011167 Ga0207426_10111673 220
217 3300025304 Ga0209257_1028436 Ga0209257_10284362 220
218 3300025904 Ga0207647_10176241 Ga0207647_101762412 220
219 3300025913 Ga0207695_10000037 Ga0207695_10000037166 220
220 3300025914 Ga0207671_10007582 Ga0207671_100075825 220
221 3300025935 Ga0207709_10196148 Ga0207709_101961482 220
222 3300025949 Ga0207667_10037412 Ga0207667_100374124 220
223 3300025981 Ga0207640_10029045 Ga0207640_100290453 220
224 3300026067 Ga0207678_10136756 Ga0207678_101367562 220
225 3300027312 Ga0209371_1013252 Ga0209371_10132522 220
226 3300027682 Ga0209971_1015185 Ga0209971_10151852 220
227 3300028379 Ga0268266_10259712 Ga0268266_102597122 220
228 3300030500 Ga0268256_1014509 Ga0268256_10145092 220
229 3300031711 Ga0265314_10029074 Ga0265314_100290744 220
230 3300031731 Ga0307405_10004117 Ga0307405_100041177 220
231 3300031911 Ga0307412_10005919 Ga0307412_100059195 220
232 3300037853 Ga0436364_1137474 Ga0436364_1137474_2012_2698 220
233 3300044684 Ga0466966_0048081 Ga0466966_0048081_634_1296 220
234 3300044765 Ga0466970_0008792 Ga0466970_0008792_2490_3152 220
235 3300046460 Ga0495638_0211263 Ga0495638_0211263_40_729 220
236 3300046492 Ga0495585_0260661 Ga0495585_0260661_27_689 220
237 3300046501 Ga0495607_0129025 Ga0495607_0129025_569_1231 220
238 3300046506 Ga0495583_0002570 Ga0495583_0002570_6952_7614 220
239 3300046507 Ga0495606_0217668 Ga0495606_0217668_141_803 220
240 3300046507 Ga0495606_0230497 Ga0495606_0230497_47_709 220
241 3300046512 Ga0495610_0001038 Ga0495610_0001038_18921_19583 220
242 3300046519 Ga0495632_0105578 Ga0495632_0105578_459_1121 220
243 3300046522 Ga0495643_0010219 Ga0495643_0010219_3290_3952 220
244 3300046522 Ga0495643_0019793 Ga0495643_0019793_1046_1708 220
245 3300046558 Ga0495633_0021986 Ga0495633_0021986_497_1162 220
246 3300046616 Ga0495668_0094960 Ga0495668_0094960_754_1416 220
247 3300046660 Ga0495625_0060252 Ga0495625_0060252_1863_2525 220
248 3300046674 Ga0495588_0024930 Ga0495588_0024930_276_941 220
249 3300047320 Ga0495672_0096489 Ga0495672_0096489_881_1546 220
250 3300047469 Ga0495673_0054802 Ga0495673_0054802_1060_1722 220
251 3300047470 Ga0495681_0069260 Ga0495681_0069260_93_758 220
252 3300047472 Ga0495686_0072851 Ga0495686_0072851_208_870 220
253 3300048903 Ga0496100_0027721 Ga0496100_0027721_557_1219 220
254 3300048904 Ga0496101_0115446 Ga0496101_0115446_429_1091 220
255 3300048905 Ga0496102_0074825 Ga0496102_0074825_642_1304 220
256 3300048906 Ga0496103_0029517 Ga0496103_0029517_613_1275 220
257 3300048916 Ga0496113_0055325 Ga0496113_0055325_346_1008 220
258 3300048916 Ga0496113_0756807 Ga0496113_0756807_82_744 220
259 3300048919 Ga0496116_0001842 Ga0496116_0001842_16728_17390 220
260 3300048919 Ga0496116_0010084 Ga0496116_0010084_2567_3229 220
261 3300048919 Ga0496116_0011223 Ga0496116_0011223_4529_5191 220
262 3300048919 Ga0496116_0026899 Ga0496116_0026899_1938_2600 220
263 3300048919 Ga0496116_0128036 Ga0496116_0128036_678_1340 220
264 3300048920 Ga0496117_0004154 Ga0496117_0004154_1730_2392 220
265 3300048920 Ga0496117_0004648 Ga0496117_0004648_12114_12776 220
266 3300048920 Ga0496117_0005013 Ga0496117_0005013_4424_5086 220
267 3300048921 Ga0496118_0002863 Ga0496118_0002863_9035_9697 220
268 3300048921 Ga0496118_0018242 Ga0496118_0018242_883_1545 220
269 3300048921 Ga0496118_0136079 Ga0496118_0136079_738_1400 220
270 3300048921 Ga0496118_0305473 Ga0496118_0305473_175_837 220
271 3300048922 Ga0496119_0025362 Ga0496119_0025362_379_1041 220
272 3300048922 Ga0496119_0045497 Ga0496119_0045497_1212_1874 220
273 3300048922 Ga0496119_0080287 Ga0496119_0080287_936_1598 220
274 3300048923 Ga0496120_0094391 Ga0496120_0094391_288_950 220
275 3300048924 Ga0496121_0003295 Ga0496121_0003295_13494_14156 220
276 3300048924 Ga0496121_0019291 Ga0496121_0019291_528_1190 220
277 3300048924 Ga0496121_0034626 Ga0496121_0034626_3848_4510 220
278 3300048924 Ga0496121_0036801 Ga0496121_0036801_857_1519 220
279 3300048925 Ga0496122_0003708 Ga0496122_0003708_11944_12606 220
280 3300048925 Ga0496122_0009004 Ga0496122_0009004_4459_5121 220
281 3300048925 Ga0496122_0015397 Ga0496122_0015397_5306_5968 220
282 3300048925 Ga0496122_0057404 Ga0496122_0057404_2098_2760 220
283 3300048926 Ga0496123_0003218 Ga0496123_0003218_13219_13881 220
284 3300048926 Ga0496123_0006650 Ga0496123_0006650_1342_2004 220
285 3300048926 Ga0496123_0058547 Ga0496123_0058547_1582_2244 220
286 3300048926 Ga0496123_0060934 Ga0496123_0060934_1361_2023 220
287 3300048927 Ga0496124_0003621 Ga0496124_0003621_4719_5381 220
288 3300048927 Ga0496124_0007667 Ga0496124_0007667_5222_5884 220
289 3300048927 Ga0496124_0043392 Ga0496124_0043392_1935_2597 220
290 3300048927 Ga0496124_0052537 Ga0496124_0052537_2467_3129 220
291 3300048927 Ga0496124_0075313 Ga0496124_0075313_1120_1782 220
292 3300048927 Ga0496124_0096942 Ga0496124_0096942_1003_1665 220
293 3300048927 Ga0496124_0113640 Ga0496124_0113640_637_1299 220
294 3300048928 Ga0496125_0016121 Ga0496125_0016121_3488_4150 220
295 3300048928 Ga0496125_0020862 Ga0496125_0020862_780_1442 220
296 3300048928 Ga0496125_0106289 Ga0496125_0106289_1044_1706 220
297 3300048928 Ga0496125_0293800 Ga0496125_0293800_64_726 220
298 3300048929 Ga0496126_0060947 Ga0496126_0060947_510_1172 220
299 3300048929 Ga0496126_0079227 Ga0496126_0079227_1199_1861 220
300 3300049592 Ga0501076_0353330 Ga0501076_0353330_486_1169 220
301 3300050516 nmdc:mga0sz30_15134_c1 nmdc:mga0sz30_15134_c1_968_1630 220
302 3300053125 Ga0500618_003919 Ga0500618_003919_831_1493 220
303 3300053125 Ga0500618_026281 Ga0500618_026281_574_1236 220
304 3300053177 Ga0500636_0049241 Ga0500636_0049241_256_918 220
305 iso_pu_bacteria 2582581304 2585259630 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

56

196

0.8

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

71

195

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.9511 3 217
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.926 3 217
3pzj-assembly1.cif.gz_A crystal structure of a probable acetyltransferases (gnat family) from chromobacterium violaceum atcc 12472 0.8896 1 192
2zxv-assembly6.cif.gz_D crystal structure of putative acetyltransferase from t. thermophilus hb8 0.862 10 203
3pzj-assembly1.cif.gz_B crystal structure of a probable acetyltransferases (gnat family) from chromobacterium violaceum atcc 12472 0.8552 4 192
ID Description Score Start End Superfamily
3tcvA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9512 3 217 3.40.630.30
3tcvA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.926 3 217 3.40.630.30
af_P40586_15_233_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9093 4 217 3.40.630.30
af_P40586_15_233_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8773 4 217 3.40.630.30
2zxvD00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.862 10 203 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A657LVG5-F1-model_v4 GCN5 family acetyltransferase 0.9586 1 218 GO:0008999
GO:1990189
AF-A0A562NUZ8-F1-model_v4 RimJ/RimL family protein N-acetyltransferase 0.9573 1 220 GO:0008999
GO:1990189
AF-A0A562NUZ8-F1-model_v4 RimJ/RimL family protein N-acetyltransferase 0.9531 1 220 GO:0008999
GO:1990189
AF-A0A7V8B326-F1-model_v4 GNAT family N-acetyltransferase 0.9526 2 217 GO:0008999
GO:1990189
AF-A0A839PMN2-F1-model_v4 RimJ/RimL family protein N-acetyltransferase 0.9516 1 217 GO:0008999
GO:1990189

Feature Viewer

pLDDT pTM Quality
90.76 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map